Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|091110
Gene name
Locationscaffold_06:725871..727270
Strand+
Gene length (bp)1399
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 7.0E-07 13 58
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 5.9E-07 12 61
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 9.6E-06 14 57
PF13445 zf-RING_UBOX RING-type zinc-finger 2.1E-05 14 55

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|091110
MSSIPSSLSVGGECPICLDLKDINIFEVYPCGHCFCKPCLVNLQPPPNKRKISCPLCRRTFHRDLERSKLGFQPV
IYDSSNVGQVIEGINLMDKTCKTVSVKRAHNKLTKAAEEIDNDNAAKLLEAIEDFAKRIVPLFEEVELGRTRIQE
LENEQRHSSEHLTAKSRQVESLQQQCFELHSSNGVLEHKFLDALESAELLQTKTEESQRQLMEVKQSLVMREEEH
RQAIDSLKRFKISDERKSEKVRGLKREVIELSQKLRQVREVREEEQDSWMDVDQEHKPTTTAPFGTDTHLPGLSS
SNIAAADEGWNVTRNFGFEGMPRPGFGSRRDVDSKKMNRLTKKQPPGGSKASSNFPLNLDAKGRPKAAVHIGPKS
TIRVAQRF*
Coding >Agabi119p4|091110
ATGTCCTCTATCCCCTCATCGCTCTCTGTTGGTGGCGAGTGCCCCATCTGCTTGGATTTAAAAGACATCAACATT
TTCGAAGTATATCCTTGTGGACATTGCTTTTGTAAACCCTGTCTCGTCAATCTCCAACCACCACCCAATAAAAGG
AAAATCAGTTGTCCTCTATGTCGAAGGACATTCCACAGAGACCTGGAAAGAAGTAAACTTGGATTCCAACCGGTC
ATTTACGATTCGAGCAATGTCGGACAAGTCATAGAAGGGATTAACCTCATGGATAAGACGTGTAAAACGGTTAGC
GTCAAACGTGCTCATAACAAATTGACCAAGGCGGCGGAAGAGATCGATAATGATAATGCGGCTAAACTGCTTGAA
GCTATTGAAGATTTTGCGAAGCGGATAGTTCCCCTATTCGAAGAGGTAGAGCTAGGAAGAACGAGGATACAAGAA
CTTGAAAATGAGCAGCGTCACTCCTCTGAGCATCTTACAGCAAAATCACGTCAAGTTGAATCACTTCAACAACAA
TGTTTCGAACTTCATAGTTCAAACGGTGTACTCGAACATAAATTCCTTGATGCGCTGGAATCTGCCGAACTCTTA
CAAACCAAAACTGAAGAATCTCAACGGCAATTGATGGAGGTGAAACAAAGTCTTGTGATGAGAGAAGAGGAACAT
AGACAGGCCATAGATTCGTTGAAAAGGTTCAAGATCTCGGATGAAAGAAAGTCGGAGAAAGTCAGAGGTCTAAAG
AGAGAGGTGATCGAGTTGAGTCAGAAGCTGCGACAAGTGAGAGAAGTGAGAGAAGAAGAGCAGGATTCATGGATG
GATGTCGATCAAGAACATAAACCTACTACCACGGCACCTTTCGGAACCGATACTCATTTACCTGGCCTCTCGTCT
TCTAATATAGCTGCAGCAGATGAGGGATGGAATGTCACTCGAAACTTTGGATTTGAAGGCATGCCCCGACCTGGT
TTCGGTTCCAGGAGGGACGTAGACAGCAAGAAGATGAACCGTCTAACCAAAAAACAGCCACCTGGCGGCTCCAAG
GCCAGTTCGAACTTTCCCTTAAACCTCGACGCGAAAGGACGGCCAAAGGCTGCAGTTCATATCGGACCAAAGTCG
ACCATCCGGGTCGCTCAACGATTCTGA
Transcript >Agabi119p4|091110
ATGTCCTCTATCCCCTCATCGCTCTCTGTTGGTGGCGAGTGCCCCATCTGCTTGGATTTAAAAGACATCAACATT
TTCGAAGTATATCCTTGTGGACATTGCTTTTGTAAACCCTGTCTCGTCAATCTCCAACCACCACCCAATAAAAGG
AAAATCAGTTGTCCTCTATGTCGAAGGACATTCCACAGAGACCTGGAAAGAAGTAAACTTGGATTCCAACCGGTC
ATTTACGATTCGAGCAATGTCGGACAAGTCATAGAAGGGATTAACCTCATGGATAAGACGTGTAAAACGGTTAGC
GTCAAACGTGCTCATAACAAATTGACCAAGGCGGCGGAAGAGATCGATAATGATAATGCGGCTAAACTGCTTGAA
GCTATTGAAGATTTTGCGAAGCGGATAGTTCCCCTATTCGAAGAGGTAGAGCTAGGAAGAACGAGGATACAAGAA
CTTGAAAATGAGCAGCGTCACTCCTCTGAGCATCTTACAGCAAAATCACGTCAAGTTGAATCACTTCAACAACAA
TGTTTCGAACTTCATAGTTCAAACGGTGTACTCGAACATAAATTCCTTGATGCGCTGGAATCTGCCGAACTCTTA
CAAACCAAAACTGAAGAATCTCAACGGCAATTGATGGAGGTGAAACAAAGTCTTGTGATGAGAGAAGAGGAACAT
AGACAGGCCATAGATTCGTTGAAAAGGTTCAAGATCTCGGATGAAAGAAAGTCGGAGAAAGTCAGAGGTCTAAAG
AGAGAGGTGATCGAGTTGAGTCAGAAGCTGCGACAAGTGAGAGAAGTGAGAGAAGAAGAGCAGGATTCATGGATG
GATGTCGATCAAGAACATAAACCTACTACCACGGCACCTTTCGGAACCGATACTCATTTACCTGGCCTCTCGTCT
TCTAATATAGCTGCAGCAGATGAGGGATGGAATGTCACTCGAAACTTTGGATTTGAAGGCATGCCCCGACCTGGT
TTCGGTTCCAGGAGGGACGTAGACAGCAAGAAGATGAACCGTCTAACCAAAAAACAGCCACCTGGCGGCTCCAAG
GCCAGTTCGAACTTTCCCTTAAACCTCGACGCGAAAGGACGGCCAAAGGCTGCAGTTCATATCGGACCAAAGTCG
ACCATCCGGGTCGCTCAACGATTCTGA
Gene >Agabi119p4|091110
ATGTCCTCTATCCCCTCATCGCTCTCTGTTGGTGGCGAGTGCCCCATCTGCTTGGATTTAAAAGACATCAACATT
TTCGAAGTATATCCTTGTGGCAAGTCTGTTCCTTTTGCGTCCTCGACTCCCCCCGAGATATATATCTAACATATA
TAAAACGTTGTAGGACATTGCTTTTGTAAACCCTGTCTCGTCAATCTCCAACCACCACCCAATAAAAGGAAAATC
AGTTGTCCTCTATGTCGAAGGACATTCCACAGAGACCTGGAAAGAAGTAAACTTGGATTCCAACCGGTCATTTAC
GATTCGAGCAATGTCGGACAAGTCATAGAAGGGATTAACCTCATGGATAAGACGTGTAAAACGGTTAGCGTCAAA
CGTGCTCATAACAAATTGACCAAGGCGGCGGAAGAGATCGATAATGATAATGCGGTGCGCTATATAATCATATAA
TTGGTTCTCGTCCCTTTTCTCAACTAACCTTTGCGTTTGTGCGTATAGGCTAAACTGCTTGAAGCTATTGAAGAT
TTTGCGAAGCGGATAGTTCCCCTATTCGAAGAGGTAGAGCTAGGAAGAACGAGGATACAAGAACTTGAAAATGAG
CAGCGTCACTCCTCTGAGCATCTTACAGCAAAATCACGTCAAGTTGAATCACTTCAACAACAATGTTTCGAACTT
CATAGTTCAAACGGTGTACTCGAACATAAATTCCTTGATGCGCTGGAATCTGCCGAACTCTTACAAACCAAAACT
GAAGAATCTCAACGGCAATTGATGGAGGTGAAACAAAGTCTTGTGATGAGAGAAGAGGAACATAGACAGGCCATA
GATTCGTTGAAAAGGTTCAAGATCTCGGTGAGCGACATTGGTTTCACATTTCGAGCCTTGTTTGTTGATGGTAGC
TTCCTGTTTATTAGGATGAAAGAAAGTCGGAGAAAGTCAGAGGTCTAAAGAGAGAGGTGATCGAGTTGAGTCAGA
AGCTGCGACAAGTGAGAGAAGTGAGAGAAGAAGAGCAGGATTCATGGATGGTGAGAGATTTTGAATTTCGGAAGA
AAAAGTGTCTCAACTCGGCCAGGATGTCGATCAAGAACATAAACCTACTACCACGGCACCTTTCGGAACCGATAC
TCATTTACCTGGCCTCTCGTCTTCTAATATAGCTGCAGCAGATGAGGGATGGAATGTCACTCGAAACTTTGGATT
TGAAGGCATGCCCCGACCTGGTTTCGGTTCCAGGAGGGACGTAGACAGCAAGAAGATGAACCGTCTAACCAAAAA
ACAGCCACCTGGCGGCTCCAAGGCCAGTTCGAACTTTCCCTTAAACCTCGACGCGAAAGGACGGCCAAAGGCTGC
AGTTCATATCGGACCAAAGTCGACCATCCGGGTCGCTCAACGATTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail