Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|090840
Gene name
Locationscaffold_06:653522..658421
Strand+
Gene length (bp)4899
Transcript length (bp)3537
Coding sequence length (bp)3537
Protein length (aa) 1179

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 2.0E-24 568 749
PF00072 Response_reg Response regulator receiver domain 5.2E-11 1081 1152

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 424 742 2.0E-20
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 404 749 6.0E-20
sp|Q53RH0|ERS1_ORYSJ Probable ethylene response sensor 1 OS=Oryza sativa subsp. japonica GN=ERS1 PE=2 SV=1 413 752 4.0E-19
sp|A2XL32|ERS1_ORYSI Probable ethylene response sensor 1 OS=Oryza sativa subsp. indica GN=ERS1 PE=2 SV=1 413 752 4.0E-19
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 424 742 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 424 742 2.0E-20
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 404 749 6.0E-20
sp|Q53RH0|ERS1_ORYSJ Probable ethylene response sensor 1 OS=Oryza sativa subsp. japonica GN=ERS1 PE=2 SV=1 413 752 4.0E-19
sp|A2XL32|ERS1_ORYSI Probable ethylene response sensor 1 OS=Oryza sativa subsp. indica GN=ERS1 PE=2 SV=1 413 752 4.0E-19
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 424 742 5.0E-18
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 429 750 7.0E-18
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 429 750 8.0E-18
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 421 742 2.0E-17
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 377 742 3.0E-17
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 421 742 3.0E-17
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 403 748 2.0E-16
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 423 803 2.0E-16
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 429 777 3.0E-16
sp|Q9M7M1|ETR1_PRUPE Ethylene receptor OS=Prunus persica GN=ETR1 PE=2 SV=1 422 760 3.0E-16
sp|P20169|DSPA_SYNY3 Drug sensory protein A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dspA PE=3 SV=2 414 748 3.0E-16
sp|O81122|ETR1_MALDO Ethylene receptor OS=Malus domestica GN=ETR1 PE=2 SV=1 422 773 5.0E-16
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 379 743 1.0E-15
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 424 742 2.0E-15
sp|Q38846|ERS1_ARATH Ethylene response sensor 1 OS=Arabidopsis thaliana GN=ERS1 PE=1 SV=1 404 752 5.0E-14
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 373 742 6.0E-14
sp|Q41342|ETR1_SOLLC Ethylene receptor 1 OS=Solanum lycopersicum GN=ETR1 PE=1 SV=1 410 760 9.0E-14
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 674 759 1.0E-12
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 565 754 2.0E-12
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 379 765 4.0E-12
sp|P0AEC4|ARCB_SHIFL Aerobic respiration control sensor protein ArcB OS=Shigella flexneri GN=arcB PE=3 SV=1 423 742 6.0E-12
sp|P0AEC3|ARCB_ECOLI Aerobic respiration control sensor protein ArcB OS=Escherichia coli (strain K12) GN=arcB PE=1 SV=1 423 742 6.0E-12
sp|P58363|ARCB_ECO57 Aerobic respiration control sensor protein ArcB OS=Escherichia coli O157:H7 GN=arcB PE=3 SV=1 423 742 6.0E-12
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 412 591 7.0E-12
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 424 591 5.0E-11
sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=luxQ PE=3 SV=1 412 591 6.0E-11
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 402 600 1.0E-10
sp|P44578|ARCB_HAEIN Aerobic respiration control sensor protein ArcB homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=arcB PE=3 SV=1 345 594 1.0E-10
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 602 748 1.0E-10
sp|O49230|ETR1_BRAOL Ethylene receptor 1 OS=Brassica oleracea GN=ETR1 PE=2 SV=1 675 763 2.0E-10
sp|Q6GGK7|SRRB_STAAR Sensor protein SrrB OS=Staphylococcus aureus (strain MRSA252) GN=srrB PE=3 SV=2 667 747 3.0E-10
sp|Q9L523|SRRB_STAAU Sensor protein SrrB OS=Staphylococcus aureus GN=srrB PE=2 SV=1 667 747 3.0E-10
sp|Q8NWF3|SRRB_STAAW Sensor protein SrrB OS=Staphylococcus aureus (strain MW2) GN=srrB PE=3 SV=2 667 747 3.0E-10
sp|Q6G973|SRRB_STAAS Sensor protein SrrB OS=Staphylococcus aureus (strain MSSA476) GN=srrB PE=3 SV=2 667 747 3.0E-10
sp|Q5HFT1|SRRB_STAAC Sensor protein SrrB OS=Staphylococcus aureus (strain COL) GN=srrB PE=2 SV=1 667 747 3.0E-10
sp|Q2FY80|SRRB_STAA8 Sensor protein SrrB OS=Staphylococcus aureus (strain NCTC 8325) GN=srrB PE=3 SV=1 667 747 3.0E-10
sp|Q7A5H7|SRRB_STAAN Sensor protein SrrB OS=Staphylococcus aureus (strain N315) GN=srrB PE=1 SV=2 667 747 3.0E-10
sp|Q99TZ9|SRRB_STAAM Sensor protein SrrB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=srrB PE=3 SV=2 667 747 3.0E-10
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 675 766 4.0E-10
sp|P49333|ETR1_ARATH Ethylene receptor 1 OS=Arabidopsis thaliana GN=ETR1 PE=1 SV=1 675 770 4.0E-10
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 422 601 8.0E-10
sp|O82436|ETR1_CUCMN Ethylene receptor 1 OS=Cucumis melo var. cantalupensis GN=ETR1 PE=2 SV=1 675 760 1.0E-09
sp|O49187|ETR2_SOLLC Ethylene receptor 2 OS=Solanum lycopersicum GN=ETR2 PE=2 SV=1 675 760 1.0E-09
sp|P35164|RESE_BACSU Sensor histidine kinase ResE OS=Bacillus subtilis (strain 168) GN=resE PE=1 SV=1 675 747 2.0E-09
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 668 751 2.0E-09
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 668 751 2.0E-09
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 675 748 2.0E-09
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 410 591 2.0E-09
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 671 748 3.0E-09
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 406 591 3.0E-09
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 406 591 3.0E-09
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 406 591 3.0E-09
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 406 591 3.0E-09
sp|Q9SSY6|ETR1_CUCSA Ethylene receptor 1 OS=Cucumis sativus GN=ETR1 PE=2 SV=1 675 760 5.0E-09
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 412 600 7.0E-09
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 412 600 7.0E-09
sp|Q9XH58|ETR1_PELHO Ethylene receptor 1 OS=Pelargonium hortorum GN=ETR1 PE=2 SV=1 675 766 7.0E-09
sp|Q9ZWL6|ETR1_PASED Ethylene receptor OS=Passiflora edulis GN=ETR1 PE=2 SV=1 675 750 9.0E-09
sp|O48929|ETR1_TOBAC Ethylene receptor OS=Nicotiana tabacum GN=ETR1 PE=2 SV=1 675 763 1.0E-08
sp|P23545|PHOR_BACSU Alkaline phosphatase synthesis sensor protein PhoR OS=Bacillus subtilis (strain 168) GN=phoR PE=1 SV=1 675 747 1.0E-08
sp|P30855|EVGS_ECOLI Sensor protein EvgS OS=Escherichia coli (strain K12) GN=evgS PE=1 SV=2 674 758 2.0E-08
sp|P0DMK6|IRLS_BURPS Sensor protein IrlS OS=Burkholderia pseudomallei (strain K96243) GN=irlS PE=3 SV=1 662 747 3.0E-08
sp|I1WSZ3|IRLS_BURP2 Sensor protein IrlS OS=Burkholderia pseudomallei (strain 1026b) GN=irlS PE=3 SV=1 662 747 3.0E-08
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 664 763 5.0E-08
sp|E0X9C7|TODS_PSEPT Sensor histidine kinase TodS OS=Pseudomonas putida (strain DOT-T1E) GN=todS PE=1 SV=1 677 785 6.0E-08
sp|A5W4E3|TODS_PSEP1 Sensor histidine kinase TodS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todS PE=1 SV=1 677 785 6.0E-08
sp|Q03228|DIVJ_CAUCR Histidine protein kinase DivJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divJ PE=1 SV=2 674 748 7.0E-08
sp|Q08408|RPRX_BACFR Sensor protein RprX OS=Bacteroides fragilis (strain YCH46) GN=rprX PE=3 SV=2 677 748 7.0E-08
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 657 750 1.0E-07
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 657 750 1.0E-07
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 657 750 1.0E-07
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 657 750 1.0E-07
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 670 763 1.0E-07
sp|O34206|KINB_PSEAI Alginate biosynthesis sensor protein KinB OS=Pseudomonas aeruginosa GN=kinB PE=1 SV=1 675 748 1.0E-07
sp|A5A2P0|WALK_STASR Sensor protein kinase WalK (Fragment) OS=Staphylococcus sciuri subsp. rodentium GN=walK PE=3 SV=1 677 747 1.0E-07
sp|Q9XH57|ETR2_PELHO Ethylene receptor 2 OS=Pelargonium hortorum GN=ETR2 PE=2 SV=1 675 750 1.0E-07
sp|P14377|ZRAS_ECOLI Sensor protein ZraS OS=Escherichia coli (strain K12) GN=zraS PE=1 SV=2 675 750 2.0E-07
sp|P94414|YCLK_BACSU Sensor histidine kinase YclK OS=Bacillus subtilis (strain 168) GN=yclK PE=3 SV=1 653 748 2.0E-07
sp|Q45614|YYCG_BACSU Sensor histidine kinase YycG OS=Bacillus subtilis (strain 168) GN=yycG PE=1 SV=1 419 747 2.0E-07
sp|P58402|EVGS_ECO57 Sensor protein EvgS OS=Escherichia coli O157:H7 GN=evgS PE=3 SV=1 674 750 2.0E-07
sp|Q8CSL7|ARLS_STAES Signal transduction histidine-protein kinase ArlS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=arlS PE=3 SV=1 674 748 3.0E-07
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 665 748 3.0E-07
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 657 748 3.0E-07
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 675 748 3.0E-07
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 657 748 3.0E-07
sp|Q03228|DIVJ_CAUCR Histidine protein kinase DivJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divJ PE=1 SV=2 413 596 4.0E-07
sp|P37461|ZRAS_SALTY Sensor protein ZraS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zraS PE=2 SV=2 666 748 4.0E-07
sp|Q8Z332|ZRAS_SALTI Sensor protein ZraS OS=Salmonella typhi GN=zraS PE=3 SV=1 666 748 4.0E-07
sp|P9WGK5|SENX3_MYCTU Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=senX3 PE=1 SV=1 649 747 4.0E-07
sp|P9WGK4|SENX3_MYCTO Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=senX3 PE=3 SV=1 649 747 4.0E-07
sp|P0A601|SENX3_MYCBO Sensor-like histidine kinase senX3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=senX3 PE=3 SV=1 649 747 4.0E-07
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 664 764 6.0E-07
sp|Q5HPC4|ARLS_STAEQ Signal transduction histidine-protein kinase ArlS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=arlS PE=3 SV=1 674 748 6.0E-07
sp|Q6GGZ4|ARLS_STAAR Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MRSA252) GN=arlS PE=3 SV=1 677 744 6.0E-07
sp|Q2YY04|ARLS_STAAB Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=arlS PE=3 SV=1 677 744 6.0E-07
sp|A0QTK3|MTRB_MYCS2 Sensor histidine kinase MtrB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtrB PE=3 SV=2 669 763 6.0E-07
sp|P9WGK8|MTRB_MYCTO Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mtrB PE=3 SV=1 669 763 6.0E-07
sp|P59963|MTRB_MYCBO Sensor histidine kinase MtrB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mtrB PE=3 SV=1 669 763 6.0E-07
sp|Q7A0W5|ARLS_STAAW Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MW2) GN=arlS PE=3 SV=1 677 744 6.0E-07
sp|Q6G9E7|ARLS_STAAS Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MSSA476) GN=arlS PE=3 SV=1 677 744 6.0E-07
sp|Q7A5N3|ARLS_STAAN Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain N315) GN=arlS PE=1 SV=1 677 744 6.0E-07
sp|Q7A2R7|ARLS_STAAM Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arlS PE=3 SV=1 677 744 6.0E-07
sp|Q5HG05|ARLS_STAAC Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain COL) GN=arlS PE=3 SV=1 677 744 6.0E-07
sp|Q9KJN3|ARLS_STAA8 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain NCTC 8325) GN=arlS PE=1 SV=1 677 744 6.0E-07
sp|Q2FH24|ARLS_STAA3 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain USA300) GN=arlS PE=3 SV=1 677 744 6.0E-07
sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=luxQ PE=3 SV=1 659 748 8.0E-07
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 424 591 8.0E-07
sp|Q8KIY1|TMOS_PSEME Sensor histidine kinase TmoS OS=Pseudomonas mendocina GN=tmoS PE=1 SV=1 677 748 8.0E-07
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 675 742 9.0E-07
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 392 599 9.0E-07
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 417 591 1.0E-06
sp|Q9RZA4|BPHY_DEIRA Bacteriophytochrome OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=bphP PE=1 SV=1 677 747 1.0E-06
sp|P9WGK9|MTRB_MYCTU Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtrB PE=1 SV=1 669 763 1.0E-06
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 677 764 1.0E-06
sp|Q0DKM0|ERS2_ORYSJ Probable ethylene response sensor 2 OS=Oryza sativa subsp. japonica GN=ERS2 PE=2 SV=1 413 591 1.0E-06
sp|B8AY75|ERS2_ORYSI Probable ethylene response sensor 2 OS=Oryza sativa subsp. indica GN=ERS2 PE=2 SV=1 413 591 1.0E-06
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 669 750 2.0E-06
sp|Q9CCJ1|MTRB_MYCLE Sensor histidine kinase MtrB OS=Mycobacterium leprae (strain TN) GN=mtrB PE=3 SV=1 669 763 2.0E-06
sp|Q93CB7|MTRB_MYCPA Sensor histidine kinase MtrB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mtrB PE=3 SV=1 669 763 2.0E-06
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 658 748 3.0E-06
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 661 754 3.0E-06
sp|Q9RDT3|WALK_STAAU Sensor protein kinase WalK (Fragment) OS=Staphylococcus aureus GN=walK PE=1 SV=1 677 747 3.0E-06
sp|P54883|SEX3_MYCLE Sensor-like histidine kinase senX3 OS=Mycobacterium leprae (strain TN) GN=senX3 PE=3 SV=1 675 747 3.0E-06
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 415 591 3.0E-06
sp|Q4LAJ8|WALK_STAHJ Sensor protein kinase WalK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=walK PE=3 SV=1 677 747 3.0E-06
sp|Q4A159|WALK_STAS1 Sensor protein kinase WalK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=walK PE=3 SV=1 677 747 3.0E-06
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 949 1143 4.0E-06
sp|Q0DKM0|ERS2_ORYSJ Probable ethylene response sensor 2 OS=Oryza sativa subsp. japonica GN=ERS2 PE=2 SV=1 677 763 4.0E-06
sp|B8AY75|ERS2_ORYSI Probable ethylene response sensor 2 OS=Oryza sativa subsp. indica GN=ERS2 PE=2 SV=1 677 763 4.0E-06
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 669 742 4.0E-06
sp|Q8X614|ZRAS_ECO57 Sensor protein ZraS OS=Escherichia coli O157:H7 GN=zraS PE=3 SV=1 675 750 4.0E-06
sp|Q9ZTP3|EIN4_ARATH Protein EIN4 OS=Arabidopsis thaliana GN=EIN4 PE=1 SV=1 403 598 4.0E-06
sp|Q8FK37|CUSS_ECOL6 Sensor kinase CusS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cusS PE=3 SV=1 670 747 4.0E-06
sp|P39453|TORS_ECOLI Sensor protein TorS OS=Escherichia coli (strain K12) GN=torS PE=1 SV=4 415 599 4.0E-06
sp|A6QD58|WALK_STAAE Sensor protein kinase WalK OS=Staphylococcus aureus (strain Newman) GN=walK PE=3 SV=1 677 747 4.0E-06
sp|Q7A215|WALK_STAAW Sensor protein kinase WalK OS=Staphylococcus aureus (strain MW2) GN=walK PE=3 SV=1 677 747 4.0E-06
sp|A8YYU2|WALK_STAAT Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=walK PE=3 SV=1 677 747 4.0E-06
sp|Q6GD71|WALK_STAAS Sensor protein kinase WalK OS=Staphylococcus aureus (strain MSSA476) GN=walK PE=3 SV=1 677 747 4.0E-06
sp|Q7A8E0|WALK_STAAN Sensor protein kinase WalK OS=Staphylococcus aureus (strain N315) GN=walK PE=1 SV=1 677 747 4.0E-06
sp|Q7A305|WALK_STAAM Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=walK PE=3 SV=1 677 747 4.0E-06
sp|Q5HJX6|WALK_STAAC Sensor protein kinase WalK OS=Staphylococcus aureus (strain COL) GN=walK PE=3 SV=1 677 747 4.0E-06
sp|Q2YUQ2|WALK_STAAB Sensor protein kinase WalK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=walK PE=3 SV=1 677 747 4.0E-06
sp|A5INR0|WALK_STAA9 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH9) GN=walK PE=3 SV=1 677 747 4.0E-06
sp|Q2G2U4|WALK_STAA8 Sensor protein kinase WalK OS=Staphylococcus aureus (strain NCTC 8325) GN=walK PE=1 SV=1 677 747 4.0E-06
sp|Q2FKN7|WALK_STAA3 Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300) GN=walK PE=3 SV=1 677 747 4.0E-06
sp|A6TXG9|WALK_STAA2 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH1) GN=walK PE=3 SV=1 677 747 4.0E-06
sp|A7WWQ7|WALK_STAA1 Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=walK PE=3 SV=1 677 747 4.0E-06
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 1078 1152 5.0E-06
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 1078 1152 5.0E-06
sp|Q6GKS6|WALK_STAAR Sensor protein kinase WalK OS=Staphylococcus aureus (strain MRSA252) GN=walK PE=3 SV=1 677 747 5.0E-06
sp|Q8CU87|WALK_STAES Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=walK PE=1 SV=1 677 750 5.0E-06
sp|Q5HK19|WALK_STAEQ Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=walK PE=1 SV=1 677 750 5.0E-06
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 657 748 5.0E-06
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 657 748 5.0E-06
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 397 591 6.0E-06
sp|P16575|BVGS_BORPE Virulence sensor protein BvgS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bvgS PE=1 SV=3 675 755 7.0E-06
sp|A0QR01|SENX3_MYCS2 Signal-transduction histidine kinase senX3 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=senX3 PE=1 SV=1 675 747 7.0E-06
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 341 591 8.0E-06
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 341 591 8.0E-06
sp|Q52969|Y1002_RHIME Uncharacterized sensor-like histidine kinase R01002 OS=Rhizobium meliloti (strain 1021) GN=R01002 PE=3 SV=2 657 767 8.0E-06
sp|P77485|CUSS_ECOLI Sensor kinase CusS OS=Escherichia coli (strain K12) GN=cusS PE=1 SV=1 670 747 8.0E-06
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 679 742 9.0E-06
sp|P26762|BVGS_BORBR Virulence sensor protein BvgS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bvgS PE=3 SV=2 671 748 9.0E-06
sp|P40330|BVGS_BORPA Virulence sensor protein BvgS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bvgS PE=3 SV=2 671 748 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0000160 phosphorelay signal transduction system Yes
GO:0007165 signal transduction No
GO:0035556 intracellular signal transduction No
GO:0065007 biological regulation No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 223 240 17
2 255 275 20
3 282 304 22
4 337 359 22
5 372 391 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|090840
MSSWFRRLTYPRVPPWSDDEEHLGPPAPTPMSENTQDFPKYGMPTTATSTAVDHILPPPTTHPRNPARLKIASRL
HLGVYWMRLKKQLGTGIAPSNSSFLGDSTVEGSTKREGQPVDEDGEVDTVVVDRAWSEEFKSSDSSPSEQGPIIM
PFDRSAMGHTGQTTGKSSDHESEEPRGFGRILRIFVVLRYKFFPALHEFFFTRFEDEKSESHYAQEDWMLKKSLA
LWGALWLIVNWVVGVALLDKNEGDTEGPDIAFYYVIGPLLAIPVLWMVIYDWPRNRPVFYQLFLLCAIWSWGFYI
ILYLKICQFYGPPSKSPPFCRGRDFLGTFFYTTALQTMGLFGLNLNRLMAAIGALCFFVMTSALMIPEQQSWVRN
MINFFVFHFFLIYVHYMREKSERRLYTLRYQLKIQWKATQKAQVNERRAADSKRRLTSYVFHEVRVPLNTALLAV
QNMHACGVVKEQQLEFSALSNSLIMMSKVLNDVLDFNKMDSGKFESASKPYAFHQTMQSLCNSVEIDTSSNGLSF
STFLDPNIDIVARKAAYQALGEDMDVIRRYIEDNPNIPGVVTGDEVRLRQVVTNLASNACKFTDKGGKIWIRTKL
VLPVVPPGGNLLQTLQPNPAEETVDEKPRYPLTASHLSQHDTEQEMEEKGSKKSCSKFRNNSSIPKESAAETIIV
RIEVEDSGSGIKPSDMHKLFTAFNQTEQGRLQGGKGTGLGLALVRQIVKLSGGRLGVQSKVGRGSTFWVELPLGI
GNEAVTTQFPPHPDVSRGYNHFEHLHGQPVIQKEAAKSENAAPRTRKNDTTGKYEENESKSPTTESVMLDYTNEG
DRSGPEMKEQALGERVFVHGPSNLSARMQSTVSASADEGGDLARDGSTAPTPTFSITPTASAMATPDSEKGSDAI
EEEVFQSEKNGSSSSNIPVPNGKRVIQRPTFVQLPSPRTFSIEAHIPPISPSAIYTPAIGSSYSSTSTSPLAMFD
ANYARGSPSSLNAGMSFESVGMPVLVVDDDPLTRTLMKKILTRLGCQVSCAENGEVALEMILGRRICIPLSTPSS
DYSMREMKPILEQEVSPQRSTSACTPPESNDEYKFAVIFLDNQMPKMSGLKVVAKLRSMERKDFVVGVTGNALLA
DQQEYLEAGVDKVLTKPVLERSLRDALQCADEKRKIYMRETNSPEISRAPPSR*
Coding >Agabi119p4|090840
ATGTCCTCCTGGTTCAGACGACTCACATATCCTCGTGTTCCTCCATGGTCTGATGACGAAGAACACCTGGGCCCG
CCCGCCCCCACCCCCATGAGCGAGAACACTCAGGATTTCCCCAAGTATGGCATGCCCACCACAGCTACCTCCACA
GCCGTCGACCACATTCTCCCCCCTCCCACAACTCATCCTCGTAATCCGGCTCGTTTAAAAATCGCATCACGTCTT
CATTTGGGCGTCTACTGGATGCGCTTGAAGAAACAGCTCGGAACAGGCATAGCTCCCTCGAATAGTTCTTTTCTG
GGGGACAGTACGGTGGAAGGCTCCACAAAACGGGAAGGTCAACCGGTGGATGAGGATGGGGAAGTGGACACAGTA
GTTGTTGACCGTGCTTGGTCAGAAGAATTCAAAAGTTCAGACTCGTCGCCGTCGGAACAAGGACCTATCATAATG
CCATTTGATAGGTCGGCCATGGGACACACTGGACAAACTACAGGAAAATCTAGCGATCATGAAAGCGAAGAACCG
AGAGGTTTCGGGCGAATATTGAGAATTTTCGTTGTCCTGCGCTACAAGTTCTTTCCCGCCCTCCACGAGTTTTTT
TTCACCCGCTTTGAAGATGAGAAATCCGAAAGTCACTATGCACAGGAGGATTGGATGCTAAAAAAAAGTTTAGCA
CTTTGGGGGGCACTCTGGCTTATAGTCAATTGGGTCGTCGGCGTCGCTCTGCTGGACAAAAATGAAGGTGATACC
GAAGGTCCTGACATTGCTTTTTATTATGTGATTGGACCTCTGTTGGCTATCCCAGTGCTATGGATGGTAATCTAC
GACTGGCCCCGAAATCGACCTGTGTTTTACCAATTATTTTTGCTTTGCGCGATTTGGTCCTGGGGATTCTACATT
ATTTTGTATCTGAAAATATGCCAATTCTATGGCCCACCGTCAAAATCACCCCCTTTCTGCAGGGGGCGCGATTTT
TTGGGGACATTTTTCTATACAACGGCATTGCAAACCATGGGTCTATTCGGGCTGAATCTGAACAGGTTGATGGCG
GCCATTGGAGCGCTGTGCTTTTTCGTCATGACCTCGGCTCTCATGATACCGGAGCAACAAAGCTGGGTTAGGAAC
ATGATAAACTTTTTTGTCTTCCACTTCTTCCTTATATATGTGCACTACATGCGCGAAAAGTCAGAGAGGCGCCTG
TACACTCTTCGATATCAACTGAAGATCCAGTGGAAGGCCACTCAGAAAGCTCAGGTGAACGAGCGGAGGGCAGCT
GATTCGAAACGAAGGTTGACTTCCTATGTTTTTCATGAAGTGCGAGTGCCGTTGAATACTGCTCTGCTGGCTGTC
CAGAACATGCATGCCTGTGGAGTTGTGAAAGAACAACAACTCGAGTTCAGCGCGTTATCCAACAGTTTAATCATG
ATGTCGAAAGTGCTCAACGATGTCCTGGATTTCAACAAGATGGATAGTGGTAAATTTGAATCGGCTTCAAAACCA
TATGCGTTCCATCAGACAATGCAATCCCTTTGTAATTCCGTCGAAATTGACACTTCCTCCAATGGGTTGTCTTTC
TCGACGTTTCTAGATCCAAATATTGATATTGTTGCTCGAAAAGCTGCCTATCAGGCACTGGGCGAAGACATGGAT
GTTATCCGCCGATATATCGAGGACAACCCAAATATTCCGGGTGTTGTTACTGGGGATGAGGTTCGATTAAGACAA
GTCGTTACAAACCTTGCCAGCAATGCGTGCAAGTTCACGGATAAAGGTGGTAAGATTTGGATACGAACAAAGCTA
GTACTTCCCGTCGTACCACCAGGAGGAAATTTGCTTCAAACACTACAACCCAATCCTGCGGAAGAAACCGTGGAC
GAAAAACCACGGTACCCACTAACTGCATCACATCTCAGTCAGCACGATACTGAACAGGAAATGGAAGAGAAAGGA
AGCAAGAAATCGTGTTCAAAGTTTCGTAACAATTCCAGTATTCCGAAAGAGTCTGCTGCGGAGACCATCATAGTG
AGGATTGAAGTAGAGGATTCTGGGTCAGGAATCAAGCCATCCGACATGCATAAGCTCTTTACCGCGTTCAACCAG
ACAGAACAAGGGCGATTGCAAGGTGGGAAGGGGACTGGTTTGGGTTTAGCGCTTGTGCGACAAATTGTCAAATTG
AGTGGAGGGAGGCTCGGGGTGCAATCAAAAGTTGGACGGGGATCGACATTCTGGGTAGAACTTCCACTTGGAATC
GGAAACGAAGCTGTGACAACACAATTCCCGCCTCATCCTGACGTGTCGAGAGGATACAATCACTTTGAACACCTG
CACGGACAGCCTGTTATCCAAAAGGAAGCGGCAAAAAGTGAAAATGCAGCACCTAGAACACGGAAGAATGACACC
ACGGGGAAGTACGAGGAGAATGAATCAAAATCTCCAACGACAGAATCTGTAATGCTTGATTATACGAATGAAGGT
GATCGCTCCGGACCCGAAATGAAAGAGCAAGCATTGGGTGAGCGCGTGTTCGTACATGGACCGAGCAATCTGTCG
GCCCGTATGCAGTCCACCGTTTCAGCCTCAGCAGATGAAGGAGGTGACTTAGCTCGAGACGGAAGTACAGCACCC
ACACCGACCTTTTCAATTACGCCCACCGCAAGTGCCATGGCGACCCCGGACAGCGAGAAGGGATCAGATGCGATT
GAGGAAGAAGTCTTTCAGAGTGAAAAGAACGGCTCGTCATCTTCAAACATACCAGTGCCTAATGGGAAGAGGGTG
ATACAACGGCCGACATTCGTTCAACTGCCTTCTCCAAGAACATTCTCAATTGAAGCACATATACCTCCAATATCA
CCGTCTGCTATCTATACGCCTGCAATTGGCTCTTCGTATTCCTCCACATCAACATCACCCTTGGCAATGTTTGAT
GCGAACTATGCTCGGGGGAGTCCCTCTTCCTTAAATGCTGGAATGAGTTTTGAATCAGTGGGGATGCCGGTGTTG
GTAGTTGACGACGATCCATTGACGCGGACGCTGATGAAGAAAATACTAACGAGATTGGGATGCCAAGTGTCTTGC
GCTGAGAACGGTGAGGTAGCACTGGAGATGATTTTGGGGAGACGAATATGTATTCCGCTATCGACGCCATCGAGT
GACTATTCTATGAGGGAGATGAAGCCGATATTGGAGCAGGAAGTGTCACCACAACGGTCGACGTCTGCGTGTACG
CCACCGGAATCGAATGATGAATACAAGTTTGCAGTAATATTCTTGGATAACCAAATGCCAAAGATGTCGGGGCTG
AAGGTCGTGGCGAAACTGAGGTCGATGGAGAGGAAAGATTTTGTTGTGGGCGTGACAGGCAATGCATTATTAGCT
GATCAGCAGGAGTACCTTGAAGCCGGTGTGGATAAGGTTCTGACAAAGCCTGTCCTCGAGAGAAGTTTGCGAGAC
GCGTTGCAGTGTGCGGATGAGAAGAGGAAAATTTACATGCGAGAAACGAATAGCCCAGAAATTTCCCGGGCCCCA
CCCTCGCGATGA
Transcript >Agabi119p4|090840
ATGTCCTCCTGGTTCAGACGACTCACATATCCTCGTGTTCCTCCATGGTCTGATGACGAAGAACACCTGGGCCCG
CCCGCCCCCACCCCCATGAGCGAGAACACTCAGGATTTCCCCAAGTATGGCATGCCCACCACAGCTACCTCCACA
GCCGTCGACCACATTCTCCCCCCTCCCACAACTCATCCTCGTAATCCGGCTCGTTTAAAAATCGCATCACGTCTT
CATTTGGGCGTCTACTGGATGCGCTTGAAGAAACAGCTCGGAACAGGCATAGCTCCCTCGAATAGTTCTTTTCTG
GGGGACAGTACGGTGGAAGGCTCCACAAAACGGGAAGGTCAACCGGTGGATGAGGATGGGGAAGTGGACACAGTA
GTTGTTGACCGTGCTTGGTCAGAAGAATTCAAAAGTTCAGACTCGTCGCCGTCGGAACAAGGACCTATCATAATG
CCATTTGATAGGTCGGCCATGGGACACACTGGACAAACTACAGGAAAATCTAGCGATCATGAAAGCGAAGAACCG
AGAGGTTTCGGGCGAATATTGAGAATTTTCGTTGTCCTGCGCTACAAGTTCTTTCCCGCCCTCCACGAGTTTTTT
TTCACCCGCTTTGAAGATGAGAAATCCGAAAGTCACTATGCACAGGAGGATTGGATGCTAAAAAAAAGTTTAGCA
CTTTGGGGGGCACTCTGGCTTATAGTCAATTGGGTCGTCGGCGTCGCTCTGCTGGACAAAAATGAAGGTGATACC
GAAGGTCCTGACATTGCTTTTTATTATGTGATTGGACCTCTGTTGGCTATCCCAGTGCTATGGATGGTAATCTAC
GACTGGCCCCGAAATCGACCTGTGTTTTACCAATTATTTTTGCTTTGCGCGATTTGGTCCTGGGGATTCTACATT
ATTTTGTATCTGAAAATATGCCAATTCTATGGCCCACCGTCAAAATCACCCCCTTTCTGCAGGGGGCGCGATTTT
TTGGGGACATTTTTCTATACAACGGCATTGCAAACCATGGGTCTATTCGGGCTGAATCTGAACAGGTTGATGGCG
GCCATTGGAGCGCTGTGCTTTTTCGTCATGACCTCGGCTCTCATGATACCGGAGCAACAAAGCTGGGTTAGGAAC
ATGATAAACTTTTTTGTCTTCCACTTCTTCCTTATATATGTGCACTACATGCGCGAAAAGTCAGAGAGGCGCCTG
TACACTCTTCGATATCAACTGAAGATCCAGTGGAAGGCCACTCAGAAAGCTCAGGTGAACGAGCGGAGGGCAGCT
GATTCGAAACGAAGGTTGACTTCCTATGTTTTTCATGAAGTGCGAGTGCCGTTGAATACTGCTCTGCTGGCTGTC
CAGAACATGCATGCCTGTGGAGTTGTGAAAGAACAACAACTCGAGTTCAGCGCGTTATCCAACAGTTTAATCATG
ATGTCGAAAGTGCTCAACGATGTCCTGGATTTCAACAAGATGGATAGTGGTAAATTTGAATCGGCTTCAAAACCA
TATGCGTTCCATCAGACAATGCAATCCCTTTGTAATTCCGTCGAAATTGACACTTCCTCCAATGGGTTGTCTTTC
TCGACGTTTCTAGATCCAAATATTGATATTGTTGCTCGAAAAGCTGCCTATCAGGCACTGGGCGAAGACATGGAT
GTTATCCGCCGATATATCGAGGACAACCCAAATATTCCGGGTGTTGTTACTGGGGATGAGGTTCGATTAAGACAA
GTCGTTACAAACCTTGCCAGCAATGCGTGCAAGTTCACGGATAAAGGTGGTAAGATTTGGATACGAACAAAGCTA
GTACTTCCCGTCGTACCACCAGGAGGAAATTTGCTTCAAACACTACAACCCAATCCTGCGGAAGAAACCGTGGAC
GAAAAACCACGGTACCCACTAACTGCATCACATCTCAGTCAGCACGATACTGAACAGGAAATGGAAGAGAAAGGA
AGCAAGAAATCGTGTTCAAAGTTTCGTAACAATTCCAGTATTCCGAAAGAGTCTGCTGCGGAGACCATCATAGTG
AGGATTGAAGTAGAGGATTCTGGGTCAGGAATCAAGCCATCCGACATGCATAAGCTCTTTACCGCGTTCAACCAG
ACAGAACAAGGGCGATTGCAAGGTGGGAAGGGGACTGGTTTGGGTTTAGCGCTTGTGCGACAAATTGTCAAATTG
AGTGGAGGGAGGCTCGGGGTGCAATCAAAAGTTGGACGGGGATCGACATTCTGGGTAGAACTTCCACTTGGAATC
GGAAACGAAGCTGTGACAACACAATTCCCGCCTCATCCTGACGTGTCGAGAGGATACAATCACTTTGAACACCTG
CACGGACAGCCTGTTATCCAAAAGGAAGCGGCAAAAAGTGAAAATGCAGCACCTAGAACACGGAAGAATGACACC
ACGGGGAAGTACGAGGAGAATGAATCAAAATCTCCAACGACAGAATCTGTAATGCTTGATTATACGAATGAAGGT
GATCGCTCCGGACCCGAAATGAAAGAGCAAGCATTGGGTGAGCGCGTGTTCGTACATGGACCGAGCAATCTGTCG
GCCCGTATGCAGTCCACCGTTTCAGCCTCAGCAGATGAAGGAGGTGACTTAGCTCGAGACGGAAGTACAGCACCC
ACACCGACCTTTTCAATTACGCCCACCGCAAGTGCCATGGCGACCCCGGACAGCGAGAAGGGATCAGATGCGATT
GAGGAAGAAGTCTTTCAGAGTGAAAAGAACGGCTCGTCATCTTCAAACATACCAGTGCCTAATGGGAAGAGGGTG
ATACAACGGCCGACATTCGTTCAACTGCCTTCTCCAAGAACATTCTCAATTGAAGCACATATACCTCCAATATCA
CCGTCTGCTATCTATACGCCTGCAATTGGCTCTTCGTATTCCTCCACATCAACATCACCCTTGGCAATGTTTGAT
GCGAACTATGCTCGGGGGAGTCCCTCTTCCTTAAATGCTGGAATGAGTTTTGAATCAGTGGGGATGCCGGTGTTG
GTAGTTGACGACGATCCATTGACGCGGACGCTGATGAAGAAAATACTAACGAGATTGGGATGCCAAGTGTCTTGC
GCTGAGAACGGTGAGGTAGCACTGGAGATGATTTTGGGGAGACGAATATGTATTCCGCTATCGACGCCATCGAGT
GACTATTCTATGAGGGAGATGAAGCCGATATTGGAGCAGGAAGTGTCACCACAACGGTCGACGTCTGCGTGTACG
CCACCGGAATCGAATGATGAATACAAGTTTGCAGTAATATTCTTGGATAACCAAATGCCAAAGATGTCGGGGCTG
AAGGTCGTGGCGAAACTGAGGTCGATGGAGAGGAAAGATTTTGTTGTGGGCGTGACAGGCAATGCATTATTAGCT
GATCAGCAGGAGTACCTTGAAGCCGGTGTGGATAAGGTTCTGACAAAGCCTGTCCTCGAGAGAAGTTTGCGAGAC
GCGTTGCAGTGTGCGGATGAGAAGAGGAAAATTTACATGCGAGAAACGAATAGCCCAGAAATTTCCCGGGCCCCA
CCCTCGCGATGA
Gene >Agabi119p4|090840
ATGTCCTCCTGGTTCAGACGACTCACATATCCTCGTGTTCCTCCATGGTCTGATGACGAAGAACACCTGGGCCCG
CCCGCCCCCACCCCCATGAGCGAGAACACTCAGGATTTCCCCAAGTATGGCATGCCCACCACAGCTACCTCCACA
GCCGTCGACCACATTCTCCCCCCTCCCACAACTCATCCTCGTAATCCGGCTCGTTTAAAAATCGCATCACGTCTT
CATTTGGGCGTCTACTGGATGCGCTTGAAGAAACAGCTCGGAACAGGCATAGCTCCCTCGAATAGTTCTTTTCTG
GGGGACAGTACGGTGGAAGGCTCCACAAAACGGGAAGGTCAACCGGTGGATGAGGATGGGGAAGTGGACACAGTA
GTTGTTGACCGTGCTTGGTCAGAAGAATTCAAAAGTTCAGACTCGTCGCCGTCGGAACAAGGACCTATCATAATG
CCATTTGATAGGTCGGCCATGGGACACACTGGACAAACTACAGGAAAATCTAGCGATCATGAAAGCGAAGAACCG
AGAGGTTTCGGGCGAATATTGAGAATTTTCGTTGTCCTGCGCTACAAGTTCTTTCCCGCCCTCCACGAGTTTTTT
TTCACCCGCTTTGAAGATGAGAAATCCGAAAGTCACTATGCACAGGTTGCTTCTACCATTTTCCAGCAGATATAT
CAATTGACAACATCATGTAGGAGGATTGGATGCTAAAAAAAAGTTTAGCACTTTGGGGGGCACTCTGGCTTATAG
TCAATTGGGTCGTCGGCGTCGCTCTGCTGGACAAAAATGAAGGTGATACCGAAGGTCCTGACATTGCTTTTTATT
ATGTGGTACGTATGCTATTCCCCGCGTAATGCCACCATTGAAATTATATCCTTTAGATTGGACCTCTGTTGGCTA
TCCCAGTGCTGTAAGTTACTCCAAAATTCTCCGCGATGGTTTACCTTATATCACCAGATGGATGGTAATCTACGA
CTGGCCCCGAAATCGACCTGTGTTTTACCAATTATTTTTGCTTTGCGCGATTTGGTCCTGGTAAGCTCTTCAGTA
GTTCCTGTGCTCCACTTTAACTTGCTTATCTAGGGGATTCTACATTATTTTGTATCTGTAAGCTAGCATCGGTTT
TATCTTTTTTGTCCCTGAGACGCGGTAATTCCAGGAAAATATGCCAATTCTATGGCCCACCGTCAAAATCACCCC
CTTTCTGCAGGGGGCGCGATTTTTTGGGGACATTTTTCTATACAACGGTAATACTTTTTCAAAACTGTGATCATG
GCATTCCTTACATTGGTGATAGGCATTGCAAACCATGGGTCTATTCGGGCTGAATCTGAACAGGTTGATGGCGGC
CATTGGAGCGCTGTGCTTTTTCGTCATGTCAGTCAAACAAGTATTCCACAGATTCTTGTTTGCTGACACCTTGAA
TAGGACCTCGGCTCTCATGATACCGGAGCAACAAAGCTGGGTTAGGAGTAAGTTGCATTTTAACCAATATACTTG
ATAATAACTTGCCTAAACAGACATGATAAACTTTTTTGTCTTCCACTTCTGTAAGTTCTGTACGACTTTCTCTGA
AGTCTACTTACATTCTTGCGGAAAATTCAGTCCTTATATATGTGCACTACATGCGCGAAAAGGTGAGGTGTTTTC
AATAATATCCCAAGGCAGTAATTGACACGATATCAGTCAGAGAGGCGCCTGTACACTCTTCGATATCAACTGAAG
ATCCAGTGGAAGGTAATGAATTCACTCTCCTGTGCTTTCTTTAAATTATAATTTCTCTCTCAAATATAATAGGCC
ACTCAGAAAGCTCAGGTGAACGAGCGGAGGGCAGCTGATTCGAAACGAAGGTTGACTTCGTGAGTGGATCTCTTT
TGAGTTCTTTCGCCTGCGGCTAATTTTCCCTCAGCTATGTTTTTCATGATGAGTAAAATTGCTATAAGCATGGGA
AACTCTACTTACCTTTTTTCCGGTCAATACAAGTGCGAGTGCCGTTGAATACTGCTCGTGAGTTATTTTATTTCC
CGTTTATATGCGCTCATAGTCTACCTAGTGCTGGCTGTCCAGAACATGCATGCCTGTGGAGTTGTGAAAGAACAA
CAACTCGAGTTCAGCGCGTTATCCAACAGTTTAATCATGATGTCGAAAGGTAGGCCGGAAATATAGCGACCACCA
TATCAGGAACTCACGGCTTGACTATTAGTGCTCAACGATGTCCTGGATTTGTGCGTGACTGTTATCCTGGCATTT
AGATGGTGGACTAAGTATTTTTTTTAGCAACAAGATGGATAGTGGTAAATTTGAATCGGCTTCAAAAGTATGCGC
TTGCCCTTGACATTCAAAAGTACAGGTTATTGATGAGATTCTTCTAGCCATATGCGTTCCATCAGACAATGCAAT
CCCTTTGTAATTCCGTCGAAATTGACACTTCCTCCAATGGGTTGTCTTTCTCGACGTTTCTAGATCCAAATATTG
ATATTGTAAGTTTACATGCGCGTAGGTTGAGACGCCATCAAATCAAACTTTCAGGTTGCTCGAAAAGCTGCCTAT
CAGGCACTGGGCGAAGACATGGATGTTATCCGCCGATATATCGAGGACAACCCAAATATTCCGGGTGTTGTTACT
GGGGATGAGGTTCGATTAAGACAAGTCGTTACAAACCTTGCCAGGTAAGTTTCTTTTCGAGATAAGTCTCAATAT
AGTTTTCAATACTTCATCTCAAGCAATGCGTGCAAGTTCACGGATAAAGGTGGTAAGATTTGGATACGAACAAAG
CTAGTACTTCCCGTCGTACCACCAGGAGGAAATTTGCTTCAAACACTACAACCCAATCCTGCGGAAGAAACCGTG
GACGAAAAACCACGGTACCCACTAACTGCATCACATCTCAGTCAGCACGATACTGAACAGGAAATGGAAGAGAAA
GGAAGCAAGAAATCGTGTTCAAAGTTTCGTAACAATTCCAGTATTCCGAAAGAGTCTGCTGCGGAGACCATCATA
GTGAGGATTGAAGTAGAGGATTCTGGGTCAGGAATCAAGCCATCCGACATGCATAAGCTCTTTAGTAAGTTGAAC
ATCGTATCACACATCTTCAACTCATCAATGCGATATTTCAGCCGCGTTCAACCAGACAGAACAAGGGCGATTGCA
AGGTGGGAAGGGGACTGGTTTGGGTTTAGCGCTTGTGCGACAAATTGTCAAATTGAGTGGAGGGAGGCTCGGGGT
GCAATCAAAAGTTGGACGGGGATCGACATTCTGGGTAGAACTTCCACTTGGAATCGGAAACGAAGCTGTGACAAC
ACAATTCCCGCCTCATCCTGACGTGTCGAGAGGATACAATCACTTTGAACACCTGCACGGACAGCCTGTTATCCA
AAAGGAAGCGGCAAAAAGTGAAAATGCAGCACCTAGAACACGGAAGAATGACACCACGGGGAAGTACGAGGAGAA
TGAATCAAAATCTCCAACGACAGAATCTGTAATGCTTGATTATACGAATGAAGGTCTGTGATGCTTCGGCTCTGA
AAGTTTGATACTCATGCGCTCTTGTTTCTACACAACTGTTTTTCCTTTGTTGCTCAGGTGATCGCTCCGGACCCG
AAATGAAAGAGCAAGCATTGGGTGAGCGCGTGTTCGTACATGGACCGAGCAATCTGTCGGCCCGTATGCAGTCCA
CCGTTTCAGCCTCAGCAGATGAAGGAGGTGACTTAGCTCGAGACGGAAGTACAGCACCCACACCGACCTTTTCAA
TTACGCCCACCGCAAGTGCCATGGCGACCCCGGACAGCGAGAAGGGATCAGATGGTAAGCTGACGACGAGTACGA
TCACTTCTGGTTCGCACTCGACATCCTATACGAGTATGAGTATGACCGTATCAACTCCAGCGATTGAGGAAGAAG
TCTTTCAGAGTGAAAAGAACGGCTCGTCATCTTCAAACATACCAGTGCCTAATGGGAAGAGGGTGATACAACGGC
CGACATTCGTTCAACTGCCTTCTCCAAGAACATTCTCAATTGAAGCACATATACCTCCAATATCACCGTCTGCTA
TCTATACGCCTGCAATTGGCTCTTCGTATTCCTCCACATCAACATCACCCTTGGCAATGTTTGATGCGAACTATG
CTCGGGGGAGTCCCTCTTCCTTAAATGCTGGAATGAGTTTTGAATCAGTGGGGATGCCGGTGTTGGTAGTTGACG
ACGATCCATTGACGCGGACGCTGATGAAGAAAATACTAACGAGATTGGGATGCCAAGTGTCTTGCGCTGAGAACG
GTGAGGTAGCACTGGAGATGATTTTGGGGAGACGAATATGTATTCCGCTATCGACGCCATCGAGTGACTATTCTA
TGAGGGAGATGAAGCCGATATTGGAGCAGGAAGTGTCACCACAACGGTCGACGTCTGCGTGTACGCCACCGGAAT
CGAATGATGAATACAAGTTTGCAGTAATATTCTTGGATAACCAAATGCCAAAGATGTCGGGGCTGAAGGTCGTGG
CGAAACTGAGGTCGATGGAGAGGAAAGATTTTGTTGTGGGCGTGACAGGTGCGCTTTTGACAACCGCCGTACTCA
TGGTGATTAACGAAATTTCGAAATTTACACAGGCAATGCATTATTAGCTGGTAAGTCATTTAGCAGAATCGATTA
ATGCGCCGTCGCAGTATTCTAAACTTGCGCTATAAAATAGATCAGCAGGAGTACCTTGAAGCCGGTGTGGATAAG
TAAGTGTTTTAGTTGTAAGTGGAGCTGACGCTCAACGCGATCTATAGGGTTCTGACAAAGCCTGTCCTCGAGAGA
AGTTTGCGAGACGCGTTGCAGTGTGCGGATGAGAAGAGGAAAATTTACATGCGAGAAACGAATAGCCCAGAAATT
TCCCGGGCCCCACCCTCGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail