Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|090860
Gene name
Locationscaffold_06:661286..662750
Strand+
Gene length (bp)1464
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 2.9E-06 21 80
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 1.1E-04 83 148
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 2.5E-05 153 201
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 7.6E-10 206 259
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 3.6E-08 263 320
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 2.0E-08 324 392
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 6.9E-07 397 445
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 9.7E-07 67 94
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 5.0E-10 247 275
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 7.0E-06 307 336

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28745|RCC1_SCHPO Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 2 445 9.0E-63
sp|P21827|RCC1_YEAST Guanine nucleotide exchange factor SRM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRM1 PE=1 SV=1 13 445 6.0E-56
sp|P25183|RCC1_XENLA Regulator of chromosome condensation OS=Xenopus laevis GN=rcc1 PE=2 SV=1 7 451 3.0E-46
sp|P18754|RCC1_HUMAN Regulator of chromosome condensation OS=Homo sapiens GN=RCC1 PE=1 SV=1 14 452 6.0E-43
sp|P23800|RCC1_MESAU Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 17 452 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28745|RCC1_SCHPO Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 2 445 9.0E-63
sp|P21827|RCC1_YEAST Guanine nucleotide exchange factor SRM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRM1 PE=1 SV=1 13 445 6.0E-56
sp|P25183|RCC1_XENLA Regulator of chromosome condensation OS=Xenopus laevis GN=rcc1 PE=2 SV=1 7 451 3.0E-46
sp|P18754|RCC1_HUMAN Regulator of chromosome condensation OS=Homo sapiens GN=RCC1 PE=1 SV=1 14 452 6.0E-43
sp|P23800|RCC1_MESAU Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 17 452 2.0E-42
sp|Q8VE37|RCC1_MOUSE Regulator of chromosome condensation OS=Mus musculus GN=Rcc1 PE=1 SV=1 17 451 9.0E-42
sp|P25171|RCC1_DROME Regulator of chromosome condensation OS=Drosophila melanogaster GN=Rcc1 PE=1 SV=2 21 449 2.0E-39
sp|P52499|RCC1_CANAX Protein RCC1 OS=Candida albicans GN=RCC1 PE=3 SV=1 19 403 9.0E-39
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 20 424 3.0E-29
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 21 424 1.0E-26
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 21 439 5.0E-26
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 21 439 2.0E-25
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 21 439 5.0E-24
sp|Q18211|RCC1_CAEEL Regulator of chromosome condensation OS=Caenorhabditis elegans GN=ran-3 PE=3 SV=1 60 450 1.0E-21
sp|Q3MHW0|SRGEF_BOVIN Secretion-regulating guanine nucleotide exchange factor OS=Bos taurus GN=SERGEF PE=2 SV=1 5 449 1.0E-21
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 174 446 3.0E-21
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 117 444 9.0E-21
sp|Q9UGK8|SRGEF_HUMAN Secretion-regulating guanine nucleotide exchange factor OS=Homo sapiens GN=SERGEF PE=1 SV=2 28 449 1.0E-20
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 117 444 2.0E-20
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 117 444 3.0E-19
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 53 446 4.0E-19
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 61 337 1.0E-18
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 53 446 2.0E-18
sp|Q80YD6|SRGEF_MOUSE Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus GN=Sergef PE=2 SV=2 14 449 2.0E-18
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 139 447 3.0E-18
sp|Q9N1T2|RPGR_CANLF X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris GN=RPGR PE=2 SV=1 21 339 3.0E-18
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 156 446 8.0E-18
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 15 348 2.0E-17
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 135 444 4.0E-17
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 135 444 5.0E-17
sp|Q92834|RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 21 339 1.0E-16
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 154 444 2.0E-16
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 154 444 2.0E-16
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 188 447 4.0E-16
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 118 446 1.0E-15
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 21 338 1.0E-15
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 123 404 1.0E-15
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 123 404 1.0E-15
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 123 404 1.0E-15
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 188 446 1.0E-15
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 118 446 2.0E-15
sp|Q9R0X5|RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 21 339 2.0E-15
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 21 429 2.0E-15
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 68 338 3.0E-15
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 55 347 3.0E-15
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 68 338 4.0E-15
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 123 404 4.0E-15
sp|Q52KW8|RCC2_XENLA Protein RCC2 homolog OS=Xenopus laevis GN=rcc2 PE=2 SV=1 183 424 4.0E-15
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 59 348 1.0E-14
sp|Q9N1T2|RPGR_CANLF X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris GN=RPGR PE=2 SV=1 137 444 3.0E-14
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 154 444 3.0E-14
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 154 444 3.0E-14
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 123 450 4.0E-14
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 21 322 5.0E-14
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 21 322 5.0E-14
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 139 450 8.0E-14
sp|Q96I51|WBS16_HUMAN Williams-Beuren syndrome chromosomal region 16 protein OS=Homo sapiens GN=WBSCR16 PE=1 SV=2 86 447 1.0E-13
sp|Q92834|RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 137 444 2.0E-13
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 173 449 3.0E-13
sp|Q6NYE2|RCC2_DANRE Protein RCC2 homolog OS=Danio rerio GN=rcc2 PE=2 SV=1 183 447 3.0E-13
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 133 442 4.0E-13
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 21 317 1.0E-12
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 21 318 2.0E-12
sp|Q9R0X5|RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 137 444 2.0E-12
sp|Q9CYF5|WBS16_MOUSE Williams-Beuren syndrome chromosomal region 16 protein homolog OS=Mus musculus GN=Wbscr16 PE=2 SV=1 123 447 2.0E-12
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 21 318 3.0E-12
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 67 422 3.0E-12
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 184 449 4.0E-12
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 70 411 5.0E-12
sp|Q9R0X5|RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 192 450 8.0E-12
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 21 322 8.0E-12
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 23 338 1.0E-11
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 21 322 3.0E-11
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 133 447 4.0E-11
sp|Q92834|RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 247 447 5.0E-11
sp|Q4R828|RCCD1_MACFA RCC1 domain-containing protein 1 OS=Macaca fascicularis GN=RCCD1 PE=2 SV=1 182 444 5.0E-11
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 185 449 7.0E-11
sp|Q5DX34|RPGRH_CAEEL X-linked retinitis pigmentosa GTPase regulator homolog OS=Caenorhabditis elegans GN=glo-4 PE=1 SV=2 135 446 8.0E-11
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 61 343 9.0E-11
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 123 445 1.0E-10
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 123 445 1.0E-10
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 123 450 1.0E-10
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 66 336 2.0E-10
sp|Q5DX34|RPGRH_CAEEL X-linked retinitis pigmentosa GTPase regulator homolog OS=Caenorhabditis elegans GN=glo-4 PE=1 SV=2 139 413 2.0E-10
sp|Q54Q89|RCCDC_DICDI RCC1 repeat-containing protein DDB_G0284033 OS=Dictyostelium discoideum GN=DDB_G0284033 PE=3 SV=2 21 421 2.0E-10
sp|Q54VW7|GACGG_DICDI Rho GTPase-activating protein gacGG OS=Dictyostelium discoideum GN=gacGG PE=3 SV=1 56 411 2.0E-10
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 133 447 2.0E-10
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 233 447 3.0E-10
sp|A6NED2|RCCD1_HUMAN RCC1 domain-containing protein 1 OS=Homo sapiens GN=RCCD1 PE=1 SV=1 182 444 8.0E-10
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 136 447 9.0E-10
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 184 447 1.0E-09
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 58 338 1.0E-09
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 61 346 1.0E-09
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 189 447 1.0E-09
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 184 447 2.0E-09
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 63 334 2.0E-09
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 232 447 2.0E-09
sp|Q9CYF5|WBS16_MOUSE Williams-Beuren syndrome chromosomal region 16 protein homolog OS=Mus musculus GN=Wbscr16 PE=2 SV=1 169 424 2.0E-09
sp|O42645|YF94_SCHPO RCC1 repeat-containing protein C10F6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.04 PE=3 SV=1 67 326 2.0E-09
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 133 447 2.0E-09
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 232 447 3.0E-09
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 123 446 4.0E-09
sp|P23800|RCC1_MESAU Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 197 429 6.0E-09
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 145 414 6.0E-09
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 139 449 6.0E-09
sp|Q9P258|RCC2_HUMAN Protein RCC2 OS=Homo sapiens GN=RCC2 PE=1 SV=2 107 403 6.0E-09
sp|Q8BTU7|RCCD1_MOUSE RCC1 domain-containing protein 1 OS=Mus musculus GN=Rccd1 PE=2 SV=2 182 349 6.0E-09
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 139 449 7.0E-09
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 244 450 9.0E-09
sp|Q9P258|RCC2_HUMAN Protein RCC2 OS=Homo sapiens GN=RCC2 PE=1 SV=2 226 411 9.0E-09
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 132 338 1.0E-08
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 145 414 1.0E-08
sp|Q8VE37|RCC1_MOUSE Regulator of chromosome condensation OS=Mus musculus GN=Rcc1 PE=1 SV=1 203 429 2.0E-08
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 61 334 2.0E-08
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 208 447 2.0E-08
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 139 449 2.0E-08
sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 150 343 2.0E-08
sp|Q8BK67|RCC2_MOUSE Protein RCC2 OS=Mus musculus GN=Rcc2 PE=1 SV=1 107 445 2.0E-08
sp|Q8IS20|GEFC_DICDI Ras guanine nucleotide exchange factor C OS=Dictyostelium discoideum GN=gefC PE=2 SV=1 21 262 2.0E-08
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 21 378 3.0E-08
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 21 378 3.0E-08
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 21 275 4.0E-08
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 74 337 4.0E-08
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 21 275 5.0E-08
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 61 343 8.0E-08
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 21 378 9.0E-08
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 21 378 1.0E-07
sp|Q5DX34|RPGRH_CAEEL X-linked retinitis pigmentosa GTPase regulator homolog OS=Caenorhabditis elegans GN=glo-4 PE=1 SV=2 139 423 1.0E-07
sp|Q8BK67|RCC2_MOUSE Protein RCC2 OS=Mus musculus GN=Rcc2 PE=1 SV=1 76 333 2.0E-07
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 20 269 3.0E-07
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 139 447 3.0E-07
sp|Q8BTU7|RCCD1_MOUSE RCC1 domain-containing protein 1 OS=Mus musculus GN=Rccd1 PE=2 SV=2 252 452 3.0E-07
sp|Q8IS20|GEFC_DICDI Ras guanine nucleotide exchange factor C OS=Dictyostelium discoideum GN=gefC PE=2 SV=1 281 444 3.0E-07
sp|Q6ZPR6|IBTK_MOUSE Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 184 340 3.0E-07
sp|Q52KW8|RCC2_XENLA Protein RCC2 homolog OS=Xenopus laevis GN=rcc2 PE=2 SV=1 64 333 5.0E-07
sp|P25171|RCC1_DROME Regulator of chromosome condensation OS=Drosophila melanogaster GN=Rcc1 PE=1 SV=2 21 325 6.0E-07
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 264 412 7.0E-07
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 21 258 1.0E-06
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 21 220 1.0E-06
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 20 261 1.0E-06
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 232 440 1.0E-06
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 184 340 1.0E-06
sp|Q6NYE2|RCC2_DANRE Protein RCC2 homolog OS=Danio rerio GN=rcc2 PE=2 SV=1 58 333 2.0E-06
sp|O75592|MYCB2_HUMAN E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens GN=MYCBP2 PE=1 SV=3 182 338 2.0E-06
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 206 447 3.0E-06
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 297 447 4.0E-06
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 265 447 4.0E-06
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 206 447 4.0E-06
sp|O42645|YF94_SCHPO RCC1 repeat-containing protein C10F6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.04 PE=3 SV=1 208 444 4.0E-06
sp|Q9P258|RCC2_HUMAN Protein RCC2 OS=Homo sapiens GN=RCC2 PE=1 SV=2 76 333 5.0E-06
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 67 319 6.0E-06
sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 189 340 7.0E-06
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 20 269 8.0E-06
sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 230 413 8.0E-06
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 13 228 9.0E-06
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 265 447 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|090860
MAQHFNPLPTPPLTARPALVLFAWGAGNFGQFGMGPDVLDSLTTPRRNQWVEAQIGNGTFGEIGAGITAIAAGGL
HTLFIDENGTVWSCGANDDAALGRITTNVPNPDKEGLFLDIDELTSWPRPIQTLVDQNFRAVVVAAGDSIGAAVS
DEGELRVWGTYRGMEGALGFSSRSEKQQLPTPILTSSRVSSVAAGNNHLVILTTQGYIYTLGSGEQYQLGRKIIE
GRKIDGTNPRKIVLGKRLRKAVHVAAGSYHSFAIDENDDVWAWGLNNLGQTGTGWFSEEDNIVYSPQKIESLSRQ
NLAGDYVTQIAGGEHHSLFLTSGGKVYSCGRMNGGQLGLQDDNPAIVEWRMKYAEKYGDKLPQLLPTPTQINFPD
ANDPVVQVSAGLHNNAVVTQGGALLAWGQGVQGELGLRKKEEVKTPEVVVRKEGGAWFAAAVSCGGQHTIGLFRK
KD*
Coding >Agabi119p4|090860
ATGGCACAACACTTCAATCCCCTTCCGACCCCACCCTTGACAGCGAGACCCGCTCTTGTCCTATTCGCTTGGGGT
GCAGGCAATTTTGGTCAATTTGGCATGGGTCCGGACGTCCTTGACTCATTGACCACGCCACGGAGAAACCAATGG
GTCGAGGCTCAGATCGGAAATGGCACATTTGGCGAGATTGGTGCTGGCATAACCGCTATCGCTGCCGGTGGCCTT
CATACGCTTTTTATAGATGAGAATGGGACCGTATGGTCCTGCGGTGCTAACGATGATGCTGCCCTTGGTCGAATC
ACTACGAATGTTCCGAATCCTGACAAAGAAGGCTTATTCCTTGATATCGATGAGCTCACAAGCTGGCCGCGACCA
ATTCAGACATTAGTTGACCAGAATTTCCGCGCTGTAGTTGTCGCCGCTGGTGATAGCATCGGTGCTGCGGTCAGT
GATGAAGGTGAACTCCGTGTCTGGGGCACTTACAGGGGTATGGAAGGAGCTCTCGGATTCTCGAGCCGCAGCGAG
AAACAGCAACTTCCTACACCAATCCTCACGTCAAGCCGGGTTTCCTCGGTGGCTGCAGGCAACAACCATCTCGTC
ATTCTCACAACTCAAGGTTACATTTATACCCTTGGATCCGGTGAACAATATCAACTTGGCCGGAAAATCATAGAA
GGTCGGAAGATAGACGGAACTAACCCAAGAAAAATTGTTCTTGGTAAACGTTTGCGTAAAGCCGTCCATGTTGCT
GCCGGTTCTTACCACTCTTTCGCCATCGATGAGAATGATGATGTCTGGGCATGGGGATTGAACAATCTGGGCCAA
ACTGGTACCGGCTGGTTCTCGGAGGAGGATAATATCGTATATTCACCCCAGAAGATCGAGTCCCTCAGCAGACAG
AACCTTGCAGGCGATTACGTGACTCAAATTGCTGGAGGCGAGCATCATAGTCTTTTCTTGACTTCTGGGGGGAAG
GTATATTCTTGTGGACGTATGAATGGCGGTCAACTTGGACTTCAGGATGACAACCCTGCTATCGTGGAGTGGCGG
ATGAAGTATGCCGAGAAGTATGGAGATAAACTTCCACAACTACTTCCAACACCAACGCAAATAAATTTTCCGGAT
GCCAACGATCCTGTTGTCCAGGTATCTGCTGGCTTGCACAACAATGCGGTAGTGACGCAGGGCGGAGCTCTACTA
GCATGGGGTCAAGGCGTACAAGGTGAACTTGGTCTTCGCAAAAAGGAAGAGGTCAAAACGCCGGAGGTTGTTGTG
CGTAAAGAGGGTGGTGCTTGGTTTGCGGCAGCCGTTTCCTGCGGCGGGCAACATACAATTGGGCTTTTCAGAAAG
AAAGACTAG
Transcript >Agabi119p4|090860
ATGGCACAACACTTCAATCCCCTTCCGACCCCACCCTTGACAGCGAGACCCGCTCTTGTCCTATTCGCTTGGGGT
GCAGGCAATTTTGGTCAATTTGGCATGGGTCCGGACGTCCTTGACTCATTGACCACGCCACGGAGAAACCAATGG
GTCGAGGCTCAGATCGGAAATGGCACATTTGGCGAGATTGGTGCTGGCATAACCGCTATCGCTGCCGGTGGCCTT
CATACGCTTTTTATAGATGAGAATGGGACCGTATGGTCCTGCGGTGCTAACGATGATGCTGCCCTTGGTCGAATC
ACTACGAATGTTCCGAATCCTGACAAAGAAGGCTTATTCCTTGATATCGATGAGCTCACAAGCTGGCCGCGACCA
ATTCAGACATTAGTTGACCAGAATTTCCGCGCTGTAGTTGTCGCCGCTGGTGATAGCATCGGTGCTGCGGTCAGT
GATGAAGGTGAACTCCGTGTCTGGGGCACTTACAGGGGTATGGAAGGAGCTCTCGGATTCTCGAGCCGCAGCGAG
AAACAGCAACTTCCTACACCAATCCTCACGTCAAGCCGGGTTTCCTCGGTGGCTGCAGGCAACAACCATCTCGTC
ATTCTCACAACTCAAGGTTACATTTATACCCTTGGATCCGGTGAACAATATCAACTTGGCCGGAAAATCATAGAA
GGTCGGAAGATAGACGGAACTAACCCAAGAAAAATTGTTCTTGGTAAACGTTTGCGTAAAGCCGTCCATGTTGCT
GCCGGTTCTTACCACTCTTTCGCCATCGATGAGAATGATGATGTCTGGGCATGGGGATTGAACAATCTGGGCCAA
ACTGGTACCGGCTGGTTCTCGGAGGAGGATAATATCGTATATTCACCCCAGAAGATCGAGTCCCTCAGCAGACAG
AACCTTGCAGGCGATTACGTGACTCAAATTGCTGGAGGCGAGCATCATAGTCTTTTCTTGACTTCTGGGGGGAAG
GTATATTCTTGTGGACGTATGAATGGCGGTCAACTTGGACTTCAGGATGACAACCCTGCTATCGTGGAGTGGCGG
ATGAAGTATGCCGAGAAGTATGGAGATAAACTTCCACAACTACTTCCAACACCAACGCAAATAAATTTTCCGGAT
GCCAACGATCCTGTTGTCCAGGTATCTGCTGGCTTGCACAACAATGCGGTAGTGACGCAGGGCGGAGCTCTACTA
GCATGGGGTCAAGGCGTACAAGGTGAACTTGGTCTTCGCAAAAAGGAAGAGGTCAAAACGCCGGAGGTTGTTGTG
CGTAAAGAGGGTGGTGCTTGGTTTGCGGCAGCCGTTTCCTGCGGCGGGCAACATACAATTGGGCTTTTCAGAAAG
AAAGACTAG
Gene >Agabi119p4|090860
ATGGCACAACACTTCAATCCCCTTCCGACCCCACCCTTGACAGCGAGACCCGCTCTTGTCCTATTCGCTTGGGGT
GCAGGCAATTTTGGTCAATTTGGCATGGGTCCGGACGTCCTTGACTCATTGACCACGCCACGGAGAAACCAATGG
GTCGAGGCTCAGATCGGAAATGGCACATTTGGCGAGATTGGTGCTGGCATAACCGCTATCGCTGCCGGTGGCCTT
CATACGCTTTTTATAGATGAGAATGGGACCGTACATTGATTATTCTTTCGCCTCGTTGTCTTCTTGTTTATTGAT
TATCTGCCTTAGGTATGGTCCTGCGGTGCTAACGATGATGCTGCCCTTGGTCGAATCACTACGAATGTTCCGAAT
CCTGACAAAGAAGGCTTATTCCTTGATATCGATGAGCTCACAAGCTGGCCGCGACCAATTCAGACATTAGTTGAC
CAGAATTTCCGCGCTGTAGTTGTCGCCGCTGGTGATAGCATCGGTGCTGCGGTCAGTGATGAAGGTGAACTCCGT
GTCTGGGGCACTTACAGGGTAAAATTGTCTCTGTCACTAGCTTCAATTTTCTGAGTATAGTCCCAGGGTATGGAA
GGAGCTCTCGGATTCTCGAGCCGCAGCGAGAAACAGCAACTTCCTACACCAATCCTCACGTCAAGCCGGGTTTCC
TCGGTGGCTGCAGGCAACAACCATCTCGTCATTCTCACAACTCAAGGTTACATTTATACCCTTGGATCCGGTGAA
CAATATCAACTTGGCCGGAAAATCATAGAAGGTCGGAAGATAGACGGAACTAACCCAAGAAAAATTGTTCTTGGT
AAACGTTTGCGTAAAGCCGTCCATGTTGCTGCCGGTTCTTACCACTCTTTCGCCATCGATGAGAATGATGATGTC
TGGGCATGGGGATTGAACAATCTGGGCCAAACTGGTACCGGCTGGTTCTCGGAGGAGGATAATATCGTATATTCA
CCCCAGAAGATCGAGTCCCTCAGCAGACAGAACCTTGCAGGCGATTACGTGACTCAAATTGCTGGAGGCGAGCAT
CATAGTCTTTTCTTGACTTCTGGGGGGAAGGTATATTCTTGTGGACGTATGAATGGCGGTCAACTTGGACTTCAG
GATGACAACCCTGCTATCGTGGAGTGGCGGATGAAGTATGCCGAGAAGTATGGAGATAAACTTCCACAACTACTT
CCAACACCAACGCAAATAAATTTTCCGGATGCCAACGATCCTGTTGTCCAGGTATCTGCTGGCTTGCACAACAAT
GCGGTAGTGACGCAGGGCGGAGCTCTACTAGCATGGGGTCAAGGCGTACAAGGTGAACTTGGTCTTCGCAAAAAG
GAAGAGGTCAAAACGCCGGAGGTTGTTGTGCGTAAAGAGGGTGGTGCTTGGTTTGCGGCAGCCGTTTCCTGCGGC
GGGCAACATACAATTGGGCTTTTCAGAAAGAAAGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail