Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|091100
Gene name
Locationscaffold_06:720674..725689
Strand+
Gene length (bp)5015
Transcript length (bp)4644
Coding sequence length (bp)4644
Protein length (aa) 1548

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13507 GATase_5 CobB/CobQ-like glutamine amidotransferase domain 1.2E-98 1282 1546
PF02769 AIRS_C AIR synthase related protein, C-terminal domain 3.2E-28 655 813
PF02769 AIRS_C AIR synthase related protein, C-terminal domain 3.2E-08 1079 1208
PF18076 FGAR-AT_N Formylglycinamide ribonucleotide amidotransferase N-terminal 1.6E-32 225 354
PF05871 ESCRT-II ESCRT-II complex subunit 2.8E-31 17 145
PF18072 FGAR-AT_linker Formylglycinamide ribonucleotide amidotransferase linker domain 1.5E-22 379 432

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2SK05|PUR4_HAHCH Phosphoribosylformylglycinamidine synthase OS=Hahella chejuensis (strain KCTC 2396) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|P38972|PUR4_YEAST Phosphoribosylformylglycinamidine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE6 PE=1 SV=2 192 1547 0.0E+00
sp|O14228|PUR4_SCHPO Probable phosphoribosylformylglycinamidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade3 PE=3 SV=1 190 1547 0.0E+00
sp|Q9HXN2|PUR4_PSEAE Phosphoribosylformylglycinamidine synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purL PE=3 SV=1 190 1545 0.0E+00
sp|Q88P16|PUR4_PSEPK Phosphoribosylformylglycinamidine synthase OS=Pseudomonas putida (strain KT2440) GN=purL PE=3 SV=1 190 1545 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2SK05|PUR4_HAHCH Phosphoribosylformylglycinamidine synthase OS=Hahella chejuensis (strain KCTC 2396) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|P38972|PUR4_YEAST Phosphoribosylformylglycinamidine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE6 PE=1 SV=2 192 1547 0.0E+00
sp|O14228|PUR4_SCHPO Probable phosphoribosylformylglycinamidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade3 PE=3 SV=1 190 1547 0.0E+00
sp|Q9HXN2|PUR4_PSEAE Phosphoribosylformylglycinamidine synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purL PE=3 SV=1 190 1545 0.0E+00
sp|Q88P16|PUR4_PSEPK Phosphoribosylformylglycinamidine synthase OS=Pseudomonas putida (strain KT2440) GN=purL PE=3 SV=1 190 1545 0.0E+00
sp|Q4KHS6|PUR4_PSEF5 Phosphoribosylformylglycinamidine synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=purL PE=3 SV=1 190 1545 0.0E+00
sp|Q3KHL4|PUR4_PSEPF Phosphoribosylformylglycinamidine synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=purL PE=3 SV=1 190 1545 0.0E+00
sp|Q5QWY0|PUR4_IDILO Phosphoribosylformylglycinamidine synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q3IHZ2|PUR4_PSEHT Phosphoribosylformylglycinamidine synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q4ZX02|PUR4_PSEU2 Phosphoribosylformylglycinamidine synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=purL PE=3 SV=1 190 1545 0.0E+00
sp|Q47XX7|PUR4_COLP3 Phosphoribosylformylglycinamidine synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=purL PE=3 SV=2 193 1547 0.0E+00
sp|Q0HKU9|PUR4_SHESM Phosphoribosylformylglycinamidine synthase OS=Shewanella sp. (strain MR-4) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q48LX3|PUR4_PSE14 Phosphoribosylformylglycinamidine synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=purL PE=3 SV=2 190 1545 0.0E+00
sp|Q6LU24|PUR4_PHOPR Phosphoribosylformylglycinamidine synthase OS=Photobacterium profundum GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q8EC57|PUR4_SHEON Phosphoribosylformylglycinamidine synthase OS=Shewanella oneidensis (strain MR-1) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q0HX47|PUR4_SHESR Phosphoribosylformylglycinamidine synthase OS=Shewanella sp. (strain MR-7) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q886W6|PUR4_PSESM Phosphoribosylformylglycinamidine synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=purL PE=3 SV=1 190 1545 0.0E+00
sp|Q7N1Z4|PUR4_PHOLL Phosphoribosylformylglycinamidine synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=purL PE=3 SV=2 190 1547 0.0E+00
sp|Q87RW0|PUR4_VIBPA Phosphoribosylformylglycinamidine synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purL PE=3 SV=1 190 1543 0.0E+00
sp|Q65RJ7|PUR4_MANSM Phosphoribosylformylglycinamidine synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=purL PE=3 SV=1 192 1545 0.0E+00
sp|Q9KTN2|PUR4_VIBCH Phosphoribosylformylglycinamidine synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q0I5H4|PUR4_HAES1 Phosphoribosylformylglycinamidine synthase OS=Haemophilus somnus (strain 129Pt) GN=purL PE=3 SV=1 192 1547 0.0E+00
sp|Q1H2I8|PUR4_METFK Phosphoribosylformylglycinamidine synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=purL PE=3 SV=2 190 1547 0.0E+00
sp|Q7MN70|PUR4_VIBVY Phosphoribosylformylglycinamidine synthase OS=Vibrio vulnificus (strain YJ016) GN=purL PE=3 SV=2 190 1543 0.0E+00
sp|Q8DF81|PUR4_VIBVU Phosphoribosylformylglycinamidine synthase OS=Vibrio vulnificus (strain CMCP6) GN=purL PE=3 SV=1 190 1543 0.0E+00
sp|Q9CLW4|PUR4_PASMU Phosphoribosylformylglycinamidine synthase OS=Pasteurella multocida (strain Pm70) GN=purL PE=3 SV=1 190 1544 0.0E+00
sp|Q12PR7|PUR4_SHEDO Phosphoribosylformylglycinamidine synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q15R69|PUR4_PSEA6 Phosphoribosylformylglycinamidine synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q8XA46|PUR4_ECO57 Phosphoribosylformylglycinamidine synthase OS=Escherichia coli O157:H7 GN=purL PE=3 SV=3 190 1547 0.0E+00
sp|Q085S1|PUR4_SHEFN Phosphoribosylformylglycinamidine synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q5E749|PUR4_VIBF1 Phosphoribosylformylglycinamidine synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=purL PE=3 SV=1 190 1543 0.0E+00
sp|P74881|PUR4_SALTY Phosphoribosylformylglycinamidine synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=purL PE=1 SV=3 190 1547 0.0E+00
sp|Q8Z4L6|PUR4_SALTI Phosphoribosylformylglycinamidine synthase OS=Salmonella typhi GN=purL PE=3 SV=3 190 1547 0.0E+00
sp|Q1R8H7|PUR4_ECOUT Phosphoribosylformylglycinamidine synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=purL PE=3 SV=3 190 1547 0.0E+00
sp|Q3YYZ8|PUR4_SHISS Phosphoribosylformylglycinamidine synthase OS=Shigella sonnei (strain Ss046) GN=purL PE=3 SV=3 190 1547 0.0E+00
sp|P15254|PUR4_ECOLI Phosphoribosylformylglycinamidine synthase OS=Escherichia coli (strain K12) GN=purL PE=1 SV=3 190 1547 0.0E+00
sp|Q31XT0|PUR4_SHIBS Phosphoribosylformylglycinamidine synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=purL PE=3 SV=3 190 1547 0.0E+00
sp|Q8ZCQ2|PUR4_YERPE Phosphoribosylformylglycinamidine synthase OS=Yersinia pestis GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q1C5E7|PUR4_YERPA Phosphoribosylformylglycinamidine synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=purL PE=3 SV=2 190 1547 0.0E+00
sp|Q32D15|PUR4_SHIDS Phosphoribosylformylglycinamidine synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=purL PE=3 SV=3 190 1547 0.0E+00
sp|Q667W1|PUR4_YERPS Phosphoribosylformylglycinamidine synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q0TET1|PUR4_ECOL5 Phosphoribosylformylglycinamidine synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=purL PE=3 SV=3 190 1547 0.0E+00
sp|Q6D238|PUR4_PECAS Phosphoribosylformylglycinamidine synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q8FF26|PUR4_ECOL6 Phosphoribosylformylglycinamidine synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=purL PE=3 SV=3 190 1547 0.0E+00
sp|Q5PIG8|PUR4_SALPA Phosphoribosylformylglycinamidine synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=purL PE=3 SV=3 190 1547 0.0E+00
sp|Q1CKD2|PUR4_YERPN Phosphoribosylformylglycinamidine synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=purL PE=3 SV=2 190 1547 0.0E+00
sp|Q57LE6|PUR4_SALCH Phosphoribosylformylglycinamidine synthase OS=Salmonella choleraesuis (strain SC-B67) GN=purL PE=3 SV=3 190 1547 0.0E+00
sp|Q4QME6|PUR4_HAEI8 Phosphoribosylformylglycinamidine synthase OS=Haemophilus influenzae (strain 86-028NP) GN=purL PE=3 SV=2 218 1544 0.0E+00
sp|P43847|PUR4_HAEIN Phosphoribosylformylglycinamidine synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purL PE=3 SV=1 218 1544 0.0E+00
sp|Q1D9V4|PUR4_MYXXD Phosphoribosylformylglycinamidine synthase OS=Myxococcus xanthus (strain DK 1622) GN=purL PE=3 SV=2 190 1547 0.0E+00
sp|Q2NS22|PUR4_SODGM Phosphoribosylformylglycinamidine synthase OS=Sodalis glossinidius (strain morsitans) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q8XYN6|PUR4_RALSO Phosphoribosylformylglycinamidine synthase OS=Ralstonia solanacearum (strain GMI1000) GN=purL PE=3 SV=1 189 1547 0.0E+00
sp|Q9JWC5|PUR4_NEIMA Phosphoribosylformylglycinamidine synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=purL PE=3 SV=1 251 1547 0.0E+00
sp|Q5F7J4|PUR4_NEIG1 Phosphoribosylformylglycinamidine synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=purL PE=3 SV=2 251 1547 0.0E+00
sp|Q9JXK5|PUR4_NEIMB Phosphoribosylformylglycinamidine synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=purL PE=3 SV=1 251 1547 0.0E+00
sp|Q8PGR7|PUR4_XANAC Phosphoribosylformylglycinamidine synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q8PCQ7|PUR4_XANCP Phosphoribosylformylglycinamidine synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q87DN2|PUR4_XYLFT Phosphoribosylformylglycinamidine synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q9PDF6|PUR4_XYLFA Phosphoribosylformylglycinamidine synthase OS=Xylella fastidiosa (strain 9a5c) GN=purL PE=3 SV=1 190 1547 0.0E+00
sp|Q9M8D3|PUR4_ARATH Probable phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=At1g74260 PE=2 SV=3 276 1545 0.0E+00
sp|Q54JC8|PUR4_DICDI Phosphoribosylformylglycinamidine synthase OS=Dictyostelium discoideum GN=purL PE=1 SV=1 279 1546 0.0E+00
sp|Q5SUR0|PUR4_MOUSE Phosphoribosylformylglycinamidine synthase OS=Mus musculus GN=Pfas PE=1 SV=1 189 1545 0.0E+00
sp|O15067|PUR4_HUMAN Phosphoribosylformylglycinamidine synthase OS=Homo sapiens GN=PFAS PE=1 SV=4 263 1545 0.0E+00
sp|P35421|PUR4_DROME Phosphoribosylformylglycinamidine synthase OS=Drosophila melanogaster GN=ade2 PE=1 SV=2 281 1546 0.0E+00
sp|Q19311|PUR4_CAEEL Probable phosphoribosylformylglycinamidine synthase OS=Caenorhabditis elegans GN=F10F2.2 PE=3 SV=3 305 1546 0.0E+00
sp|Q9QR70|ORF75_HHV8P Protein ORF75 OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF75 PE=4 SV=1 779 1545 2.0E-41
sp|Q6KZR2|PURL_PICTO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=purL PE=3 SV=1 388 1233 9.0E-37
sp|Q9HJA4|PURL_THEAC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=purL PE=3 SV=1 378 1233 2.0E-35
sp|Q5Z2C3|PURL_NOCFA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Nocardia farcinica (strain IFM 10152) GN=purL PE=3 SV=1 365 1174 8.0E-34
sp|P03179|MTP_EBVB9 Major tegument protein OS=Epstein-Barr virus (strain B95-8) GN=BNRF1 PE=1 SV=1 849 1545 1.0E-33
sp|Q3KSV4|MTP_EBVG Major tegument protein OS=Epstein-Barr virus (strain GD1) GN=BNRF1 PE=3 SV=1 849 1545 1.0E-33
sp|P0A5T9|PURL_MYCBO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=purL PE=3 SV=1 400 1201 1.0E-33
sp|P9WHL6|PURL_MYCTO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=purL PE=3 SV=2 400 1201 1.0E-33
sp|P9WHL7|PURL_MYCTU Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=purL PE=1 SV=2 400 1201 2.0E-33
sp|A5U0J2|PURL_MYCTA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=purL PE=3 SV=2 400 1201 2.0E-33
sp|C1ALD8|PURL_MYCBT Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=purL PE=3 SV=2 400 1201 2.0E-33
sp|A1KGT6|PURL_MYCBP Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=purL PE=3 SV=2 400 1201 2.0E-33
sp|P11282|VP75_SHV21 Probable membrane antigen 75 OS=Saimiriine herpesvirus 2 (strain 11) GN=75 PE=4 SV=1 873 1546 2.0E-33
sp|Q50023|PURL_MYCLE Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium leprae (strain TN) GN=purL PE=3 SV=1 400 1201 3.0E-33
sp|B8ZSV5|PURL_MYCLB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium leprae (strain Br4923) GN=purL PE=3 SV=1 400 1201 3.0E-33
sp|Q1HVJ0|MTP_EBVA8 Major tegument protein OS=Epstein-Barr virus (strain AG876) GN=BNRF1 PE=3 SV=1 849 1545 5.0E-33
sp|Q97BD5|PURL_THEVO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=purL PE=3 SV=1 379 1165 7.0E-32
sp|A1TFE0|PURL_MYCVP Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=purL PE=3 SV=1 400 1214 1.0E-31
sp|A0QAT1|PURL_MYCA1 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium avium (strain 104) GN=purL PE=3 SV=1 400 1201 2.0E-30
sp|Q743F0|PURL_MYCPA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=purL PE=3 SV=1 400 1201 3.0E-30
sp|O36422|VP75_ALHV1 Probable membrane antigen 75 OS=Alcelaphine herpesvirus 1 (strain C500) GN=75 PE=4 SV=1 869 1546 1.0E-29
sp|B9KZ38|PURL_THERP Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=purL PE=3 SV=1 394 1212 3.0E-29
sp|Q6M0U0|PURQ_METMP Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Methanococcus maripaludis (strain S2 / LL) GN=purQ PE=3 SV=1 1283 1527 8.0E-29
sp|A6VIG8|PURQ_METM7 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=purQ PE=3 SV=1 1283 1527 9.0E-29
sp|C3NEN0|PURL_SULIY Phosphoribosylformylglycinamidine synthase subunit PurL OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=purL PE=3 SV=1 386 1171 2.0E-28
sp|C3NH14|PURL_SULIN Phosphoribosylformylglycinamidine synthase subunit PurL OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=purL PE=3 SV=1 386 1171 2.0E-28
sp|C3MQF3|PURL_SULIL Phosphoribosylformylglycinamidine synthase subunit PurL OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=purL PE=3 SV=1 386 1171 2.0E-28
sp|Q9RKK5|PURL_STRCO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=purL PE=3 SV=1 361 1201 6.0E-28
sp|A4T7J3|PURL_MYCGI Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium gilvum (strain PYR-GCK) GN=purL PE=3 SV=1 400 1214 7.0E-28
sp|A9WV65|PURL_RENSM Phosphoribosylformylglycinamidine synthase subunit PurL OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=purL PE=3 SV=1 409 1193 8.0E-28
sp|Q9UX24|PURL_SULSO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=purL PE=3 SV=1 386 1211 8.0E-28
sp|Q82FW4|PURL_STRAW Phosphoribosylformylglycinamidine synthase subunit PurL OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=purL PE=3 SV=1 361 1201 8.0E-28
sp|C3MW31|PURL_SULIM Phosphoribosylformylglycinamidine synthase subunit PurL OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=purL PE=3 SV=1 386 1171 9.0E-28
sp|C3N674|PURL_SULIA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Sulfolobus islandicus (strain M.16.27) GN=purL PE=3 SV=1 386 1171 1.0E-27
sp|C4KHN7|PURL_SULIK Phosphoribosylformylglycinamidine synthase subunit PurL OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=purL PE=3 SV=1 386 1171 1.0E-27
sp|A4G010|PURQ_METM5 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=purQ PE=3 SV=1 1283 1527 2.0E-27
sp|Q9RHW9|PURL_CORAM Phosphoribosylformylglycinamidine synthase subunit PurL OS=Corynebacterium ammoniagenes GN=purL PE=3 SV=1 388 1236 2.0E-27
sp|Q47TL8|PURL_THEFY Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermobifida fusca (strain YX) GN=purL PE=3 SV=1 409 1236 2.0E-27
sp|Q9HIM1|PURQ_THEAC Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=purQ PE=3 SV=2 1283 1512 3.0E-27
sp|C0ZP44|PURL_RHOE4 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=purL PE=3 SV=1 367 1236 3.0E-27
sp|B1MHY1|PURL_MYCA9 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=purL PE=3 SV=1 400 1191 1.0E-26
sp|Q6L0V9|PURQ_PICTO Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=purQ PE=3 SV=1 1284 1542 2.0E-26
sp|Q3Z9H5|PURQ_DEHM1 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=purQ PE=3 SV=1 1284 1545 2.0E-26
sp|Q58660|PURL_METJA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=purL PE=3 SV=1 406 1240 8.0E-26
sp|Q0S766|PURL_RHOJR Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodococcus jostii (strain RHA1) GN=purL PE=3 SV=1 365 1201 1.0E-25
sp|B0K3Q4|PURL_THEPX Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermoanaerobacter sp. (strain X514) GN=purL PE=3 SV=1 407 1154 2.0E-25
sp|Q4JXF0|PURL_CORJK Phosphoribosylformylglycinamidine synthase subunit PurL OS=Corynebacterium jeikeium (strain K411) GN=purL PE=3 SV=2 371 1145 3.0E-25
sp|Q7NIR9|PURL_GLOVI Phosphoribosylformylglycinamidine synthase subunit PurL OS=Gloeobacter violaceus (strain PCC 7421) GN=purL PE=3 SV=1 409 1174 3.0E-25
sp|Q97C36|PURQ_THEVO Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=purQ PE=3 SV=1 1283 1512 3.0E-25
sp|Q4FLJ4|PURL_PELUB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Pelagibacter ubique (strain HTCC1062) GN=purL PE=3 SV=1 433 1208 8.0E-25
sp|Q8RBK5|PURL_CALS4 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=purL PE=3 SV=1 407 1239 9.0E-25
sp|B0KBQ5|PURL_THEP3 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=purL PE=3 SV=1 407 1154 9.0E-25
sp|Q66675|VG75_EHV2 Probable membrane antigen 75 OS=Equine herpesvirus 2 (strain 86/87) GN=75 PE=4 SV=1 771 1541 1.0E-24
sp|Q8ZZJ7|PURL_PYRAE Phosphoribosylformylglycinamidine synthase subunit PurL OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=purL PE=3 SV=1 388 834 1.0E-24
sp|Q8FMM3|PURL_COREF Phosphoribosylformylglycinamidine synthase subunit PurL OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=purL PE=3 SV=1 400 1236 1.0E-24
sp|O59621|PURL_PYRHO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purL PE=3 SV=1 510 1240 3.0E-24
sp|Q83FE8|PURL_TROWT Phosphoribosylformylglycinamidine synthase subunit PurL OS=Tropheryma whipplei (strain Twist) GN=purL PE=3 SV=2 402 1157 3.0E-24
sp|Q83H66|PURL_TROW8 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Tropheryma whipplei (strain TW08/27) GN=purL PE=3 SV=1 402 1157 3.0E-24
sp|C1ATA2|PURL_RHOOB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodococcus opacus (strain B4) GN=purL PE=3 SV=1 365 1201 5.0E-24
sp|C6A0I0|PURL_THESM Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=purL PE=3 SV=1 506 1188 6.0E-24
sp|C3PIW7|PURL_CORA7 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=purL PE=3 SV=1 400 1236 2.0E-23
sp|Q5SMH8|PURL_THET8 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=purL PE=1 SV=1 409 1233 6.0E-23
sp|Q72IH7|PURL_THET2 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=purL PE=3 SV=1 409 1233 6.0E-23
sp|Q5V2D3|PURL_HALMA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=purL PE=3 SV=1 409 1178 9.0E-23
sp|Q6ACC3|PURL_LEIXX Phosphoribosylformylglycinamidine synthase subunit PurL OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=purL PE=3 SV=1 388 1200 9.0E-23
sp|B4UIX7|PURL_ANASK Phosphoribosylformylglycinamidine synthase subunit PurL OS=Anaeromyxobacter sp. (strain K) GN=purL PE=3 SV=1 390 1142 1.0E-22
sp|A4QGY6|PURL_CORGB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Corynebacterium glutamicum (strain R) GN=purL PE=3 SV=1 400 1236 2.0E-22
sp|Q1WU59|PURL_LACS1 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactobacillus salivarius (strain UCC118) GN=purL PE=3 SV=1 420 1153 2.0E-22
sp|O29008|PURQ_ARCFU Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=purQ PE=3 SV=1 1284 1511 2.0E-22
sp|A6X1J9|PURL_OCHA4 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=purL PE=3 SV=1 389 1211 3.0E-22
sp|A8LCI3|PURL_FRASN Phosphoribosylformylglycinamidine synthase subunit PurL OS=Frankia sp. (strain EAN1pec) GN=purL PE=3 SV=1 388 1201 3.0E-22
sp|A4WMV7|PURL_PYRAR Phosphoribosylformylglycinamidine synthase subunit PurL OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=purL PE=3 SV=1 388 802 3.0E-22
sp|Q2J4M9|PURL_FRASC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Frankia sp. (strain CcI3) GN=purL PE=3 SV=1 394 1194 4.0E-22
sp|Q8TX85|PURQ_METKA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=purQ PE=3 SV=1 1284 1546 5.0E-22
sp|Q3AD64|PURL_CARHZ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=purL PE=3 SV=1 409 1233 5.0E-22
sp|O28339|PURL_ARCFU Phosphoribosylformylglycinamidine synthase subunit PurL OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=purL PE=3 SV=1 378 1160 6.0E-22
sp|A6UX13|PURL_META3 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=purL PE=3 SV=1 409 855 8.0E-22
sp|Q9REQ6|PURL_ZYMMO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=purL PE=3 SV=2 390 1150 9.0E-22
sp|Q8U491|PURL_PYRFU Phosphoribosylformylglycinamidine synthase subunit PurL OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=purL PE=3 SV=1 510 898 1.0E-21
sp|A7HIJ4|PURL_ANADF Phosphoribosylformylglycinamidine synthase subunit PurL OS=Anaeromyxobacter sp. (strain Fw109-5) GN=purL PE=3 SV=1 409 1142 3.0E-21
sp|A2BTV9|PURL_PROM5 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Prochlorococcus marinus (strain MIT 9515) GN=purL PE=3 SV=1 409 1168 3.0E-21
sp|Q8NMI5|PURL_CORGL Phosphoribosylformylglycinamidine synthase subunit PurL OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=purL PE=3 SV=1 400 1236 5.0E-21
sp|A8MCK2|PURL_CALMQ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=purL PE=3 SV=1 388 896 6.0E-21
sp|Q6NWF4|VPS25_DANRE Vacuolar protein-sorting-associated protein 25 OS=Danio rerio GN=vps25 PE=2 SV=2 12 183 6.0E-21
sp|Q01000|VP03_SHV21 Probable membrane antigen 3 OS=Saimiriine herpesvirus 2 (strain 11) GN=3 PE=4 SV=1 845 1545 6.0E-21
sp|Q8YGN1|PURL_BRUME Phosphoribosylformylglycinamidine synthase subunit PurL OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=purL PE=3 SV=1 389 1233 1.0E-20
sp|C0RIH1|PURL_BRUMB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=purL PE=3 SV=1 389 1233 1.0E-20
sp|Q57DR8|PURL_BRUAB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Brucella abortus biovar 1 (strain 9-941) GN=purL PE=3 SV=1 389 1233 1.0E-20
sp|Q2YNG6|PURL_BRUA2 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Brucella abortus (strain 2308) GN=purL PE=3 SV=1 389 1233 1.0E-20
sp|B2S573|PURL_BRUA1 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Brucella abortus (strain S19) GN=purL PE=3 SV=1 389 1233 1.0E-20
sp|A2RJW3|PURL_LACLM Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=purL PE=3 SV=1 506 1153 1.0E-20
sp|Q9ZB06|PURL_LACLC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactococcus lactis subsp. cremoris GN=purL PE=3 SV=1 506 1153 1.0E-20
sp|A1SPT8|PURL_NOCSJ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Nocardioides sp. (strain BAA-499 / JS614) GN=purL PE=3 SV=1 400 1236 1.0E-20
sp|A8I8B0|PURL_AZOC5 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=purL PE=3 SV=1 389 1169 1.0E-20
sp|Q7V3R5|PURL_PROMP Phosphoribosylformylglycinamidine synthase subunit PurL OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=purL PE=3 SV=1 400 1184 1.0E-20
sp|Q6A6C0|PURL_PROAC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=purL PE=3 SV=1 394 1168 2.0E-20
sp|Q8G183|PURL_BRUSU Phosphoribosylformylglycinamidine synthase subunit PurL OS=Brucella suis biovar 1 (strain 1330) GN=purL PE=3 SV=1 389 1233 2.0E-20
sp|B0CLG4|PURL_BRUSI Phosphoribosylformylglycinamidine synthase subunit PurL OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=purL PE=3 SV=1 389 1233 2.0E-20
sp|A5VQ15|PURL_BRUO2 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=purL PE=3 SV=1 389 1233 2.0E-20
sp|A9MAL4|PURL_BRUC2 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=purL PE=3 SV=1 389 1233 2.0E-20
sp|Q73MV2|PURQ_TREDE Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=purQ PE=3 SV=1 1282 1530 3.0E-20
sp|Q02Y55|PURL_LACLS Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=purL PE=3 SV=1 506 1153 4.0E-20
sp|A0AJM3|PURL_LISW6 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=purL PE=3 SV=1 407 1168 4.0E-20
sp|Q8Y6C1|PURL_LISMO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=purL PE=3 SV=1 407 1168 5.0E-20
sp|Q66609|VP03_EHV2 Probable membrane antigen 3 OS=Equine herpesvirus 2 (strain 86/87) GN=3 PE=4 SV=1 870 1545 7.0E-20
sp|Q833Y9|PURL_ENTFA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=purL PE=3 SV=1 508 1152 1.0E-19
sp|B8DDY8|PURL_LISMH Phosphoribosylformylglycinamidine synthase subunit PurL OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=purL PE=3 SV=1 407 1168 1.0E-19
sp|Q92AN9|PURL_LISIN Phosphoribosylformylglycinamidine synthase subunit PurL OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=purL PE=3 SV=1 407 1168 1.0E-19
sp|Q2RWI3|PURL_RHORT Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=purL PE=3 SV=1 402 1171 1.0E-19
sp|Q71YP9|PURL_LISMF Phosphoribosylformylglycinamidine synthase subunit PurL OS=Listeria monocytogenes serotype 4b (strain F2365) GN=purL PE=3 SV=1 407 1168 2.0E-19
sp|C1KW68|PURL_LISMC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=purL PE=3 SV=1 407 1168 2.0E-19
sp|Q9X0X3|PURL_THEMA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purL PE=1 SV=1 409 807 2.0E-19
sp|Q9CFE8|PURL_LACLA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=purL PE=3 SV=1 506 1171 2.0E-19
sp|Q2IHC1|PURL_ANADE Phosphoribosylformylglycinamidine synthase subunit PurL OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=purL PE=3 SV=1 390 1151 4.0E-19
sp|Q11IV2|PURL_CHESB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Chelativorans sp. (strain BNC1) GN=purL PE=3 SV=1 390 1150 4.0E-19
sp|Q8PTB0|PURQ_METMA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=purQ PE=3 SV=1 1284 1511 5.0E-19
sp|B1YBM5|PURL_PYRNV Phosphoribosylformylglycinamidine synthase subunit PurL OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=purL PE=3 SV=1 408 833 6.0E-19
sp|Q07R72|PURL_RHOP5 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodopseudomonas palustris (strain BisA53) GN=purL PE=3 SV=1 390 1202 6.0E-19
sp|Q18FM4|PURQ_HALWD Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=purQ PE=3 SV=1 1285 1516 6.0E-19
sp|A1RQQ2|PURL_PYRIL Phosphoribosylformylglycinamidine synthase subunit PurL OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=purL PE=3 SV=1 409 817 7.0E-19
sp|Q3M6Z4|PURL_ANAVT Phosphoribosylformylglycinamidine synthase subunit PurL OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=purL PE=3 SV=1 409 1183 8.0E-19
sp|B3Q7H9|PURL_RHOPT Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodopseudomonas palustris (strain TIE-1) GN=purL PE=3 SV=1 389 1202 8.0E-19
sp|C4L299|PURL_EXISA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=purL PE=3 SV=1 400 1168 9.0E-19
sp|B8JBS8|PURL_ANAD2 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=purL PE=3 SV=1 409 1151 9.0E-19
sp|Q98NN7|PURL_RHILO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhizobium loti (strain MAFF303099) GN=purL PE=3 SV=1 389 1171 9.0E-19
sp|A3MXD4|PURL_PYRCJ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=purL PE=3 SV=1 409 815 1.0E-18
sp|Q037U9|PURL_LACC3 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactobacillus casei (strain ATCC 334) GN=purL PE=3 SV=1 379 1152 1.0E-18
sp|Q5WJ86|PURL_BACSK Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus clausii (strain KSM-K16) GN=purL PE=3 SV=1 505 1152 1.0E-18
sp|A8G1Z0|PURL_PROM2 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Prochlorococcus marinus (strain MIT 9215) GN=purL PE=3 SV=1 409 1153 1.0E-18
sp|Q6FZI9|PURL_BARQU Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bartonella quintana (strain Toulouse) GN=purL PE=3 SV=1 400 1184 1.0E-18
sp|Q218N3|PURL_RHOPB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodopseudomonas palustris (strain BisB18) GN=purL PE=3 SV=1 390 1169 2.0E-18
sp|B0C6R3|PURL_ACAM1 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Acaryochloris marina (strain MBIC 11017) GN=purL PE=3 SV=1 390 1152 2.0E-18
sp|Q6AX45|VPS25_XENLA Vacuolar protein-sorting-associated protein 25 OS=Xenopus laevis GN=vps25 PE=2 SV=1 11 183 2.0E-18
sp|A2BNC9|PURL_PROMS Phosphoribosylformylglycinamidine synthase subunit PurL OS=Prochlorococcus marinus (strain AS9601) GN=purL PE=3 SV=1 409 1153 2.0E-18
sp|Q6N9F2|PURL_RHOPA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=purL PE=3 SV=1 389 1202 2.0E-18
sp|C5D4I0|PURL_GEOSW Phosphoribosylformylglycinamidine synthase subunit PurL OS=Geobacillus sp. (strain WCH70) GN=purL PE=3 SV=1 409 1233 2.0E-18
sp|B7IUV3|PURL_BACC2 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus cereus (strain G9842) GN=purL PE=3 SV=1 409 1153 2.0E-18
sp|B9KZ37|PURQ_THERP Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=purQ PE=3 SV=1 1335 1511 3.0E-18
sp|A3PA50|PURL_PROM0 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Prochlorococcus marinus (strain MIT 9301) GN=purL PE=3 SV=1 409 1206 3.0E-18
sp|A9VRF1|PURL_BACWK Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus weihenstephanensis (strain KBAB4) GN=purL PE=3 SV=1 409 1153 3.0E-18
sp|B8HRP1|PURL_CYAP4 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=purL PE=3 SV=1 409 1154 4.0E-18
sp|Q3ST22|PURL_NITWN Phosphoribosylformylglycinamidine synthase subunit PurL OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=purL PE=3 SV=1 389 1147 4.0E-18
sp|Q92PH7|PURL_RHIME Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhizobium meliloti (strain 1021) GN=purL PE=3 SV=1 389 1171 4.0E-18
sp|Q31DI1|PURL_PROM9 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Prochlorococcus marinus (strain MIT 9312) GN=purL PE=3 SV=1 399 1153 5.0E-18
sp|Q81IQ3|PURL_BACCR Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=purL PE=3 SV=1 409 1153 5.0E-18
sp|A7HWB1|PURL_PARL1 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=purL PE=3 SV=1 389 1233 5.0E-18
sp|A9IVH5|PURL_BART1 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=purL PE=3 SV=1 400 1171 5.0E-18
sp|O67691|PURL_AQUAE Phosphoribosylformylglycinamidine synthase subunit PurL OS=Aquifex aeolicus (strain VF5) GN=purL PE=3 SV=1 506 1190 6.0E-18
sp|Q6G335|PURL_BARHE Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=purL PE=3 SV=1 400 1140 6.0E-18
sp|B7H4T6|PURL_BACC4 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus cereus (strain B4264) GN=purL PE=3 SV=1 409 1153 7.0E-18
sp|Q468N4|PURQ_METBF Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=purQ PE=3 SV=1 1284 1511 8.0E-18
sp|A8F8I3|PURL_PSELT Phosphoribosylformylglycinamidine synthase subunit PurL OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=purL PE=3 SV=1 409 1221 9.0E-18
sp|Q8TPF0|PURQ_METAC Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=purQ PE=3 SV=1 1284 1511 1.0E-17
sp|A1UT47|PURL_BARBK Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=purL PE=3 SV=1 399 1155 1.0E-17
sp|Q8TY09|PURL_METKA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=purL PE=3 SV=1 409 1233 1.0E-17
sp|Q9KF57|PURL_BACHD Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=purL PE=3 SV=1 370 1153 1.0E-17
sp|Q7JXV9|VPS25_DROME Vacuolar protein-sorting-associated protein 25 OS=Drosophila melanogaster GN=Vps25 PE=1 SV=1 12 183 2.0E-17
sp|O59619|PURQ_PYRHO Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purQ PE=3 SV=2 1284 1511 2.0E-17
sp|Q5JFL7|PURL_THEKO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=purL PE=3 SV=1 510 812 2.0E-17
sp|Q2K7X0|PURL_RHIEC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=purL PE=3 SV=1 387 1169 2.0E-17
sp|A4YRR9|PURL_BRASO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bradyrhizobium sp. (strain ORS278) GN=purL PE=3 SV=1 390 963 3.0E-17
sp|Q5SI57|PURQ_THET8 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=purQ PE=3 SV=1 1286 1513 3.0E-17
sp|Q5JFP4|PURQ_THEKO Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=purQ PE=3 SV=1 1284 1511 3.0E-17
sp|Q5FNL0|PURL_GLUOX Phosphoribosylformylglycinamidine synthase subunit PurL OS=Gluconobacter oxydans (strain 621H) GN=purL PE=3 SV=1 388 1171 3.0E-17
sp|Q72IH9|PURQ_THET2 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=purQ PE=3 SV=1 1286 1513 3.0E-17
sp|B1YJ04|PURQ_EXIS2 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=purQ PE=3 SV=1 1284 1515 3.0E-17
sp|C1EV63|PURL_BACC3 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus cereus (strain 03BB102) GN=purL PE=3 SV=1 409 1153 4.0E-17
sp|B7JM85|PURL_BACC0 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus cereus (strain AH820) GN=purL PE=3 SV=1 409 1153 4.0E-17
sp|Q81ZH2|PURL_BACAN Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus anthracis GN=purL PE=3 SV=1 409 1153 4.0E-17
sp|A0R8Z6|PURL_BACAH Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus thuringiensis (strain Al Hakam) GN=purL PE=3 SV=1 409 1153 4.0E-17
sp|C3L532|PURL_BACAC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=purL PE=3 SV=1 409 1153 4.0E-17
sp|C3PBN0|PURL_BACAA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus anthracis (strain A0248) GN=purL PE=3 SV=1 409 1153 4.0E-17
sp|B7HS32|PURL_BACC7 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus cereus (strain AH187) GN=purL PE=3 SV=1 409 1153 4.0E-17
sp|Q73EN5|PURL_BACC1 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=purL PE=3 SV=1 409 1153 5.0E-17
sp|A8ABX6|PURL_IGNH4 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=purL PE=3 SV=1 409 896 5.0E-17
sp|B9J1K5|PURL_BACCQ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus cereus (strain Q1) GN=purL PE=3 SV=1 409 1153 5.0E-17
sp|Q63GT3|PURL_BACCZ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus cereus (strain ZK / E33L) GN=purL PE=3 SV=1 409 1153 5.0E-17
sp|Q5E9A6|VPS25_BOVIN Vacuolar protein-sorting-associated protein 25 OS=Bos taurus GN=VPS25 PE=2 SV=1 11 183 5.0E-17
sp|Q3IMR2|PURQ_NATPD Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=purQ PE=3 SV=1 1285 1511 6.0E-17
sp|Q9BRG1|VPS25_HUMAN Vacuolar protein-sorting-associated protein 25 OS=Homo sapiens GN=VPS25 PE=1 SV=1 11 183 6.0E-17
sp|Q1MG23|PURL_RHIL3 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=purL PE=3 SV=1 389 1169 7.0E-17
sp|Q1QMU2|PURL_NITHX Phosphoribosylformylglycinamidine synthase subunit PurL OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=purL PE=3 SV=1 389 963 8.0E-17
sp|A5EMI1|PURL_BRASB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=purL PE=3 SV=1 390 963 8.0E-17
sp|Q6HPA4|PURL_BACHK Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=purL PE=3 SV=1 409 1153 8.0E-17
sp|Q8DIA7|PURL_THEEB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermosynechococcus elongatus (strain BP-1) GN=purL PE=3 SV=1 409 1168 8.0E-17
sp|Q8U492|PURQ_PYRFU Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=purQ PE=3 SV=2 1284 1537 9.0E-17
sp|B9LT08|PURL_HALLT Phosphoribosylformylglycinamidine synthase subunit PurL OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=purL PE=3 SV=1 409 888 9.0E-17
sp|Q8ES96|PURL_OCEIH Phosphoribosylformylglycinamidine synthase subunit PurL OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=purL PE=3 SV=1 409 1152 9.0E-17
sp|P72644|PURL_SYNY3 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purL PE=3 SV=2 409 1168 9.0E-17
sp|Q67KF8|PURL_SYMTH Phosphoribosylformylglycinamidine synthase subunit PurL OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=purL PE=3 SV=1 409 1133 9.0E-17
sp|P0C0A1|VPS25_RAT Vacuolar protein-sorting-associated protein 25 OS=Rattus norvegicus GN=Vps25 PE=1 SV=1 11 183 1.0E-16
sp|Q9A5F0|PURL_CAUCR Phosphoribosylformylglycinamidine synthase subunit PurL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=purL PE=3 SV=1 409 1158 1.0E-16
sp|Q9CQ80|VPS25_MOUSE Vacuolar protein-sorting-associated protein 25 OS=Mus musculus GN=Vps25 PE=1 SV=1 11 183 1.0E-16
sp|Q8YR06|PURL_NOSS1 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=purL PE=3 SV=1 409 1153 2.0E-16
sp|A8F8I4|PURQ_PSELT Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=purQ PE=3 SV=1 1335 1511 2.0E-16
sp|A5G1X4|PURL_ACICJ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Acidiphilium cryptum (strain JF-5) GN=purL PE=3 SV=1 388 1169 2.0E-16
sp|Q55GD9|VPS25_DICDI Vacuolar protein-sorting-associated protein 25 OS=Dictyostelium discoideum GN=vps25 PE=1 SV=1 12 177 3.0E-16
sp|C5A4U6|PURL_THEGJ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=purL PE=3 SV=1 510 812 3.0E-16
sp|Q18JI5|PURL_HALWD Phosphoribosylformylglycinamidine synthase subunit PurL OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=purL PE=3 SV=1 406 802 3.0E-16
sp|Q13AA1|PURL_RHOPS Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodopseudomonas palustris (strain BisB5) GN=purL PE=3 SV=1 389 963 3.0E-16
sp|C3MD72|PURL_RHISN Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhizobium sp. (strain NGR234) GN=purL PE=3 SV=1 390 1171 3.0E-16
sp|A6TLS3|PURL_ALKMQ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Alkaliphilus metalliredigens (strain QYMF) GN=purL PE=3 SV=1 409 1233 3.0E-16
sp|Q2JQL7|PURL_SYNJA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Synechococcus sp. (strain JA-3-3Ab) GN=purL PE=3 SV=1 409 1233 3.0E-16
sp|Q9KH12|PURL_RHIFH Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhizobium fredii (strain HH103) GN=purL PE=3 SV=1 510 1171 3.0E-16
sp|A5UMW9|PURL_METS3 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=purL PE=3 SV=1 478 1155 4.0E-16
sp|Q0BRI4|PURL_GRABC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=purL PE=3 SV=1 409 1156 4.0E-16
sp|Q8UEB0|PURL_AGRFC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=purL PE=3 SV=1 390 1202 4.0E-16
sp|Q2S567|PURQ_SALRD Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=purQ PE=3 SV=1 1324 1513 4.0E-16
sp|B3PPS1|PURL_RHIE6 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhizobium etli (strain CIAT 652) GN=purL PE=3 SV=1 387 1169 5.0E-16
sp|A1B943|PURL_PARDP Phosphoribosylformylglycinamidine synthase subunit PurL OS=Paracoccus denitrificans (strain Pd 1222) GN=purL PE=3 SV=1 390 817 5.0E-16
sp|B5ZQU1|PURL_RHILW Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=purL PE=3 SV=1 387 1169 6.0E-16
sp|Q9UXW5|PURQ_PYRAB Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purQ PE=3 SV=1 1283 1511 7.0E-16
sp|A7GKH8|PURL_BACCN Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=purL PE=3 SV=1 409 1152 7.0E-16
sp|Q2RGU5|PURL_MOOTA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Moorella thermoacetica (strain ATCC 39073) GN=purL PE=3 SV=1 409 1236 7.0E-16
sp|Q89IC0|PURL_BRADU Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=purL PE=3 SV=1 390 963 8.0E-16
sp|A6U9L9|PURL_SINMW Phosphoribosylformylglycinamidine synthase subunit PurL OS=Sinorhizobium medicae (strain WSM419) GN=purL PE=3 SV=1 390 1171 9.0E-16
sp|B7GFT8|PURL_ANOFW Phosphoribosylformylglycinamidine synthase subunit PurL OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=purL PE=3 SV=1 467 1168 1.0E-15
sp|Q5FIV0|PURQ_LACAC Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=purQ PE=3 SV=1 1284 1513 1.0E-15
sp|Q2ITQ2|PURL_RHOP2 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodopseudomonas palustris (strain HaA2) GN=purL PE=3 SV=1 389 963 1.0E-15
sp|Q2G630|PURL_NOVAD Phosphoribosylformylglycinamidine synthase subunit PurL OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=purL PE=3 SV=1 408 838 2.0E-15
sp|Q2JI39|PURL_SYNJB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=purL PE=3 SV=1 409 1152 2.0E-15
sp|Q2NEB6|PURL_METST Phosphoribosylformylglycinamidine synthase subunit PurL OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=purL PE=3 SV=1 388 960 2.0E-15
sp|Q63GT4|PURQ_BACCZ Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus cereus (strain ZK / E33L) GN=purQ PE=3 SV=1 1284 1513 2.0E-15
sp|B9J1K4|PURQ_BACCQ Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus cereus (strain Q1) GN=purQ PE=3 SV=1 1284 1513 2.0E-15
sp|Q3AD65|PURQ_CARHZ Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=purQ PE=3 SV=1 1335 1511 2.0E-15
sp|A4WQY3|PURL_RHOS5 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=purL PE=3 SV=1 390 838 3.0E-15
sp|Q65MS8|PURL_BACLD Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=purL PE=3 SV=1 400 964 3.0E-15
sp|P35852|PURL_LACCA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactobacillus casei GN=purL PE=3 SV=2 379 1152 3.0E-15
sp|P99166|PURQ_STAAN Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus aureus (strain N315) GN=purQ PE=1 SV=1 1284 1513 3.0E-15
sp|P65904|PURQ_STAAM Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purQ PE=3 SV=1 1284 1513 3.0E-15
sp|Q7V834|PURQ_PROMM Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Prochlorococcus marinus (strain MIT 9313) GN=purQ PE=3 SV=1 1327 1511 4.0E-15
sp|Q8NX93|PURQ_STAAW Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus aureus (strain MW2) GN=purQ PE=3 SV=1 1284 1513 4.0E-15
sp|Q5HH16|PURQ_STAAC Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus aureus (strain COL) GN=purQ PE=3 SV=1 1284 1513 4.0E-15
sp|Q2FZJ1|PURQ_STAA8 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus aureus (strain NCTC 8325) GN=purQ PE=3 SV=1 1284 1513 4.0E-15
sp|Q2FI10|PURQ_STAA3 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus aureus (strain USA300) GN=purQ PE=3 SV=1 1284 1513 4.0E-15
sp|Q6GAE5|PURQ_STAAS Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus aureus (strain MSSA476) GN=purQ PE=3 SV=1 1284 1513 4.0E-15
sp|Q31B97|PURQ_PROM9 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Prochlorococcus marinus (strain MIT 9312) GN=purQ PE=3 SV=1 1285 1511 4.0E-15
sp|A8YW85|PURL_LACH4 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactobacillus helveticus (strain DPC 4571) GN=purL PE=3 SV=1 420 1236 5.0E-15
sp|Q5FNL1|PURQ_GLUOX Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Gluconobacter oxydans (strain 621H) GN=purQ PE=3 SV=1 1321 1516 5.0E-15
sp|Q9HNU2|PURQ_HALSA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=purQ PE=3 SV=1 1285 1511 5.0E-15
sp|Q9HR49|PURL_HALSA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=purL PE=3 SV=1 407 805 6.0E-15
sp|B0R4B5|PURL_HALS3 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=purL PE=3 SV=1 407 805 6.0E-15
sp|Q6GI16|PURQ_STAAR Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus aureus (strain MRSA252) GN=purQ PE=3 SV=1 1284 1513 6.0E-15
sp|A7GKH7|PURQ_BACCN Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=purQ PE=3 SV=1 1284 1514 6.0E-15
sp|Q6HPA5|PURQ_BACHK Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=purQ PE=3 SV=1 1284 1513 6.0E-15
sp|B7HS31|PURQ_BACC7 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus cereus (strain AH187) GN=purQ PE=3 SV=1 1284 1513 6.0E-15
sp|Q73EN6|PURQ_BACC1 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=purQ PE=3 SV=1 1284 1513 6.0E-15
sp|B7JM84|PURQ_BACC0 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus cereus (strain AH820) GN=purQ PE=3 SV=1 1284 1513 6.0E-15
sp|Q81ZH3|PURQ_BACAN Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus anthracis GN=purQ PE=3 SV=1 1284 1513 6.0E-15
sp|C3L531|PURQ_BACAC Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=purQ PE=3 SV=1 1284 1513 6.0E-15
sp|C3PBM9|PURQ_BACAA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus anthracis (strain A0248) GN=purQ PE=3 SV=1 1284 1513 6.0E-15
sp|C0ZKC5|PURQ_BREBN Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=purQ PE=3 SV=1 1284 1520 6.0E-15
sp|B2GF73|PURQ_LACF3 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=purQ PE=3 SV=1 1284 1513 7.0E-15
sp|A0R8Z5|PURQ_BACAH Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus thuringiensis (strain Al Hakam) GN=purQ PE=3 SV=1 1284 1513 7.0E-15
sp|C4L298|PURQ_EXISA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=purQ PE=3 SV=1 1324 1513 7.0E-15
sp|Q2YX55|PURQ_STAAB Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=purQ PE=3 SV=1 1284 1513 7.0E-15
sp|Q8PYK1|PURL_METMA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=purL PE=3 SV=2 409 962 8.0E-15
sp|B9KSY5|PURL_RHOSK Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=purL PE=3 SV=1 390 838 8.0E-15
sp|Q9UXW6|PURL_PYRAB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purL PE=3 SV=1 510 866 8.0E-15
sp|Q81IQ4|PURQ_BACCR Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=purQ PE=3 SV=1 1284 1513 9.0E-15
sp|B7H4T5|PURQ_BACC4 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus cereus (strain B4264) GN=purQ PE=3 SV=1 1284 1513 9.0E-15
sp|A8FAM7|PURL_BACP2 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus pumilus (strain SAFR-032) GN=purL PE=3 SV=1 506 1153 1.0E-14
sp|Q2NAT8|PURL_ERYLH Phosphoribosylformylglycinamidine synthase subunit PurL OS=Erythrobacter litoralis (strain HTCC2594) GN=purL PE=3 SV=1 408 822 1.0E-14
sp|A0B5C7|PURL_METTP Phosphoribosylformylglycinamidine synthase subunit PurL OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=purL PE=3 SV=1 379 1234 1.0E-14
sp|Q3IQL3|PURL_NATPD Phosphoribosylformylglycinamidine synthase subunit PurL OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=purL PE=3 SV=1 409 875 1.0E-14
sp|Q8TIT6|PURL_METAC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=purL PE=3 SV=1 409 1168 1.0E-14
sp|Q7U831|PURQ_SYNPX Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Synechococcus sp. (strain WH8102) GN=purQ PE=3 SV=1 1327 1513 1.0E-14
sp|Q3ARU4|PURL_CHLCH Phosphoribosylformylglycinamidine synthase subunit PurL OS=Chlorobium chlorochromatii (strain CaD3) GN=purL PE=3 SV=1 372 962 2.0E-14
sp|Q8CPP0|PURQ_STAES Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purQ PE=3 SV=1 1284 1513 2.0E-14
sp|Q5HQA2|PURQ_STAEQ Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purQ PE=3 SV=1 1284 1513 2.0E-14
sp|Q3B3Y0|PURL_CHLL7 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=purL PE=3 SV=1 379 1173 2.0E-14
sp|C1EV62|PURQ_BACC3 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus cereus (strain 03BB102) GN=purQ PE=3 SV=1 1284 1513 2.0E-14
sp|Q28PA2|PURQ_JANSC Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Jannaschia sp. (strain CCS1) GN=purQ PE=3 SV=1 1284 1515 2.0E-14
sp|Q2JWK2|PURQ_SYNJA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Synechococcus sp. (strain JA-3-3Ab) GN=purQ PE=3 SV=1 1335 1511 2.0E-14
sp|B7IUV2|PURQ_BACC2 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus cereus (strain G9842) GN=purQ PE=3 SV=1 1284 1513 2.0E-14
sp|Q9CFE7|PURQ_LACLA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=purQ PE=3 SV=1 1284 1513 3.0E-14
sp|Q7M9L5|PURL_WOLSU Phosphoribosylformylglycinamidine synthase subunit PurL OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=purL PE=3 SV=1 409 962 3.0E-14
sp|B2G5B8|PURL_LACRJ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactobacillus reuteri (strain JCM 1112) GN=purL PE=3 SV=1 420 1235 3.0E-14
sp|A5VHT8|PURL_LACRD Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactobacillus reuteri (strain DSM 20016) GN=purL PE=3 SV=1 420 1235 3.0E-14
sp|Q59042|PURQ_METJA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=purQ PE=3 SV=1 1284 1511 3.0E-14
sp|Q2RZ77|PURL_SALRD Phosphoribosylformylglycinamidine synthase subunit PurL OS=Salinibacter ruber (strain DSM 13855 / M31) GN=purL PE=3 SV=1 383 1152 3.0E-14
sp|Q1G9F7|PURQ_LACDA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=purQ PE=3 SV=1 1284 1513 3.0E-14
sp|Q5LS98|PURL_RUEPO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=purL PE=3 SV=1 390 817 3.0E-14
sp|Q1GGM0|PURQ_RUEST Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Ruegeria sp. (strain TM1040) GN=purQ PE=3 SV=1 1284 1511 3.0E-14
sp|Q38XW7|PURL_LACSS Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=purL PE=3 SV=1 510 1153 4.0E-14
sp|Q970V6|PURL_SULTO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=purL PE=3 SV=1 510 1191 4.0E-14
sp|Q833Y8|PURQ_ENTFA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=purQ PE=3 SV=1 1284 1513 4.0E-14
sp|Q30TB2|PURQ_SULDN Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=purQ PE=3 SV=1 1284 1513 4.0E-14
sp|Q3J273|PURL_RHOS4 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=purL PE=3 SV=2 390 838 4.0E-14
sp|Q9RHX0|PURQ_CORAM Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Corynebacterium ammoniagenes GN=purQ PE=3 SV=1 1284 1513 4.0E-14
sp|Q9ZB07|PURQ_LACLC Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Lactococcus lactis subsp. cremoris GN=purQ PE=3 SV=1 1284 1513 4.0E-14
sp|O67190|PURQ_AQUAE Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Aquifex aeolicus (strain VF5) GN=purQ PE=3 SV=1 1335 1511 5.0E-14
sp|A7H373|PURL_CAMJD Phosphoribosylformylglycinamidine synthase subunit PurL OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=purL PE=3 SV=1 506 963 7.0E-14
sp|Q8FMM2|PURQ_COREF Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=purQ PE=3 SV=1 1327 1513 7.0E-14
sp|A5GHL4|PURL_SYNPW Phosphoribosylformylglycinamidine synthase subunit PurL OS=Synechococcus sp. (strain WH7803) GN=purL PE=3 SV=1 402 898 8.0E-14
sp|B7GFT7|PURQ_ANOFW Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=purQ PE=3 SV=1 1284 1513 8.0E-14
sp|B2G5B7|PURQ_LACRJ Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Lactobacillus reuteri (strain JCM 1112) GN=purQ PE=3 SV=1 1324 1540 9.0E-14
sp|A5VHT7|PURQ_LACRD Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Lactobacillus reuteri (strain DSM 20016) GN=purQ PE=3 SV=1 1324 1540 9.0E-14
sp|B8EPE8|PURL_METSB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=purL PE=3 SV=1 390 812 9.0E-14
sp|A4IJX3|PURL_GEOTN Phosphoribosylformylglycinamidine synthase subunit PurL OS=Geobacillus thermodenitrificans (strain NG80-2) GN=purL PE=3 SV=1 508 1168 1.0E-13
sp|Q2NF29|PURQ_METST Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=purQ PE=3 SV=1 1285 1513 1.0E-13
sp|A9VRF0|PURQ_BACWK Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus weihenstephanensis (strain KBAB4) GN=purQ PE=3 SV=1 1284 1513 1.0E-13
sp|Q46LE9|PURQ_PROMT Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Prochlorococcus marinus (strain NATL2A) GN=purQ PE=3 SV=1 1284 1513 1.0E-13
sp|C5D4H9|PURQ_GEOSW Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Geobacillus sp. (strain WCH70) GN=purQ PE=3 SV=1 1284 1513 2.0E-13
sp|Q4L577|PURQ_STAHJ Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus haemolyticus (strain JCSC1435) GN=purQ PE=3 SV=1 1284 1513 2.0E-13
sp|B3WF98|PURQ_LACCB Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Lactobacillus casei (strain BL23) GN=purQ PE=3 SV=1 1284 1513 2.0E-13
sp|Q5L3D2|PURL_GEOKA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Geobacillus kaustophilus (strain HTA426) GN=purL PE=3 SV=1 409 1168 2.0E-13
sp|Q2JPK0|PURQ_SYNJB Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=purQ PE=3 SV=1 1335 1511 2.0E-13
sp|O26270|PURQ_METTH Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=purQ PE=3 SV=1 1335 1511 2.0E-13
sp|Q3B397|PURQ_CHLL7 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=purQ PE=3 SV=1 1327 1511 2.0E-13
sp|B9KFP6|PURL_CAMLR Phosphoribosylformylglycinamidine synthase subunit PurL OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=purL PE=3 SV=1 492 915 2.0E-13
sp|Q7V1S5|PURQ_PROMP Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=purQ PE=3 SV=1 1285 1513 2.0E-13
sp|B0ST16|PURL_LEPBP Phosphoribosylformylglycinamidine synthase subunit PurL OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=purL PE=3 SV=1 402 1176 2.0E-13
sp|B0SB88|PURL_LEPBA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=purL PE=3 SV=1 402 1176 2.0E-13
sp|A8FAM6|PURQ_BACP2 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus pumilus (strain SAFR-032) GN=purQ PE=3 SV=1 1284 1513 2.0E-13
sp|A9BIH4|PURL_PETMO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=purL PE=3 SV=1 477 833 3.0E-13
sp|P12042|PURL_BACSU Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus subtilis (strain 168) GN=purL PE=1 SV=2 400 961 3.0E-13
sp|Q5HUK4|PURL_CAMJR Phosphoribosylformylglycinamidine synthase subunit PurL OS=Campylobacter jejuni (strain RM1221) GN=purL PE=3 SV=1 506 963 3.0E-13
sp|Q037U8|PURQ_LACC3 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Lactobacillus casei (strain ATCC 334) GN=purQ PE=3 SV=1 1284 1513 3.0E-13
sp|Q3AYR1|PURQ_SYNS9 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Synechococcus sp. (strain CC9902) GN=purQ PE=3 SV=1 1327 1513 3.0E-13
sp|Q7M9X7|PURQ_WOLSU Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=purQ PE=3 SV=1 1285 1513 3.0E-13
sp|A4YI68|PURL_METS5 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=purL PE=3 SV=1 409 784 4.0E-13
sp|Q2RGU4|PURQ_MOOTA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Moorella thermoacetica (strain ATCC 39073) GN=purQ PE=3 SV=1 1312 1512 4.0E-13
sp|B3QMT1|PURQ_CHLP8 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Chlorobaculum parvum (strain NCIB 8327) GN=purQ PE=3 SV=1 1327 1511 5.0E-13
sp|Q9UX21|PURQ_SULSO Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=purQ PE=3 SV=1 1285 1511 5.0E-13
sp|Q49WJ3|PURL_STAS1 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=purL PE=3 SV=1 377 1025 8.0E-13
sp|Q163V9|PURL_ROSDO Phosphoribosylformylglycinamidine synthase subunit PurL OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=purL PE=3 SV=1 390 838 9.0E-13
sp|B9JFQ3|PURL_AGRRK Phosphoribosylformylglycinamidine synthase subunit PurL OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=purL PE=3 SV=1 367 838 9.0E-13
sp|Q8RBK6|PURQ_CALS4 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=purQ PE=3 SV=1 1335 1511 9.0E-13
sp|Q5N1Y6|PURL_SYNP6 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=purL PE=3 SV=1 381 777 9.0E-13
sp|Q55041|PURL_SYNE7 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Synechococcus elongatus (strain PCC 7942) GN=purL PE=3 SV=3 381 777 9.0E-13
sp|Q30T55|PURL_SULDN Phosphoribosylformylglycinamidine synthase subunit PurL OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=purL PE=3 SV=1 400 962 1.0E-12
sp|Q9RKK6|PURQ_STRCO Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=purQ PE=3 SV=1 1334 1513 1.0E-12
sp|Q9PNY0|PURL_CAMJE Phosphoribosylformylglycinamidine synthase subunit PurL OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=purL PE=1 SV=1 506 963 1.0E-12
sp|Q77ZF7|VP03_ALHV1 Probable tegument protein antigen 3 OS=Alcelaphine herpesvirus 1 (strain C500) GN=3 PE=4 SV=1 796 1545 1.0E-12
sp|Q1J2B6|PURQ_DEIGD Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Deinococcus geothermalis (strain DSM 11300) GN=purQ PE=3 SV=1 1335 1513 1.0E-12
sp|Q4L578|PURL_STAHJ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus haemolyticus (strain JCSC1435) GN=purL PE=3 SV=1 376 963 1.0E-12
sp|Q7UA92|PURL_SYNPX Phosphoribosylformylglycinamidine synthase subunit PurL OS=Synechococcus sp. (strain WH8102) GN=purL PE=3 SV=1 409 795 1.0E-12
sp|A7Z249|PURL_BACMF Phosphoribosylformylglycinamidine synthase subunit PurL OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=purL PE=3 SV=1 400 964 1.0E-12
sp|A8FM09|PURL_CAMJ8 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=purL PE=3 SV=1 506 963 2.0E-12
sp|Q7VEK9|PURL_PROMA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=purL PE=3 SV=2 396 1168 2.0E-12
sp|Q49WJ2|PURQ_STAS1 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=purQ PE=3 SV=1 1284 1513 2.0E-12
sp|B2GF74|PURL_LACF3 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=purL PE=3 SV=1 386 1235 2.0E-12
sp|Q4J8F8|PURL_SULAC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=purL PE=3 SV=1 510 1180 2.0E-12
sp|B2IC83|PURL_BEII9 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=purL PE=3 SV=1 389 1169 2.0E-12
sp|Q8KCS5|PURQ_CHLTE Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=purQ PE=3 SV=1 1327 1511 2.0E-12
sp|A1VZU6|PURL_CAMJJ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=purL PE=3 SV=1 506 963 2.0E-12
sp|Q1GHL5|PURL_RUEST Phosphoribosylformylglycinamidine synthase subunit PurL OS=Ruegeria sp. (strain TM1040) GN=purL PE=3 SV=1 389 913 2.0E-12
sp|Q9RXT3|PURQ_DEIRA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=purQ PE=3 SV=2 1335 1515 2.0E-12
sp|P47142|VPS25_YEAST Vacuolar protein-sorting-associated protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS25 PE=1 SV=1 14 176 3.0E-12
sp|Q46F25|PURL_METBF Phosphoribosylformylglycinamidine synthase subunit PurL OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=purL PE=3 SV=1 409 838 3.0E-12
sp|Q7VC88|PURQ_PROMA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=purQ PE=3 SV=1 1327 1511 3.0E-12
sp|P26500|PURL_METTM Phosphoribosylformylglycinamidine synthase subunit PurL OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=purL PE=3 SV=2 409 850 3.0E-12
sp|Q3AS25|PURQ_CHLCH Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Chlorobium chlorochromatii (strain CaD3) GN=purQ PE=3 SV=1 1335 1511 3.0E-12
sp|Q3ANP7|PURL_SYNSC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Synechococcus sp. (strain CC9605) GN=purL PE=3 SV=1 373 779 4.0E-12
sp|Q8NMI4|PURQ_CORGL Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=purQ PE=3 SV=1 1327 1513 4.0E-12
sp|Q3AII4|PURQ_SYNSC Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Synechococcus sp. (strain CC9605) GN=purQ PE=3 SV=1 1335 1513 4.0E-12
sp|Q55843|PURQ_SYNY3 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purQ PE=3 SV=1 1335 1511 5.0E-12
sp|Q2ITP9|PURQ_RHOP2 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Rhodopseudomonas palustris (strain HaA2) GN=purQ PE=3 SV=1 1284 1513 5.0E-12
sp|Q88U24|PURQ_LACPL Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=purQ PE=3 SV=3 1316 1541 5.0E-12
sp|P65901|PURL_STAAN Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain N315) GN=purL PE=1 SV=1 506 963 6.0E-12
sp|P65900|PURL_STAAM Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purL PE=3 SV=1 506 963 6.0E-12
sp|A5IRV6|PURL_STAA9 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain JH9) GN=purL PE=3 SV=1 506 963 6.0E-12
sp|A6U0N7|PURL_STAA2 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain JH1) GN=purL PE=3 SV=1 506 963 6.0E-12
sp|A7X0W1|PURL_STAA1 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=purL PE=3 SV=1 506 963 6.0E-12
sp|Q8CPN9|PURL_STAES Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purL PE=3 SV=1 373 813 6.0E-12
sp|Q5HQA1|PURL_STAEQ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purL PE=3 SV=1 373 813 6.0E-12
sp|Q2RWI2|PURQ_RHORT Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=purQ PE=3 SV=1 1286 1513 7.0E-12
sp|Q4FLJ5|PURQ_PELUB Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Pelagibacter ubique (strain HTCC1062) GN=purQ PE=3 SV=1 1335 1513 7.0E-12
sp|Q049L7|PURL_LACDB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=purL PE=3 SV=1 420 1153 8.0E-12
sp|Q1G9F8|PURL_LACDA Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=purL PE=3 SV=1 420 1153 8.0E-12
sp|Q8NX92|PURL_STAAW Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain MW2) GN=purL PE=3 SV=1 506 963 9.0E-12
sp|A8Z1L1|PURL_STAAT Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=purL PE=3 SV=1 506 963 9.0E-12
sp|Q6GAE4|PURL_STAAS Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain MSSA476) GN=purL PE=3 SV=1 506 963 9.0E-12
sp|A6QFS7|PURL_STAAE Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain Newman) GN=purL PE=3 SV=1 506 963 9.0E-12
sp|Q5HH15|PURL_STAAC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain COL) GN=purL PE=3 SV=1 506 963 9.0E-12
sp|Q2FZJ0|PURL_STAA8 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain NCTC 8325) GN=purL PE=3 SV=1 506 963 9.0E-12
sp|Q2FI09|PURL_STAA3 Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain USA300) GN=purL PE=3 SV=1 506 963 9.0E-12
sp|Q28QC2|PURL_JANSC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Jannaschia sp. (strain CCS1) GN=purL PE=3 SV=1 510 864 9.0E-12
sp|Q6GI15|PURL_STAAR Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain MRSA252) GN=purL PE=3 SV=1 506 963 9.0E-12
sp|Q0S774|PURQ_RHOJR Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Rhodococcus jostii (strain RHA1) GN=purQ PE=3 SV=1 1284 1511 9.0E-12
sp|Q5N459|PURQ_SYNP6 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=purQ PE=3 SV=1 1335 1511 1.0E-11
sp|Q31Q18|PURQ_SYNE7 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Synechococcus elongatus (strain PCC 7942) GN=purQ PE=3 SV=1 1335 1511 1.0E-11
sp|Q7VFQ4|PURQ_HELHP Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=purQ PE=3 SV=1 1285 1513 2.0E-11
sp|Q1WU60|PURQ_LACS1 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Lactobacillus salivarius (strain UCC118) GN=purQ PE=3 SV=1 1284 1540 2.0E-11
sp|Q6N376|PURQ_RHOPA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=purQ PE=3 SV=1 1335 1513 2.0E-11
sp|Q2YX54|PURL_STAAB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=purL PE=3 SV=1 506 813 2.0E-11
sp|A7I157|PURL_CAMHC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=purL PE=3 SV=1 409 962 2.0E-11
sp|Q67KF7|PURQ_SYMTH Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=purQ PE=3 SV=1 1284 1511 2.0E-11
sp|B9JVW2|PURL_AGRVS Phosphoribosylformylglycinamidine synthase subunit PurL OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=purL PE=3 SV=1 390 838 3.0E-11
sp|Q2G9J6|PURQ_NOVAD Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=purQ PE=3 SV=1 1335 1513 3.0E-11
sp|Q6A6B0|PURQ_PROAC Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=purQ PE=3 SV=1 1335 1513 3.0E-11
sp|B9DQ38|PURL_STACT Phosphoribosylformylglycinamidine synthase subunit PurL OS=Staphylococcus carnosus (strain TM300) GN=purL PE=3 SV=1 388 813 3.0E-11
sp|A4IJX2|PURQ_GEOTN Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Geobacillus thermodenitrificans (strain NG80-2) GN=purQ PE=3 SV=1 1284 1513 3.0E-11
sp|Q9KF58|PURQ_BACHD Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=purQ PE=3 SV=1 1284 1513 3.0E-11
sp|O74967|VPS25_SCHPO Vacuolar protein-sorting-associated protein 25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps25 PE=3 SV=1 14 182 3.0E-11
sp|Q6G336|PURQ_BARHE Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=purQ PE=3 SV=1 1335 1513 4.0E-11
sp|P12041|PURQ_BACSU Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus subtilis (strain 168) GN=purQ PE=1 SV=1 1324 1513 4.0E-11
sp|Q8DGX5|PURQ_THEEB Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Thermosynechococcus elongatus (strain BP-1) GN=purQ PE=3 SV=1 1325 1511 4.0E-11
sp|Q65MS9|PURQ_BACLD Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=purQ PE=3 SV=1 1324 1513 5.0E-11
sp|Q5L3D3|PURQ_GEOKA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Geobacillus kaustophilus (strain HTA426) GN=purQ PE=3 SV=1 1284 1513 6.0E-11
sp|Q8ZZJ9|PURQ_PYRAE Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=purQ PE=3 SV=1 1284 1537 7.0E-11
sp|Q6FZJ0|PURQ_BARQU Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bartonella quintana (strain Toulouse) GN=purQ PE=3 SV=1 1284 1513 7.0E-11
sp|A7Z248|PURQ_BACMF Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=purQ PE=3 SV=1 1324 1513 7.0E-11
sp|B8DDY7|PURQ_LISMH Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=purQ PE=3 SV=1 1284 1513 8.0E-11
sp|Q8VZC9|VPS25_ARATH Vacuolar protein sorting-associated protein 25 OS=Arabidopsis thaliana GN=VPS25 PE=1 SV=1 10 183 9.0E-11
sp|Q4JXF1|PURQ_CORJK Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Corynebacterium jeikeium (strain K411) GN=purQ PE=3 SV=1 1335 1513 9.0E-11
sp|Q8Y6C0|PURQ_LISMO Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=purQ PE=3 SV=1 1284 1513 9.0E-11
sp|B1HTV3|PURQ_LYSSC Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Lysinibacillus sphaericus (strain C3-41) GN=purQ PE=3 SV=1 1284 1513 1.0E-10
sp|Q82FW3|PURQ_STRAW Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=purQ PE=3 SV=1 1335 1513 1.0E-10
sp|Q218N7|PURQ_RHOPB Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Rhodopseudomonas palustris (strain BisB18) GN=purQ PE=3 SV=1 1335 1513 1.0E-10
sp|Q3MG53|PURQ_ANAVT Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=purQ PE=3 SV=1 1335 1511 1.0E-10
sp|O27427|PURL_METTH Phosphoribosylformylglycinamidine synthase subunit PurL OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=purL PE=3 SV=1 409 866 1.0E-10
sp|Q8ES97|PURQ_OCEIH Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=purQ PE=3 SV=1 1284 1513 1.0E-10
sp|Q5NMA4|PURQ_ZYMMO Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=purQ PE=3 SV=1 1327 1513 2.0E-10
sp|B9EAY8|PURL_MACCJ Phosphoribosylformylglycinamidine synthase subunit PurL OS=Macrococcus caseolyticus (strain JCSC5402) GN=purL PE=3 SV=1 388 813 2.0E-10
sp|A6Q3E8|PURL_NITSB Phosphoribosylformylglycinamidine synthase subunit PurL OS=Nitratiruptor sp. (strain SB155-2) GN=purL PE=3 SV=1 409 778 2.0E-10
sp|A6TLS2|PURQ_ALKMQ Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Alkaliphilus metalliredigens (strain QYMF) GN=purQ PE=3 SV=1 1335 1511 2.0E-10
sp|Q92PI1|PURQ_RHIME Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Rhizobium meliloti (strain 1021) GN=purQ PE=3 SV=1 1335 1513 3.0E-10
sp|Q5LS78|PURQ_RUEPO Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=purQ PE=3 SV=1 1284 1511 3.0E-10
sp|Q71YP8|PURQ_LISMF Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Listeria monocytogenes serotype 4b (strain F2365) GN=purQ PE=3 SV=1 1284 1513 3.0E-10
sp|C1KW69|PURQ_LISMC Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=purQ PE=3 SV=1 1284 1513 3.0E-10
sp|Q5FIV1|PURL_LACAC Phosphoribosylformylglycinamidine synthase subunit PurL OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=purL PE=3 SV=1 386 1153 4.0E-10
sp|Q8YU79|PURQ_NOSS1 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=purQ PE=3 SV=1 1335 1511 5.0E-10
sp|Q1GVL0|PURQ_SPHAL Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=purQ PE=3 SV=1 1331 1513 5.0E-10
sp|Q9X0X2|PURQ_THEMA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purQ PE=1 SV=1 1282 1513 5.0E-10
sp|Q9PHZ7|PURQ_CAMJE Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=purQ PE=3 SV=1 1284 1511 5.0E-10
sp|Q1MG27|PURQ_RHIL3 Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=purQ PE=3 SV=1 1335 1513 6.0E-10
sp|Q92AN8|PURQ_LISIN Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=purQ PE=3 SV=1 1284 1513 6.0E-10
sp|Q5Z2C8|PURQ_NOCFA Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Nocardia farcinica (strain IFM 10152) GN=purQ PE=3 SV=1 1284 1510 6.0E-10
sp|Q11IV0|PURQ_CHESB Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Chelativorans sp. (strain BNC1) GN=purQ PE=3 SV=1 1335 1513 8.0E-10
sp|A0B5C6|PURQ_METTP Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=purQ PE=3 SV=1 1284 1545 9.0E-10
sp|Q9A5F3|PURQ_CAUCR Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=purQ PE=3 SV=1 1281 1511 1.0E-09
sp|Q1QMU3|PURQ_NITHX Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=purQ PE=3 SV=1 1335 1513 1.0E-09
sp|Q3ST24|PURQ_NITWN Phosphoribosylformylglycinamidine synthase subunit PurQ OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=purQ PE=3 SV=1 1331 1513 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0071985 multivesicular body sorting pathway Yes
GO:0000814 ESCRT II complex Yes
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0016192 vesicle-mediated transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0036452 ESCRT complex No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|091100
MPLATHKAPSGFLLPSIHSAPPFFTQQPNPVSQAVVTDHWIKLILSYARYRRLWTLRLEDVETPGSDWDEIVRNT
RIKRRLLPAHLSAILATMVQRGCAAYEPTKQIRSVLLYWRLPEEWADALHRWAVDTGQLNTIMTFYEITDPQIAS
PLSGIPASLLKKAISILSKSGRAQTISIADGEGKQKKRHMLVLPGSSSISKPKRDALLRTIQKICPIVTSIDAVW
LHLVKCRTTSLQDELADTASSPRKILDQLLAYGDNTQLPSTSEFLSIGKNVVYVIPRPGSISPWSSKATDIANLC
NLNTHIERLERGIAYIFESTQPLTSTHLSQFSALIHDRMTQTIQLSLPQEDLIFAHHEPRPLVTVDLQSAIHTDP
KLKLATANKELGLALAPDEIDYLVDAYVSGSSAMGRNPTDAELFMFAQVNSEHCRHKIFNASWTIDNKPLQSSLF
QMIRNTERISNTGTISAYSDNAAVLEGHPASRFSVGKRSKGGPNPNLDYLYQSQKEDMPIVIKVETHNHPTAVSP
YPGAATGSGGEIRDEGAVGRGSKPKAGLAGFTVSNLLIPGFIQPWETDFGRPSHIASALDIMLEGPIGASAFNNE
FGRPALTGYFRTFSESVPIDGDGMKREVWGYHKPIMIAGGYGNVRPQFAKKSPFKAGAKIVVLGGPGLLIGLGGG
AASSQVSGASSAELDFASVQRENAEMQRRCQQVIDACVGLDEGNPIQSVHDVGAGGLSNALPELVHDSGLGAIFE
IRDVLVADMAMSPMEIWCNESQERYVLAISEEGIGEFERIAKRERCPFSVVGVATEEEELVVTDRLLGGDVIRLK
MNTLFGKPPRMSRRDMRRVVERPDFDPSLATFFSPTISTLRDRLEEAVQRVLRLPSVGSKSFLITIGDRTITGLV
TRDQMVGPWQVPVADVAVTRSSYGFDTIAGEAMAMGERTPLALLNAAASARMAVAESLTNIAAASISDISRIKLS
ANWMCAASKEGEGAALYEAVQAVGMELCPALGIGIPVGKDSMSMSMKWREGEEQKEVNAPLSLIITAFGPVKDVR
RTWTPQLRTDVDEPSALIFFDLAGGKTRMGGSALAQVFKEIGTVSPDVEDPAVVKAFFQGCQVVKDKEPGLVLAY
HDRSDGGLFTTIVEMCFAGRIGAEISLDSLHSHPNPISLLFNEELGAVFQVKESEIQKLSGIFVGVGFPSTFIHV
LGRVNSGGNQLVSIIHGGDIIFNAHRADLQQAWAETSYRMQTIRDDAAAAKEEFDLIKNENHTGLYYDLTFSYKL
SRDLFRRPKVAILREQGVNGQVEMAWSFTEAGFDAVDVHMSDILGGTVSLGDFRGLAACGGFSYGDVLGAGKGFA
HSALLNDIARDQFVNFFNREDTFALGVCNGCQFLSHLREIIPGTESWPDFKPNRSERFEGRVSMVEIVDNEVTKK
SPFLSDMAGSKLPVAIAHGEGRASFSKMDRQKEVLENKGLVALRYVDEKGLPTEVYPLNPNGSVGGITGVQTPSG
RVLALMPHPERVVTLESNSWYPPEFVEMWKGSGPWFRLFQNARVWCG*
Coding >Agabi119p4|091100
ATGCCCCTTGCAACGCACAAAGCACCTTCCGGCTTTCTCCTGCCCTCCATCCACTCCGCACCGCCCTTCTTCACC
CAGCAACCCAACCCCGTCTCCCAGGCCGTGGTCACGGATCACTGGATAAAGCTTATTTTATCGTACGCGAGGTAC
CGCAGACTATGGACGCTGCGACTAGAAGATGTAGAAACGCCTGGAAGCGACTGGGACGAGATAGTACGGAATACC
CGAATCAAGCGCCGACTTTTACCTGCCCATTTGTCTGCGATCCTGGCCACCATGGTCCAACGAGGTTGCGCCGCA
TATGAACCTACCAAGCAAATCAGGTCCGTGTTGCTGTACTGGCGTCTTCCAGAAGAATGGGCAGATGCCCTCCAC
CGCTGGGCGGTCGATACTGGCCAGCTGAACACTATCATGACATTCTACGAGATCACAGACCCTCAGATTGCCTCC
CCCCTTTCTGGTATACCCGCGTCTCTGCTCAAGAAGGCGATATCCATCTTGTCCAAGAGTGGGAGAGCACAGACC
ATCAGCATAGCAGACGGAGAAGGTAAACAAAAAAAGAGGCACATGCTCGTCCTTCCAGGGTCCTCGTCCATCTCC
AAACCCAAACGCGATGCCCTGTTGCGCACTATCCAAAAAATTTGTCCGATAGTGACATCCATCGATGCAGTTTGG
CTGCATCTTGTCAAATGTCGCACCACGTCACTGCAAGACGAGTTGGCGGACACTGCGTCCTCGCCCCGAAAGATC
CTAGACCAGCTGTTGGCATACGGTGATAACACTCAACTGCCATCCACATCCGAGTTTCTCTCCATCGGGAAAAAT
GTTGTATACGTCATTCCAAGGCCAGGATCCATATCCCCATGGTCAAGCAAGGCTACCGATATCGCCAACTTGTGT
AACCTCAACACTCACATTGAAAGACTCGAACGTGGCATTGCTTACATCTTCGAATCCACCCAACCTCTCACTTCC
ACCCACCTTTCCCAATTCTCCGCGCTCATCCATGATCGTATGACGCAAACTATACAACTGTCCCTCCCCCAAGAA
GACCTTATCTTCGCTCATCATGAACCTCGACCCCTTGTCACCGTCGATCTTCAATCCGCCATCCACACAGACCCC
AAACTGAAACTCGCAACTGCAAACAAAGAACTTGGTCTCGCTTTGGCACCAGACGAAATCGACTACCTCGTCGAT
GCTTACGTCTCTGGTTCATCAGCAATGGGACGAAATCCAACCGACGCTGAATTATTCATGTTTGCTCAAGTTAAT
TCTGAACATTGCCGTCATAAAATTTTCAATGCTTCCTGGACAATCGACAATAAACCCCTTCAATCTTCTTTATTC
CAAATGATTCGCAACACGGAAAGGATCAGTAATACGGGTACTATTTCCGCTTATTCCGACAACGCAGCCGTTCTT
GAAGGTCATCCCGCCTCCCGCTTTTCCGTCGGAAAACGTTCCAAAGGTGGTCCCAACCCCAATCTCGATTACCTT
TATCAATCACAAAAGGAAGATATGCCCATTGTCATCAAAGTCGAAACCCATAACCACCCGACGGCCGTTTCACCT
TATCCTGGCGCGGCAACGGGTTCAGGTGGAGAAATCCGTGATGAAGGTGCTGTTGGACGTGGTTCGAAACCTAAA
GCGGGTCTCGCAGGATTCACGGTATCCAATCTCCTCATCCCAGGTTTTATTCAACCTTGGGAAACCGATTTTGGT
AGACCTTCTCATATTGCCTCGGCTTTGGATATCATGTTGGAAGGTCCCATTGGTGCAAGTGCTTTCAATAATGAG
TTTGGGAGACCGGCTTTGACAGGGTATTTTCGTACGTTTTCGGAAAGTGTTCCGATTGATGGGGATGGGATGAAA
CGTGAAGTTTGGGGGTATCATAAACCTATTATGATTGCTGGTGGATATGGAAATGTCAGGCCCCAATTTGCAAAA
AAATCACCTTTCAAAGCTGGAGCGAAGATAGTTGTTCTTGGAGGACCTGGTTTGTTGATCGGACTTGGTGGAGGA
GCGGCTTCGAGTCAAGTTTCGGGTGCGAGTTCGGCCGAATTGGATTTCGCTTCGGTGCAGAGGGAGAATGCGGAG
ATGCAGAGAAGATGTCAGCAGGTTATTGATGCGTGTGTTGGACTTGATGAGGGAAATCCGATTCAGAGTGTTCAT
GATGTTGGTGCTGGGGGGTTGTCGAATGCTTTACCTGAATTGGTTCATGATTCGGGGTTGGGAGCGATTTTTGAA
ATTCGGGATGTGTTGGTGGCGGATATGGCCATGTCTCCGATGGAAATTTGGTGTAATGAAAGTCAGGAGAGGTAT
GTTTTGGCAATTAGTGAGGAGGGTATTGGAGAGTTTGAGAGGATTGCGAAGAGGGAACGATGTCCGTTTTCGGTT
GTGGGTGTTGCGACTGAGGAAGAAGAATTGGTGGTGACGGATAGGTTGTTGGGTGGGGATGTGATCAGGCTGAAA
ATGAATACGTTGTTTGGGAAACCACCGAGGATGTCGAGGAGGGATATGCGTAGAGTGGTTGAGAGACCTGATTTT
GATCCATCTCTTGCTACATTCTTTTCCCCGACGATATCGACCCTTCGAGATCGATTGGAGGAAGCTGTACAAAGG
GTGCTTCGATTACCTTCAGTCGGCTCCAAGTCTTTTCTCATCACTATCGGTGATCGTACAATTACAGGTCTTGTA
ACTCGAGATCAAATGGTTGGTCCTTGGCAAGTCCCAGTCGCAGACGTTGCAGTTACTCGTTCGTCATATGGTTTC
GATACTATCGCAGGAGAAGCCATGGCCATGGGTGAACGGACACCACTCGCATTACTCAACGCGGCAGCATCGGCT
CGTATGGCTGTAGCCGAATCTTTGACCAACATCGCTGCAGCGTCTATTTCGGATATCTCGCGTATCAAGTTGAGT
GCTAATTGGATGTGTGCTGCGTCGAAGGAGGGGGAGGGTGCGGCTTTGTATGAAGCTGTTCAGGCGGTTGGGATG
GAGTTGTGTCCTGCTTTGGGTATTGGGATACCTGTGGGTAAAGATTCCATGTCGATGTCGATGAAGTGGAGGGAG
GGTGAAGAACAGAAGGAGGTTAACGCTCCGTTGTCGTTGATTATTACTGCCTTTGGGCCTGTGAAGGATGTGAGA
AGGACATGGACACCCCAATTGCGTACGGATGTGGATGAACCCTCGGCTTTGATTTTCTTTGATTTGGCTGGTGGA
AAAACGAGAATGGGAGGTTCGGCATTGGCGCAGGTTTTTAAAGAGATTGGGACTGTGTCACCGGATGTCGAGGAT
CCTGCGGTGGTGAAAGCGTTTTTCCAAGGTTGTCAGGTGGTGAAGGACAAAGAGCCTGGATTGGTTTTGGCATAT
CATGATCGCTCTGACGGTGGTCTGTTTACGACCATCGTCGAAATGTGCTTTGCAGGCCGTATTGGTGCTGAGATT
TCGCTGGATAGTCTCCATTCTCATCCGAACCCGATCTCGTTGTTGTTCAATGAAGAGTTGGGAGCGGTTTTTCAG
GTCAAGGAGTCGGAGATTCAGAAGTTGTCGGGGATTTTTGTGGGTGTTGGATTTCCTTCGACTTTTATTCACGTT
TTGGGACGCGTGAATAGTGGTGGAAATCAACTGGTTTCGATTATTCATGGTGGAGACATCATTTTCAACGCTCAT
CGTGCCGATTTGCAACAAGCTTGGGCAGAGACGTCTTACCGTATGCAAACGATCCGTGATGACGCCGCCGCTGCG
AAAGAAGAGTTTGACCTCATCAAAAATGAAAACCATACCGGCTTGTATTACGATCTCACGTTCAGCTACAAACTC
TCAAGAGACTTGTTCCGCCGTCCTAAAGTTGCGATTCTTCGTGAACAAGGTGTGAATGGTCAAGTTGAGATGGCT
TGGTCATTCACCGAAGCTGGCTTTGATGCTGTTGATGTTCACATGTCTGATATCCTGGGTGGCACCGTTTCTCTT
GGTGATTTCCGTGGTTTGGCTGCCTGCGGTGGATTTTCGTATGGTGATGTTCTAGGTGCTGGGAAAGGATTTGCA
CACTCGGCGTTGCTGAATGATATTGCTCGCGACCAATTTGTGAACTTTTTCAATCGGGAAGACACGTTCGCTCTT
GGAGTGTGTAATGGTTGTCAATTTCTTTCTCATCTTCGTGAAATTATACCTGGGACGGAGTCGTGGCCGGATTTT
AAACCGAATCGAAGTGAGAGGTTTGAGGGTCGGGTTTCGATGGTGGAGATTGTGGATAATGAAGTGACGAAGAAA
TCGCCTTTCTTATCGGATATGGCGGGATCTAAATTGCCTGTTGCTATTGCGCATGGTGAAGGTCGTGCATCGTTT
TCCAAGATGGATCGGCAGAAAGAGGTATTGGAAAATAAGGGTTTGGTTGCGTTGAGGTATGTGGATGAGAAAGGG
TTGCCGACGGAAGTGTATCCGTTGAATCCGAATGGGAGTGTGGGGGGTATTACGGGTGTGCAGACTCCTAGCGGA
CGGGTGTTGGCACTGATGCCTCATCCTGAGAGGGTGGTGACCTTGGAGAGTAATAGTTGGTATCCTCCGGAGTTT
GTGGAGATGTGGAAGGGAAGTGGACCGTGGTTTAGGCTTTTCCAAAATGCTAGAGTATGGTGTGGGTAA
Transcript >Agabi119p4|091100
ATGCCCCTTGCAACGCACAAAGCACCTTCCGGCTTTCTCCTGCCCTCCATCCACTCCGCACCGCCCTTCTTCACC
CAGCAACCCAACCCCGTCTCCCAGGCCGTGGTCACGGATCACTGGATAAAGCTTATTTTATCGTACGCGAGGTAC
CGCAGACTATGGACGCTGCGACTAGAAGATGTAGAAACGCCTGGAAGCGACTGGGACGAGATAGTACGGAATACC
CGAATCAAGCGCCGACTTTTACCTGCCCATTTGTCTGCGATCCTGGCCACCATGGTCCAACGAGGTTGCGCCGCA
TATGAACCTACCAAGCAAATCAGGTCCGTGTTGCTGTACTGGCGTCTTCCAGAAGAATGGGCAGATGCCCTCCAC
CGCTGGGCGGTCGATACTGGCCAGCTGAACACTATCATGACATTCTACGAGATCACAGACCCTCAGATTGCCTCC
CCCCTTTCTGGTATACCCGCGTCTCTGCTCAAGAAGGCGATATCCATCTTGTCCAAGAGTGGGAGAGCACAGACC
ATCAGCATAGCAGACGGAGAAGGTAAACAAAAAAAGAGGCACATGCTCGTCCTTCCAGGGTCCTCGTCCATCTCC
AAACCCAAACGCGATGCCCTGTTGCGCACTATCCAAAAAATTTGTCCGATAGTGACATCCATCGATGCAGTTTGG
CTGCATCTTGTCAAATGTCGCACCACGTCACTGCAAGACGAGTTGGCGGACACTGCGTCCTCGCCCCGAAAGATC
CTAGACCAGCTGTTGGCATACGGTGATAACACTCAACTGCCATCCACATCCGAGTTTCTCTCCATCGGGAAAAAT
GTTGTATACGTCATTCCAAGGCCAGGATCCATATCCCCATGGTCAAGCAAGGCTACCGATATCGCCAACTTGTGT
AACCTCAACACTCACATTGAAAGACTCGAACGTGGCATTGCTTACATCTTCGAATCCACCCAACCTCTCACTTCC
ACCCACCTTTCCCAATTCTCCGCGCTCATCCATGATCGTATGACGCAAACTATACAACTGTCCCTCCCCCAAGAA
GACCTTATCTTCGCTCATCATGAACCTCGACCCCTTGTCACCGTCGATCTTCAATCCGCCATCCACACAGACCCC
AAACTGAAACTCGCAACTGCAAACAAAGAACTTGGTCTCGCTTTGGCACCAGACGAAATCGACTACCTCGTCGAT
GCTTACGTCTCTGGTTCATCAGCAATGGGACGAAATCCAACCGACGCTGAATTATTCATGTTTGCTCAAGTTAAT
TCTGAACATTGCCGTCATAAAATTTTCAATGCTTCCTGGACAATCGACAATAAACCCCTTCAATCTTCTTTATTC
CAAATGATTCGCAACACGGAAAGGATCAGTAATACGGGTACTATTTCCGCTTATTCCGACAACGCAGCCGTTCTT
GAAGGTCATCCCGCCTCCCGCTTTTCCGTCGGAAAACGTTCCAAAGGTGGTCCCAACCCCAATCTCGATTACCTT
TATCAATCACAAAAGGAAGATATGCCCATTGTCATCAAAGTCGAAACCCATAACCACCCGACGGCCGTTTCACCT
TATCCTGGCGCGGCAACGGGTTCAGGTGGAGAAATCCGTGATGAAGGTGCTGTTGGACGTGGTTCGAAACCTAAA
GCGGGTCTCGCAGGATTCACGGTATCCAATCTCCTCATCCCAGGTTTTATTCAACCTTGGGAAACCGATTTTGGT
AGACCTTCTCATATTGCCTCGGCTTTGGATATCATGTTGGAAGGTCCCATTGGTGCAAGTGCTTTCAATAATGAG
TTTGGGAGACCGGCTTTGACAGGGTATTTTCGTACGTTTTCGGAAAGTGTTCCGATTGATGGGGATGGGATGAAA
CGTGAAGTTTGGGGGTATCATAAACCTATTATGATTGCTGGTGGATATGGAAATGTCAGGCCCCAATTTGCAAAA
AAATCACCTTTCAAAGCTGGAGCGAAGATAGTTGTTCTTGGAGGACCTGGTTTGTTGATCGGACTTGGTGGAGGA
GCGGCTTCGAGTCAAGTTTCGGGTGCGAGTTCGGCCGAATTGGATTTCGCTTCGGTGCAGAGGGAGAATGCGGAG
ATGCAGAGAAGATGTCAGCAGGTTATTGATGCGTGTGTTGGACTTGATGAGGGAAATCCGATTCAGAGTGTTCAT
GATGTTGGTGCTGGGGGGTTGTCGAATGCTTTACCTGAATTGGTTCATGATTCGGGGTTGGGAGCGATTTTTGAA
ATTCGGGATGTGTTGGTGGCGGATATGGCCATGTCTCCGATGGAAATTTGGTGTAATGAAAGTCAGGAGAGGTAT
GTTTTGGCAATTAGTGAGGAGGGTATTGGAGAGTTTGAGAGGATTGCGAAGAGGGAACGATGTCCGTTTTCGGTT
GTGGGTGTTGCGACTGAGGAAGAAGAATTGGTGGTGACGGATAGGTTGTTGGGTGGGGATGTGATCAGGCTGAAA
ATGAATACGTTGTTTGGGAAACCACCGAGGATGTCGAGGAGGGATATGCGTAGAGTGGTTGAGAGACCTGATTTT
GATCCATCTCTTGCTACATTCTTTTCCCCGACGATATCGACCCTTCGAGATCGATTGGAGGAAGCTGTACAAAGG
GTGCTTCGATTACCTTCAGTCGGCTCCAAGTCTTTTCTCATCACTATCGGTGATCGTACAATTACAGGTCTTGTA
ACTCGAGATCAAATGGTTGGTCCTTGGCAAGTCCCAGTCGCAGACGTTGCAGTTACTCGTTCGTCATATGGTTTC
GATACTATCGCAGGAGAAGCCATGGCCATGGGTGAACGGACACCACTCGCATTACTCAACGCGGCAGCATCGGCT
CGTATGGCTGTAGCCGAATCTTTGACCAACATCGCTGCAGCGTCTATTTCGGATATCTCGCGTATCAAGTTGAGT
GCTAATTGGATGTGTGCTGCGTCGAAGGAGGGGGAGGGTGCGGCTTTGTATGAAGCTGTTCAGGCGGTTGGGATG
GAGTTGTGTCCTGCTTTGGGTATTGGGATACCTGTGGGTAAAGATTCCATGTCGATGTCGATGAAGTGGAGGGAG
GGTGAAGAACAGAAGGAGGTTAACGCTCCGTTGTCGTTGATTATTACTGCCTTTGGGCCTGTGAAGGATGTGAGA
AGGACATGGACACCCCAATTGCGTACGGATGTGGATGAACCCTCGGCTTTGATTTTCTTTGATTTGGCTGGTGGA
AAAACGAGAATGGGAGGTTCGGCATTGGCGCAGGTTTTTAAAGAGATTGGGACTGTGTCACCGGATGTCGAGGAT
CCTGCGGTGGTGAAAGCGTTTTTCCAAGGTTGTCAGGTGGTGAAGGACAAAGAGCCTGGATTGGTTTTGGCATAT
CATGATCGCTCTGACGGTGGTCTGTTTACGACCATCGTCGAAATGTGCTTTGCAGGCCGTATTGGTGCTGAGATT
TCGCTGGATAGTCTCCATTCTCATCCGAACCCGATCTCGTTGTTGTTCAATGAAGAGTTGGGAGCGGTTTTTCAG
GTCAAGGAGTCGGAGATTCAGAAGTTGTCGGGGATTTTTGTGGGTGTTGGATTTCCTTCGACTTTTATTCACGTT
TTGGGACGCGTGAATAGTGGTGGAAATCAACTGGTTTCGATTATTCATGGTGGAGACATCATTTTCAACGCTCAT
CGTGCCGATTTGCAACAAGCTTGGGCAGAGACGTCTTACCGTATGCAAACGATCCGTGATGACGCCGCCGCTGCG
AAAGAAGAGTTTGACCTCATCAAAAATGAAAACCATACCGGCTTGTATTACGATCTCACGTTCAGCTACAAACTC
TCAAGAGACTTGTTCCGCCGTCCTAAAGTTGCGATTCTTCGTGAACAAGGTGTGAATGGTCAAGTTGAGATGGCT
TGGTCATTCACCGAAGCTGGCTTTGATGCTGTTGATGTTCACATGTCTGATATCCTGGGTGGCACCGTTTCTCTT
GGTGATTTCCGTGGTTTGGCTGCCTGCGGTGGATTTTCGTATGGTGATGTTCTAGGTGCTGGGAAAGGATTTGCA
CACTCGGCGTTGCTGAATGATATTGCTCGCGACCAATTTGTGAACTTTTTCAATCGGGAAGACACGTTCGCTCTT
GGAGTGTGTAATGGTTGTCAATTTCTTTCTCATCTTCGTGAAATTATACCTGGGACGGAGTCGTGGCCGGATTTT
AAACCGAATCGAAGTGAGAGGTTTGAGGGTCGGGTTTCGATGGTGGAGATTGTGGATAATGAAGTGACGAAGAAA
TCGCCTTTCTTATCGGATATGGCGGGATCTAAATTGCCTGTTGCTATTGCGCATGGTGAAGGTCGTGCATCGTTT
TCCAAGATGGATCGGCAGAAAGAGGTATTGGAAAATAAGGGTTTGGTTGCGTTGAGGTATGTGGATGAGAAAGGG
TTGCCGACGGAAGTGTATCCGTTGAATCCGAATGGGAGTGTGGGGGGTATTACGGGTGTGCAGACTCCTAGCGGA
CGGGTGTTGGCACTGATGCCTCATCCTGAGAGGGTGGTGACCTTGGAGAGTAATAGTTGGTATCCTCCGGAGTTT
GTGGAGATGTGGAAGGGAAGTGGACCGTGGTTTAGGCTTTTCCAAAATGCTAGAGTATGGTGTGGGTAA
Gene >Agabi119p4|091100
ATGCCCCTTGCAACGCACAAAGCACCTTCCGGTATTTTCTTAGTTCATAGTGCTCACTGCCCGCGCTCACTCCTT
TCTAGGCTTTCTCCTGCCCTCCATCCACTCCGCACCGCCCTTCTTCACGTCCGTCGTCCCCCCCATCCCCACCCC
GCCCCCACCGCTAACCTTTTCCAGCCAGCAACCCAACCCCGTCTCCCAGGCCGTGGTCACGGATCACTGGATAAA
GCTTATTTTATCGTACGCGAGGTACCGCAGACTATGGACGCTGCGACTAGAAGATGTAGAAACGCCTGGAAGCGA
CTGGGACGAGATAGTACGGAATACCCGAATCAAGCGTACCTCTGACCTTTTCTTCCCTCTCATCAATCTAATCGT
TGTCTCCAGGCCGACTTTTACCTGCCCATTTGTCTGCGATCCTGGCCACCATGGTCCAACGAGGTTGCGCCGCAT
ATGAACCTACCAAGCAAATCAGGTCCGTGTTGCTGTACTGGCGTCTTCCAGAAGAATGGGCAGATGCCCTCCACC
GCTGGGTATGTTTATTTCTCTCCAACACATCAGACGGAAATGTTGATTTCATTTCAGGCGGTCGATACTGGCCAG
CTGAACACTATCATGACATTCTACGAGATCACAGACCCTCAGATTGCCTCCCCCCTTTCTGGTATACCCGCGTCT
CTGCTCAAGAAGGCGATATCCATCTTGTCCAAGAGTGGGAGAGCACAGACCATCAGCATAGCAGACGGAGAAGGT
GTCCGGTTCTTTGCTGGAGGTAGATGAACTTCTCTCTGTAGTATATAGCTACGTCACATGATGCCCTTAAAATCT
GAACATTTTATCTTATCGCCTTTCTCTGGCCACCAAATACGAGAAACAAAAAAAGAGGTAAGAGCGACTGTTTGT
TCAACGACGCACGCTCACCATTTTTTTTTTGCAGGCACATGCTCGTCCTTCCAGGGTCCTCGTCCATCTCCAAAC
CCAAACGCGATGCCCTGTTGCGCACTATCCAAAAAATTTGTCCGATAGTGACATCCATCGATGCAGTTTGGCTGC
ATCTTGTCAAATGTCGCACCACGTCACTGCAAGACGAGTTGGCGGACACTGCGTCCTCGCCCCGAAAGATCCTAG
ACCAGCTGTTGGCATACGGTGATAACACTCAACTGCCATCCACATCCGAGTTTCTCTCCATCGGGAAAAATGTTG
TATACGTCATTCCAAGGCCAGGATCCATATCCCCATGGTCAAGCAAGGCTACCGATATCGCCAACTTGTGTAACC
TCAACACTCACATTGAAAGACTCGAACGTGGCATTGCTTACATCTTCGAATCCACCCAACCTCTCACTTCCACCC
ACCTTTCCCAATTCTCCGCGCTCATCCATGATCGTATGACGCAAACTATACAACTGTCCCTCCCCCAAGAAGACC
TTATCTTCGCTCATCATGAACCTCGACCCCTTGTCACCGTCGATCTTCAATCCGCCATCCACACAGACCCCAAAC
TGAAACTCGCAACTGCAAACAAAGAACTTGGTCTCGCTTTGGCACCAGACGAAATCGACTACCTCGTCGATGCTT
ACGTCTCTGGTTCATCAGCAATGGGACGAAATCCAACCGACGCTGAATTATTCATGTTTGCTCAAGTTAATTCTG
AACATTGCCGTCATAAAATTTTCAATGCTTCCTGGACAATCGACAATAAACCCCTTCAATCTTCTTTATTCCAAA
TGATTCGCAACACGGAAAGGATCAGTAATACGGGTACTATTTCCGCTTATTCCGACAACGCAGCCGTTCTTGAAG
GTCATCCCGCCTCCCGCTTTTCCGTCGGAAAACGTTCCAAAGGTGGTCCCAACCCCAATCTCGATTACCTTTATC
AATCACAAAAGGAAGATATGCCCATTGTCATCAAAGTCGAAACCCATAACCACCCGACGGCCGTTTCACCTTATC
CTGGCGCGGCAACGGGTTCAGGTGGAGAAATCCGTGATGAAGGTGCTGTTGGACGTGGTTCGAAACCTAAAGCGG
GTCTCGCAGGATTCACGGTATCCAATCTCCTCATCCCAGGTTTTATTCAACCTTGGGAAACCGATTTTGGTAGAC
CTTCTCATATTGCCTCGGCTTTGGATATCATGTTGGAAGGTCCCATTGGTGCAAGTGCTTTCAATAATGAGTTTG
GGAGACCGGCTTTGACAGGGTATTTTCGTACGTTTTCGGAAAGTGTTCCGATTGATGGGGATGGGATGAAACGTG
AAGTTTGGGGGTATCATAAACCTATTATGATTGCTGGTGGATATGGAAATGTCAGGCCCCAATTTGCAAAAAAAT
CACCTTTCAAAGCTGGAGCGAAGATAGTTGTTCTTGGAGGACCTGGTTTGTTGATCGGACTTGGTGGAGGAGCGG
CTTCGAGTCAAGTTTCGGGTGCGAGTTCGGCCGAATTGGATTTCGCTTCGGTGCAGAGGGAGAATGCGGAGATGC
AGAGAAGATGTCAGCAGGTTATTGATGCGTGTGTTGGACTTGATGAGGGAAATCCGATTCAGAGTGTTCATGATG
TTGGTGCTGGGGGGTTGTCGAATGCTTTACCTGAATTGGTTCATGATTCGGGGTTGGGAGCGATTTTTGAAATTC
GGGATGTGTTGGTGGCGGATATGGCCATGTCTCCGATGGAAATTTGGTGTAATGAAAGTCAGGAGAGGTATGTTT
TGGCAATTAGTGAGGAGGGTATTGGAGAGTTTGAGAGGATTGCGAAGAGGGAACGATGTCCGTTTTCGGTTGTGG
GTGTTGCGACTGAGGAAGAAGAATTGGTGGTGACGGATAGGTTGTTGGGTGGGGATGTGATCAGGCTGAAAATGA
ATACGTTGTTTGGGAAACCACCGAGGATGTCGAGGAGGGATATGCGTAGAGTGGTTGAGAGACCTGATTTTGATC
CATCTCTTGCTACATTCTTTTCCCCGACGATATCGACCCTTCGAGATCGATTGGAGGAAGCTGTACAAAGGGTGC
TTCGATTACCTTCAGTCGGCTCCAAGTCTTTTCTCATCACTATCGGTGATCGTACAATTACAGGTCTTGTAACTC
GAGATCAAATGGTTGGTCCTTGGCAAGTCCCAGTCGCAGACGTTGCAGTTACTCGTTCGTCATATGGTTTCGATA
CTATCGCAGGAGAAGCCATGGCCATGGGTGAACGGACACCACTCGCATTACTCAACGCGGCAGCATCGGCTCGTA
TGGCTGTAGCCGAATCTTTGACCAACATCGCTGCAGCGTCTATTTCGGATATCTCGCGTATCAAGTTGAGTGCTA
ATTGGATGTGTGCTGCGTCGAAGGAGGGGGAGGGTGCGGCTTTGTATGAAGCTGTTCAGGCGGTTGGGATGGAGT
TGTGTCCTGCTTTGGGTATTGGGATACCTGTGGGTAAAGATTCCATGTCGATGTCGATGAAGTGGAGGGAGGGTG
AAGAACAGAAGGAGGTTAACGCTCCGTTGTCGTTGATTATTACTGCCTTTGGGCCTGTGAAGGATGTGAGAAGGA
CATGGACACCCCAATTGCGTACGGATGTGGATGAACCCTCGGCTTTGATTTTCTTTGATTTGGCTGGTGGAAAAA
CGAGAATGGGAGGTTCGGCATTGGCGCAGGTTTTTAAAGAGATTGGGACTGTGTCACCGGATGTCGAGGATCCTG
CGGTGGTGAAAGCGTTTTTCCAAGGTTGTCAGGTGGTGAAGGACAAAGAGCCTGGATTGGTTTTGGCATATCATG
ATCGCTCTGACGGTGGTCTGTTTACGACCATCGTCGAAATGTGCTTTGCAGGCCGTATTGGTGCTGAGATTTCGC
TGGATAGTCTCCATTCTCATCCGAACCCGATCTCGTTGTTGTTCAATGAAGAGTTGGGAGCGGTTTTTCAGGTCA
AGGAGTCGGAGATTCAGAAGTTGTCGGGGATTTTTGTGGGTGTTGGATTTCCTTCGACTTTTATTCACGTTTTGG
GACGCGTGAATAGTGGTGGAAATCAACTGGTTTCGATTATTCATGGTGGAGACATCATTTTCAACGCTCATCGTG
CCGATTTGCAACAAGCTTGGGCAGAGACGTCTTACCGTATGCAAACGATCCGTGATGACGCCGCCGCTGCGAAAG
AAGAGTTTGACCTCATCAAAAATGAAAACCATACCGGCTTGTATTACGATCTCACGTTCAGCTACAAACTCTCAA
GAGACTTGTTCCGCCGTCCTAAAGTTGCGATTCTTCGTGAACAAGGTGTGAATGGTCAAGTTGAGATGGCTTGGT
CATTCACCGAAGCTGGCTTTGATGCTGTTGATGTTCACATGTCTGATATCCTGGGTGGCACCGTTTCTCTTGGTG
ATTTCCGTGGTTTGGCTGCCTGCGGTGGATTTTCGTATGGTGATGTTCTAGGTGCTGGGAAAGGATTTGCACACT
CGGCGTTGCTGAATGATATTGCTCGCGACCAATTTGTGAACTTTTTCAATCGGGAAGACACGTTCGCTCTTGGAG
TGTGTAATGGTTGTCAATTTCTTTCTCATCTTCGTGAAATTATACCTGGGACGGAGTCGTGGCCGGATTTTAAAC
CGAATCGAAGTGAGAGGTTTGAGGGTCGGGTTTCGATGGTGGAGATTGTGGATAATGAAGTGACGAAGAAATCGC
CTTTCTTATCGGATATGGCGGGATCTAAATTGCCTGTTGCTATTGCGCATGGTGAAGGTCGTGCATCGTTTTCCA
AGATGGATCGGCAGAAAGAGGTATTGGAAAATAAGGGTTTGGTTGCGTTGAGGTATGTGGATGAGAAAGGGTTGC
CGACGGAAGTGTATCCGTTGAATCCGAATGGGAGTGTGGGGGGTATTACGGGTGTGCAGACTCCTAGCGGACGGG
TGTTGGCACTGATGCCTCATCCTGAGAGGGTGGTGACCTTGGAGAGTAATAGTTGGTATCCTCCGGAGTTTGTGG
AGATGTGGAAGGGAAGTGGACCGTGGTTTAGGCTTTTCCAAAATGCTAGAGTATGGTGTGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail