Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|090630
Gene name
Locationscaffold_06:589241..593876
Strand+
Gene length (bp)4635
Transcript length (bp)3726
Coding sequence length (bp)3726
Protein length (aa) 1242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13832 zf-HC5HC2H_2 PHD-zinc-finger like domain 4.8E-31 186 298
PF10513 EPL1 Enhancer of polycomb-like 1.0E-23 14 112
PF13771 zf-HC5HC2H PHD-like zinc-binding domain 4.3E-21 208 298
PF00439 Bromodomain Bromodomain 2.5E-17 464 544
PF13831 PHD_2 PHD-finger 4.5E-15 146 179
PF00855 PWWP PWWP domain 1.4E-10 1118 1219
PF00628 PHD PHD-finger 1.8E-10 134 180

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 51 604 1.0E-108
sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 52 548 3.0E-105
sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 55 548 5.0E-95
sp|Q12311|NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTO1 PE=1 SV=1 71 452 6.0E-76
sp|Q20318|LIN49_CAEEL Protein lin-49 OS=Caenorhabditis elegans GN=lin-49 PE=1 SV=1 67 563 6.0E-71
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 51 604 1.0E-108
sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 52 548 3.0E-105
sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 55 548 5.0E-95
sp|Q12311|NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTO1 PE=1 SV=1 71 452 6.0E-76
sp|Q20318|LIN49_CAEEL Protein lin-49 OS=Caenorhabditis elegans GN=lin-49 PE=1 SV=1 67 563 6.0E-71
sp|O74759|NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nto1 PE=1 SV=1 16 483 6.0E-70
sp|Q6GQJ2|JADE1_XENLA Protein Jade-1 OS=Xenopus laevis GN=jade1 PE=2 SV=1 49 454 2.0E-52
sp|Q6IE82|JADE3_MOUSE Protein Jade-3 OS=Mus musculus GN=Jade3 PE=1 SV=1 49 447 2.0E-50
sp|Q92613|JADE3_HUMAN Protein Jade-3 OS=Homo sapiens GN=JADE3 PE=1 SV=1 49 447 3.0E-50
sp|Q803A0|JADE1_DANRE Protein Jade-1 OS=Danio rerio GN=jade1 PE=2 SV=1 49 459 3.0E-48
sp|Q6IE81|JADE1_HUMAN Protein Jade-1 OS=Homo sapiens GN=JADE1 PE=1 SV=1 49 454 5.0E-48
sp|Q6ZPI0|JADE1_MOUSE Protein Jade-1 OS=Mus musculus GN=Jade1 PE=1 SV=2 49 441 9.0E-48
sp|Q9NQC1|JADE2_HUMAN Protein Jade-2 OS=Homo sapiens GN=JADE2 PE=1 SV=2 72 442 3.0E-47
sp|Q7ZVP1|JADE3_DANRE Protein Jade-3 OS=Danio rerio GN=jade3 PE=2 SV=1 49 451 3.0E-47
sp|Q7YZH1|RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster GN=rno PE=1 SV=1 44 298 3.0E-46
sp|Q6ZQF7|JADE2_MOUSE Protein Jade-2 OS=Mus musculus GN=Jade2 PE=1 SV=2 72 442 5.0E-46
sp|Q0P4S5|JADE3_XENTR Protein Jade-3 OS=Xenopus tropicalis GN=jade3 PE=2 SV=1 130 453 2.0E-44
sp|Q5E9T7|JADE1_BOVIN Protein Jade-1 OS=Bos taurus GN=JADE1 PE=2 SV=1 49 388 4.0E-44
sp|Q29EQ3|RNO_DROPS PHD finger protein rhinoceros OS=Drosophila pseudoobscura pseudoobscura GN=rno PE=3 SV=2 44 457 4.0E-41
sp|Q9C5X4|ATX1_ARATH Histone-lysine N-methyltransferase ATX1 OS=Arabidopsis thaliana GN=ATX1 PE=1 SV=2 134 330 7.0E-35
sp|P0CB22|ATX2_ARATH Histone-lysine N-methyltransferase ATX2 OS=Arabidopsis thaliana GN=ATX2 PE=2 SV=1 112 298 1.0E-34
sp|O54826|AF10_MOUSE Protein AF-10 OS=Mus musculus GN=Mllt10 PE=1 SV=2 134 308 1.0E-34
sp|P55197|AF10_HUMAN Protein AF-10 OS=Homo sapiens GN=MLLT10 PE=1 SV=2 134 308 1.0E-34
sp|P34447|YM2A_CAEEL Uncharacterized protein F54F2.2, isoform a OS=Caenorhabditis elegans GN=F54F2.2/F54F2.3/F54F2.4 PE=3 SV=2 134 301 7.0E-33
sp|P55198|AF17_HUMAN Protein AF-17 OS=Homo sapiens GN=MLLT6 PE=1 SV=2 134 277 1.0E-31
sp|Q9D4H9|PHF14_MOUSE PHD finger protein 14 OS=Mus musculus GN=Phf14 PE=1 SV=1 134 298 9.0E-25
sp|O94880|PHF14_HUMAN PHD finger protein 14 OS=Homo sapiens GN=PHF14 PE=1 SV=2 134 298 1.0E-24
sp|Q91VY5|KDM4B_MOUSE Lysine-specific demethylase 4B OS=Mus musculus GN=Kdm4b PE=2 SV=1 120 333 2.0E-24
sp|O94953|KDM4B_HUMAN Lysine-specific demethylase 4B OS=Homo sapiens GN=KDM4B PE=1 SV=4 136 333 2.0E-24
sp|Q9M364|ATX3_ARATH Histone-lysine N-methyltransferase ATX3 OS=Arabidopsis thaliana GN=ATX3 PE=2 SV=2 134 332 6.0E-22
sp|Q8VCD7|KDM4C_MOUSE Lysine-specific demethylase 4C OS=Mus musculus GN=Kdm4c PE=1 SV=1 141 334 6.0E-21
sp|Q8GZ42|ATX5_ARATH Histone-lysine N-methyltransferase ATX5 OS=Arabidopsis thaliana GN=ATX5 PE=2 SV=1 134 298 7.0E-21
sp|Q9SUE7|ATX4_ARATH Histone-lysine N-methyltransferase ATX4 OS=Arabidopsis thaliana GN=ATX4 PE=2 SV=3 134 298 1.0E-20
sp|Q9H3R0|KDM4C_HUMAN Lysine-specific demethylase 4C OS=Homo sapiens GN=KDM4C PE=1 SV=2 141 339 1.0E-20
sp|Q8BW72|KDM4A_MOUSE Lysine-specific demethylase 4A OS=Mus musculus GN=Kdm4a PE=1 SV=3 141 333 4.0E-19
sp|O75164|KDM4A_HUMAN Lysine-specific demethylase 4A OS=Homo sapiens GN=KDM4A PE=1 SV=2 141 333 5.0E-19
sp|Q5RD88|KDM4A_PONAB Lysine-specific demethylase 4A OS=Pongo abelii GN=KDM4A PE=2 SV=1 141 333 5.0E-19
sp|P53127|SNT2_YEAST E3 ubiquitin-protein ligase SNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT2 PE=1 SV=1 117 272 7.0E-15
sp|Q10077|SNT2_SCHPO Lid2 complex component snt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snt2 PE=3 SV=1 119 290 2.0E-10
sp|Q9NPI1|BRD7_HUMAN Bromodomain-containing protein 7 OS=Homo sapiens GN=BRD7 PE=1 SV=1 460 591 2.0E-09
sp|Q5R8B0|BRD7_PONAB Bromodomain-containing protein 7 OS=Pongo abelii GN=BRD7 PE=2 SV=1 460 591 2.0E-09
sp|Q5ZKG2|BRD7_CHICK Bromodomain-containing protein 7 OS=Gallus gallus GN=BRD7 PE=2 SV=1 460 565 2.0E-09
sp|O88665|BRD7_MOUSE Bromodomain-containing protein 7 OS=Mus musculus GN=Brd7 PE=1 SV=1 460 565 2.0E-09
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 479 548 1.0E-08
sp|Q6JHU9|CBP_RAT CREB-binding protein OS=Rattus norvegicus GN=Crebbp PE=1 SV=1 454 547 1.0E-08
sp|Q92793|CBP_HUMAN CREB-binding protein OS=Homo sapiens GN=CREBBP PE=1 SV=3 454 547 1.0E-08
sp|P45481|CBP_MOUSE CREB-binding protein OS=Mus musculus GN=Crebbp PE=1 SV=3 454 547 2.0E-08
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 479 548 2.0E-08
sp|Q7ZUF2|BRD9_DANRE Bromodomain-containing protein 9 OS=Danio rerio GN=brd9 PE=2 SV=1 459 547 2.0E-08
sp|Q60544|TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus GN=TAF1 PE=2 SV=1 462 547 2.0E-08
sp|B2RWS6|EP300_MOUSE Histone acetyltransferase p300 OS=Mus musculus GN=Ep300 PE=1 SV=2 454 549 2.0E-08
sp|Q09472|EP300_HUMAN Histone acetyltransferase p300 OS=Homo sapiens GN=EP300 PE=1 SV=2 454 549 2.0E-08
sp|P34545|CBP1_CAEEL Protein cbp-1 OS=Caenorhabditis elegans GN=cbp-1 PE=1 SV=6 457 547 7.0E-08
sp|Q03330|GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN5 PE=1 SV=1 479 549 8.0E-08
sp|Q6GLP7|BRD9_XENLA Bromodomain-containing protein 9 OS=Xenopus laevis GN=brd9 PE=2 SV=1 463 579 1.0E-07
sp|P21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens GN=TAF1 PE=1 SV=2 462 547 1.0E-07
sp|Q80UV9|TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus GN=Taf1 PE=1 SV=2 462 547 1.0E-07
sp|Q6NVM8|BRD9_XENTR Bromodomain-containing protein 9 OS=Xenopus tropicalis GN=brd9 PE=2 SV=1 463 579 1.0E-07
sp|Q3UQU0|BRD9_MOUSE Bromodomain-containing protein 9 OS=Mus musculus GN=Brd9 PE=1 SV=1 463 547 1.0E-07
sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 1112 1222 2.0E-07
sp|Q6FTW5|GCN5_CANGA Histone acetyltransferase GCN5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GCN5 PE=3 SV=1 479 549 3.0E-07
sp|Q9H8M2|BRD9_HUMAN Bromodomain-containing protein 9 OS=Homo sapiens GN=BRD9 PE=1 SV=2 463 547 3.0E-07
sp|Q9UMN6|KMT2B_HUMAN Histone-lysine N-methyltransferase 2B OS=Homo sapiens GN=KMT2B PE=1 SV=1 183 272 4.0E-07
sp|Q09948|RSC4_SCHPO Chromatin structure-remodeling complex subunit rsc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc4 PE=1 SV=1 477 544 4.0E-07
sp|Q9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B OS=Homo sapiens GN=ATAD2B PE=1 SV=3 463 621 6.0E-07
sp|Q8UVR5|BAZ1A_XENLA Bromodomain adjacent to zinc finger domain protein 1A (Fragment) OS=Xenopus laevis GN=baz1a PE=2 SV=1 479 548 6.0E-07
sp|Q8IZX4|TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens GN=TAF1L PE=1 SV=1 462 547 6.0E-07
sp|O08550|KMT2B_MOUSE Histone-lysine N-methyltransferase 2B OS=Mus musculus GN=Kmt2b PE=1 SV=3 183 272 8.0E-07
sp|Q9UUK2|GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn5 PE=1 SV=1 479 549 1.0E-06
sp|Q93ZB7|GTE11_ARATH Transcription factor GTE11 OS=Arabidopsis thaliana GN=GTE11 PE=1 SV=1 478 561 1.0E-06
sp|Q6DFF2|BRD4B_XENLA Bromodomain-containing protein 4B OS=Xenopus laevis GN=brd4-b PE=2 SV=1 483 615 1.0E-06
sp|Q08D75|BRD4A_XENLA Bromodomain-containing protein 4A OS=Xenopus laevis GN=brd4-a PE=2 SV=1 483 616 2.0E-06
sp|Q9ESU6|BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus GN=Brd4 PE=1 SV=2 467 549 2.0E-06
sp|Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1 463 534 4.0E-06
sp|Q8CDM1|ATAD2_MOUSE ATPase family AAA domain-containing protein 2 OS=Mus musculus GN=Atad2 PE=1 SV=1 463 534 5.0E-06
sp|Q9DE13|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus GN=BAZ2B PE=2 SV=1 479 549 5.0E-06
sp|Q5RDX4|ATAD2_PONAB ATPase family AAA domain-containing protein 2 OS=Pongo abelii GN=ATAD2 PE=2 SV=1 463 534 6.0E-06
sp|Q09948|RSC4_SCHPO Chromatin structure-remodeling complex subunit rsc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc4 PE=1 SV=1 477 546 7.0E-06
sp|O74964|RSC1_SCHPO Chromatin structure-remodeling complex subunit rsc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc1 PE=1 SV=1 487 551 7.0E-06
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 479 547 7.0E-06
sp|Q6CXW4|GCN5_KLULA Histone acetyltransferase GCN5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GCN5 PE=3 SV=1 479 549 8.0E-06
sp|Q7JJ13|BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus musculus GN=Brd2 PE=1 SV=1 436 549 1.0E-05
sp|Q6MGA9|BRD2_RAT Bromodomain-containing protein 2 OS=Rattus norvegicus GN=Brd2 PE=1 SV=1 436 549 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|090630
MGRAGRSSPSIVALPKALFNKIEEDDSTQPGGVHDLQARSYGYNDFSDFVRPEHYIRHIEPLESDLARQVEYDMD
EQDQEWLDAINAERRKEQLDRVSYELFEIIMDRLEKEWFDLTKNIPKLDLALPSEDSTCAICDDSEGENSNAIVF
CDGCNLAVHQDCYGVPYIPEGQWLCRKCTVSPENPVQCILCPNEGGAFKQTTNGDWVHLLCAIWVPETRVVNEVF
MEPVSGAEKISKQRWRLRCSICDIREGACIQCAKTSCFLAFHATCARKEKLLSSMKSTQGSEPPVLSCYCERHLP
KEQQEARAVALAAEGSEVDDEVNVTSNKSARAYAKTYHTGPPLVPALIVNRIVSYITKVTLRKKVDFVNTLCRYW
SLKREARRGAPLLKRLHLEPWTAAAGVKVRSKDEKRMKLDQLMRLRDDLLALRSLTELCRKRESRKYRQSEVIYD
VVSKAFFSHEDAMRHVLDRIVLLDKQDFFKNPVSKLIVPDYYDIVSKPMCWNMIEAKLDRHEYWDVQAFKDDVDL
VVANALLYNKSDSAIYRAASRLKKNIPPIYAVLDKERVVSQELSNGIYTPVPEVKPELGIDTQLNGHTTENDEAV
NSTQPLQDRATVGDLEPPMDVLELLTVTDIIKPDLTMDLQEEPLQSLFRYELAVLKPPPTPVPPPPPRAKKPKRD
RKAEYERAKAKKAAAAAAAMATAAEALTLLNGGHNRHHHHPHNVPFTEQDVARPHMGAQGHLPPSPLSPPAHVPP
SFTRPIQQDSFEFRMPMPNELSIDTNMAVYDGGAATEPAGQLSPSSPRSERPPRRKRPSMTLPGRSEVPPVVSDV
DNRDSFKMFDAGWILPPDHKRGGRLPPVDRSTQPPPRKRAKTELAPSSRLSVISMSASENQIMHTSPLSEPNIAG
PPLSPTSTRSNVAFHEQLLAALPTPEIKAPPETPVLPEPSPSNLVEKPITASPSPPASAPVPSSSRQLPPLDLSI
LGNRKIVEGANGTIIIEELDTPAIRRAKNMKRKEERRQEMLRRDSLMSAMTEGSPAAVPMSIGSSVIAAESPNKP
SKGTGADSELSSLSEFESEFADEPGQLKEPKKGKRRSSITMPKAPFSKKSYKEDSVGVPITDKMLEGGTLVWAKA
DSYPWWPAVIFEQDDPDVPLNILQGCREAREKRQIKLHILRFFDKNQSWQYLPVERLALLGENPDLDAEMQAPSS
KRQRWKSHNIRRDCCEAYKLALSEMETGSDAEAPGRRVEKV*
Coding >Agabi119p4|090630
ATGGGCCGCGCCGGGAGATCTTCTCCGTCCATTGTCGCCCTTCCTAAAGCCCTTTTCAACAAGATCGAGGAAGAC
GACTCAACTCAACCTGGTGGTGTCCATGATCTGCAAGCACGCTCGTATGGCTACAATGATTTCTCGGACTTCGTG
AGACCTGAACATTACATTCGGCATATAGAGCCTCTCGAGAGCGATCTAGCACGACAGGTCGAATATGATATGGAT
GAGCAGGATCAAGAATGGCTGGATGCAATCAATGCAGAACGCCGGAAGGAACAGCTGGACAGGGTTTCATATGAA
TTATTCGAGATTATCATGGATCGATTGGAGAAAGAATGGTTTGATCTGACCAAGAATATCCCCAAGTTAGATCTC
GCGCTGCCGTCTGAAGATTCCACCTGTGCTATCTGTGATGATTCTGAGGGAGAGAACAGTAATGCGATAGTATTT
TGTGATGGTTGCAACTTAGCAGTTCACCAGGATTGCTATGGCGTACCGTATATACCAGAGGGTCAATGGTTATGC
CGAAAATGTACTGTGTCACCCGAGAACCCTGTGCAATGTATTTTATGTCCCAATGAGGGTGGCGCATTCAAACAA
ACAACAAATGGTGATTGGGTGCATCTACTTTGTGCCATCTGGGTTCCAGAGACGCGTGTTGTAAACGAGGTTTTC
ATGGAACCTGTATCCGGTGCGGAGAAAATATCTAAGCAGCGGTGGAGACTGAGGTGTAGCATATGTGATATCCGA
GAAGGTGCTTGCATACAATGCGCCAAAACTTCTTGCTTCCTTGCTTTTCATGCAACCTGTGCTCGTAAAGAGAAA
CTCTTATCATCAATGAAGAGTACTCAGGGTTCAGAACCTCCCGTACTTAGTTGCTACTGTGAACGTCACCTTCCA
AAAGAACAACAAGAAGCTCGGGCGGTGGCGCTTGCAGCAGAAGGGTCTGAAGTTGACGATGAAGTTAATGTCACC
TCGAATAAATCCGCTCGTGCGTATGCCAAGACATACCACACAGGACCTCCTCTTGTTCCTGCGCTCATAGTCAAC
CGAATTGTATCATATATCACGAAAGTCACTCTGCGCAAGAAAGTCGATTTTGTAAACACACTCTGTAGATATTGG
AGCTTGAAGCGTGAAGCACGACGTGGTGCACCTTTACTTAAACGGCTACATCTGGAACCATGGACGGCGGCGGCG
GGTGTAAAGGTCCGATCCAAGGATGAAAAAAGAATGAAGTTAGACCAACTGATGCGATTGCGGGACGACCTTCTT
GCATTACGTTCATTAACCGAACTATGTCGGAAGCGAGAATCCAGAAAGTACAGGCAGTCAGAGGTCATTTACGAT
GTCGTCTCCAAAGCATTCTTTTCGCATGAAGATGCTATGAGGCACGTCCTAGATCGTATCGTACTACTGGATAAA
CAAGACTTTTTCAAGAACCCAGTCTCGAAGCTTATTGTTCCGGATTATTACGATATTGTTTCAAAGCCGATGTGC
TGGAACATGATTGAAGCAAAACTAGATAGGCACGAGTATTGGGATGTTCAGGCCTTCAAAGATGACGTCGATCTT
GTGGTTGCTAACGCATTGTTGTACAACAAATCAGATTCAGCCATCTATAGGGCTGCCTCTCGGCTGAAGAAAAAT
ATCCCACCCATTTATGCGGTACTCGATAAAGAACGTGTTGTTTCCCAAGAGCTTTCCAATGGTATTTACACTCCA
GTCCCGGAAGTAAAACCAGAACTTGGAATCGATACTCAATTGAACGGTCATACGACCGAAAACGATGAGGCTGTG
AACTCTACTCAGCCATTGCAGGATCGCGCTACCGTTGGCGACTTGGAGCCGCCGATGGACGTGCTTGAACTCCTT
ACAGTCACAGATATCATCAAACCGGACCTCACCATGGACCTTCAAGAGGAACCTCTTCAATCTCTCTTCCGCTAC
GAGCTTGCTGTCCTTAAACCTCCGCCCACTCCCGTACCACCCCCACCGCCTAGGGCAAAGAAACCCAAACGAGAC
CGTAAGGCCGAGTATGAGCGAGCCAAGGCAAAGAAAGCCGCCGCCGCTGCCGCTGCCATGGCCACTGCTGCTGAA
GCTCTGACCTTATTGAATGGTGGACACAACCGCCACCATCACCACCCCCATAACGTACCTTTCACGGAACAAGAC
GTCGCACGACCACACATGGGTGCCCAAGGGCATCTACCACCGTCACCACTGTCACCACCAGCGCATGTACCTCCT
TCGTTTACCCGACCAATTCAGCAGGATTCTTTTGAATTCAGGATGCCAATGCCAAACGAACTTTCGATTGATACA
AACATGGCTGTTTATGACGGGGGTGCAGCAACAGAACCAGCTGGGCAGCTGAGCCCCTCGTCCCCGAGATCAGAG
CGACCACCTCGTCGAAAACGCCCCTCTATGACTTTACCGGGGCGATCAGAAGTTCCCCCCGTAGTTTCTGATGTG
GATAACAGAGATTCATTCAAGATGTTTGATGCTGGATGGATCTTACCTCCTGACCATAAGCGCGGAGGGCGTCTA
CCACCTGTGGATCGGTCTACACAACCACCACCAAGAAAACGAGCGAAAACAGAACTGGCACCGTCGTCAAGACTT
TCAGTTATCAGCATGTCGGCATCGGAAAATCAAATCATGCATACTTCACCTTTGTCAGAGCCGAATATCGCAGGA
CCTCCGCTTTCTCCCACCTCAACTAGATCGAATGTAGCATTTCATGAACAACTTCTAGCTGCACTTCCGACTCCG
GAAATCAAAGCCCCCCCAGAAACGCCAGTCCTTCCAGAACCTAGTCCAAGCAATCTGGTGGAGAAACCTATCACC
GCATCGCCCTCTCCCCCTGCGTCTGCACCTGTACCTTCTTCGTCCAGGCAACTACCACCGCTCGACTTGTCTATA
CTTGGAAATCGTAAAATTGTGGAAGGCGCTAACGGTACGATCATCATAGAGGAGTTGGACACACCCGCTATACGT
CGGGCCAAAAATATGAAACGAAAAGAGGAGAGACGACAAGAAATGCTACGCAGGGATTCTTTAATGTCCGCTATG
ACTGAGGGAAGTCCTGCAGCCGTACCCATGTCCATAGGGTCGTCAGTAATCGCGGCAGAATCGCCAAATAAACCC
TCCAAAGGCACGGGTGCGGATTCGGAACTGAGTTCGTTGAGCGAATTTGAGAGTGAGTTCGCGGACGAACCTGGT
CAGCTCAAAGAACCCAAGAAAGGAAAGAGAAGGAGTTCGATTACGATGCCCAAAGCACCTTTTTCGAAGAAAAGT
TACAAGGAGGATTCAGTGGGTGTGCCAATTACAGATAAGATGCTTGAGGGTGGGACACTTGTGTGGGCAAAAGCG
GATTCTTACCCATGGTGGCCAGCAGTCATTTTTGAACAGGATGATCCCGACGTACCACTGAATATCCTGCAGGGC
TGTCGAGAAGCCCGAGAAAAACGCCAGATCAAGCTTCATATTCTTCGGTTCTTCGATAAGAACCAGTCCTGGCAA
TATCTACCCGTCGAGCGTCTTGCATTGTTGGGAGAAAATCCTGATTTGGATGCGGAAATGCAGGCGCCGTCCTCA
AAGCGGCAGCGGTGGAAGAGTCACAATATACGGAGAGATTGTTGTGAAGCTTACAAGCTCGCATTGTCAGAGATG
GAGACGGGGAGCGATGCGGAGGCGCCAGGCAGACGTGTAGAAAAAGTTTAG
Transcript >Agabi119p4|090630
ATGGGCCGCGCCGGGAGATCTTCTCCGTCCATTGTCGCCCTTCCTAAAGCCCTTTTCAACAAGATCGAGGAAGAC
GACTCAACTCAACCTGGTGGTGTCCATGATCTGCAAGCACGCTCGTATGGCTACAATGATTTCTCGGACTTCGTG
AGACCTGAACATTACATTCGGCATATAGAGCCTCTCGAGAGCGATCTAGCACGACAGGTCGAATATGATATGGAT
GAGCAGGATCAAGAATGGCTGGATGCAATCAATGCAGAACGCCGGAAGGAACAGCTGGACAGGGTTTCATATGAA
TTATTCGAGATTATCATGGATCGATTGGAGAAAGAATGGTTTGATCTGACCAAGAATATCCCCAAGTTAGATCTC
GCGCTGCCGTCTGAAGATTCCACCTGTGCTATCTGTGATGATTCTGAGGGAGAGAACAGTAATGCGATAGTATTT
TGTGATGGTTGCAACTTAGCAGTTCACCAGGATTGCTATGGCGTACCGTATATACCAGAGGGTCAATGGTTATGC
CGAAAATGTACTGTGTCACCCGAGAACCCTGTGCAATGTATTTTATGTCCCAATGAGGGTGGCGCATTCAAACAA
ACAACAAATGGTGATTGGGTGCATCTACTTTGTGCCATCTGGGTTCCAGAGACGCGTGTTGTAAACGAGGTTTTC
ATGGAACCTGTATCCGGTGCGGAGAAAATATCTAAGCAGCGGTGGAGACTGAGGTGTAGCATATGTGATATCCGA
GAAGGTGCTTGCATACAATGCGCCAAAACTTCTTGCTTCCTTGCTTTTCATGCAACCTGTGCTCGTAAAGAGAAA
CTCTTATCATCAATGAAGAGTACTCAGGGTTCAGAACCTCCCGTACTTAGTTGCTACTGTGAACGTCACCTTCCA
AAAGAACAACAAGAAGCTCGGGCGGTGGCGCTTGCAGCAGAAGGGTCTGAAGTTGACGATGAAGTTAATGTCACC
TCGAATAAATCCGCTCGTGCGTATGCCAAGACATACCACACAGGACCTCCTCTTGTTCCTGCGCTCATAGTCAAC
CGAATTGTATCATATATCACGAAAGTCACTCTGCGCAAGAAAGTCGATTTTGTAAACACACTCTGTAGATATTGG
AGCTTGAAGCGTGAAGCACGACGTGGTGCACCTTTACTTAAACGGCTACATCTGGAACCATGGACGGCGGCGGCG
GGTGTAAAGGTCCGATCCAAGGATGAAAAAAGAATGAAGTTAGACCAACTGATGCGATTGCGGGACGACCTTCTT
GCATTACGTTCATTAACCGAACTATGTCGGAAGCGAGAATCCAGAAAGTACAGGCAGTCAGAGGTCATTTACGAT
GTCGTCTCCAAAGCATTCTTTTCGCATGAAGATGCTATGAGGCACGTCCTAGATCGTATCGTACTACTGGATAAA
CAAGACTTTTTCAAGAACCCAGTCTCGAAGCTTATTGTTCCGGATTATTACGATATTGTTTCAAAGCCGATGTGC
TGGAACATGATTGAAGCAAAACTAGATAGGCACGAGTATTGGGATGTTCAGGCCTTCAAAGATGACGTCGATCTT
GTGGTTGCTAACGCATTGTTGTACAACAAATCAGATTCAGCCATCTATAGGGCTGCCTCTCGGCTGAAGAAAAAT
ATCCCACCCATTTATGCGGTACTCGATAAAGAACGTGTTGTTTCCCAAGAGCTTTCCAATGGTATTTACACTCCA
GTCCCGGAAGTAAAACCAGAACTTGGAATCGATACTCAATTGAACGGTCATACGACCGAAAACGATGAGGCTGTG
AACTCTACTCAGCCATTGCAGGATCGCGCTACCGTTGGCGACTTGGAGCCGCCGATGGACGTGCTTGAACTCCTT
ACAGTCACAGATATCATCAAACCGGACCTCACCATGGACCTTCAAGAGGAACCTCTTCAATCTCTCTTCCGCTAC
GAGCTTGCTGTCCTTAAACCTCCGCCCACTCCCGTACCACCCCCACCGCCTAGGGCAAAGAAACCCAAACGAGAC
CGTAAGGCCGAGTATGAGCGAGCCAAGGCAAAGAAAGCCGCCGCCGCTGCCGCTGCCATGGCCACTGCTGCTGAA
GCTCTGACCTTATTGAATGGTGGACACAACCGCCACCATCACCACCCCCATAACGTACCTTTCACGGAACAAGAC
GTCGCACGACCACACATGGGTGCCCAAGGGCATCTACCACCGTCACCACTGTCACCACCAGCGCATGTACCTCCT
TCGTTTACCCGACCAATTCAGCAGGATTCTTTTGAATTCAGGATGCCAATGCCAAACGAACTTTCGATTGATACA
AACATGGCTGTTTATGACGGGGGTGCAGCAACAGAACCAGCTGGGCAGCTGAGCCCCTCGTCCCCGAGATCAGAG
CGACCACCTCGTCGAAAACGCCCCTCTATGACTTTACCGGGGCGATCAGAAGTTCCCCCCGTAGTTTCTGATGTG
GATAACAGAGATTCATTCAAGATGTTTGATGCTGGATGGATCTTACCTCCTGACCATAAGCGCGGAGGGCGTCTA
CCACCTGTGGATCGGTCTACACAACCACCACCAAGAAAACGAGCGAAAACAGAACTGGCACCGTCGTCAAGACTT
TCAGTTATCAGCATGTCGGCATCGGAAAATCAAATCATGCATACTTCACCTTTGTCAGAGCCGAATATCGCAGGA
CCTCCGCTTTCTCCCACCTCAACTAGATCGAATGTAGCATTTCATGAACAACTTCTAGCTGCACTTCCGACTCCG
GAAATCAAAGCCCCCCCAGAAACGCCAGTCCTTCCAGAACCTAGTCCAAGCAATCTGGTGGAGAAACCTATCACC
GCATCGCCCTCTCCCCCTGCGTCTGCACCTGTACCTTCTTCGTCCAGGCAACTACCACCGCTCGACTTGTCTATA
CTTGGAAATCGTAAAATTGTGGAAGGCGCTAACGGTACGATCATCATAGAGGAGTTGGACACACCCGCTATACGT
CGGGCCAAAAATATGAAACGAAAAGAGGAGAGACGACAAGAAATGCTACGCAGGGATTCTTTAATGTCCGCTATG
ACTGAGGGAAGTCCTGCAGCCGTACCCATGTCCATAGGGTCGTCAGTAATCGCGGCAGAATCGCCAAATAAACCC
TCCAAAGGCACGGGTGCGGATTCGGAACTGAGTTCGTTGAGCGAATTTGAGAGTGAGTTCGCGGACGAACCTGGT
CAGCTCAAAGAACCCAAGAAAGGAAAGAGAAGGAGTTCGATTACGATGCCCAAAGCACCTTTTTCGAAGAAAAGT
TACAAGGAGGATTCAGTGGGTGTGCCAATTACAGATAAGATGCTTGAGGGTGGGACACTTGTGTGGGCAAAAGCG
GATTCTTACCCATGGTGGCCAGCAGTCATTTTTGAACAGGATGATCCCGACGTACCACTGAATATCCTGCAGGGC
TGTCGAGAAGCCCGAGAAAAACGCCAGATCAAGCTTCATATTCTTCGGTTCTTCGATAAGAACCAGTCCTGGCAA
TATCTACCCGTCGAGCGTCTTGCATTGTTGGGAGAAAATCCTGATTTGGATGCGGAAATGCAGGCGCCGTCCTCA
AAGCGGCAGCGGTGGAAGAGTCACAATATACGGAGAGATTGTTGTGAAGCTTACAAGCTCGCATTGTCAGAGATG
GAGACGGGGAGCGATGCGGAGGCGCCAGGCAGACGTGTAGAAAAAGTTTAG
Gene >Agabi119p4|090630
ATGGGCCGCGCCGGGAGATCTTCTCCGTCCATTGTCGCCCTTCCTAAAGCCCTTTTCAACAAGATCGAGGAAGAC
GACTCAACTCAACCTGGTGGTGTCCATGATCTGCAAGCACGCTCGTATGGCTGTCAGTACAGAAGTTTAATTATC
TGTAGTGATGCTGATGGCGGTGTAGACAATGATTTCTCGGACTTCGTGAGACCTGAACATTACATTCGGCATATA
GGTGAGTTTTTGTTTTGGGTGCCTTACCTATCCCGTAATCTTACCAAAGTGACTGCAGAGCCTCTCGAGAGCGAT
CTAGCACGACAGGTCGAATATGATATGGATGAGCAGGGTTAGTTGCCACGAAGCGTTTATGGACCAATCGCCTGA
CATCGTAGTGGCGTAGATCAAGAATGGCTGGATGCAATCAATGCAGAACGCCGGAAGGAACAGCTGGACAGGGTT
TCATATGAATTATTCGAGATTATCATGGATCGATTGGAGAAAGAATGGTTTGATCTGGTGAGCCCTACTTACCTT
TGGTGTTCATGTCGTAACTGAGATCTTGCCTTGTAGACCAAGAATATCCCCAAGTTAGATCTCGCGCTGCCGTCT
GAAGATTCCACCTGTGCTATCTGTGATGATTCTGAGGGAGAGAACAGTAATGCGATAGTATTTTGTGATGGTTGC
AACTTAGCAGTTCACCAGGGTAAGCCATGAATCAGAATTGCCCCTTGTACACGACCAATGATCTAGCTGTCGCAT
CGCAGATTGCTATGGCGTACCGTATATACCAGAGGGTCAATGGTTATGCCGAAAATGTACTGTGTCACCCGAGAA
CCCTGTGGTACGTTGGACCTTCTACGCACACGAACAAATTTAATTCGAACCCAGCAATGTATTTTATGTCCCAAT
GAGGGTGGCGCATTCAAACAAACAACAAATGGTGATTGGGTGCATCTACTTTGTGCCATCTGGGTTCCAGAGACG
CGTGTTGTAAACGAGGTTTTCATGGAACCTGTATCCGGTGCGGAGAAAATATCTAAGCAGCGGTGGAGACTGGTG
AGCGTTAAACCTATCGAACTGTTCTGTCATTAACCTCATCGGATTCAGAGGTGTAGCATATGTGATATCCGAGAA
GGTGCTTGCATACAATGCGCCAAAACTTCTTGCTTCCTTGCTTTTCATGCAACCTGTGCTCGTAAAGAGAAACTC
TTATCATCAATGAAGAGTACTCAGGGTTCAGAACCTCCCGTACTTAGTTGCTACTGTGAACGTCACCTTCCAGTA
CGTGAGGTCAATGGTTCTGGTTCGGTCTCTTAACTTCTCTCCAGAAAGAACAACAAGAAGCTCGGGCGGTGGCGC
TTGCAGCAGAAGGGTCTGAAGTTGACGATGAAGTTAATGTCACCTCGAATAAATCCGCTCGTGCGTATGCCAAGA
CATACCACACAGGACCTCCTCTTGTTCCTGCGCTCATAGTCAACCGAATTGTATCATATATCACGAAAGTCACTC
TGCGCAAGAAAGTCGATTTTGTAAACACACTCTGTAGATATTGGAGCTTGAAGCGTGAAGCACGACGTGGTGCAC
CTTTACTTAAACGGCTACATCTGGAACCATGGACGGCGGCGGCGGGTGTAAAGGTCCGATCCAAGGATGAAAAAA
GAATGAAGTTAGACGTACGTCTTCCGATCACGCAGATTTACGGCCATTTTTGACTCCAGATTAGCAACTGATGCG
ATTGCGGGACGACCTTCTTGCATTACGTTCATTAACCGAACTATGTCGGAAGCGAGAATCCAGAAAGTACAGGCA
GTCAGAGGTCATTTACGATGTCGTCTCCAAAGCATTCTTTTCGCATGAAGATGCTATGAGGCACGTCCTAGATCG
TATCGTACTGTGAGTGCACTTGACATTGCCATAGTACGTCTGCGTATCTCAATCTGTTTGCCTTAGACTGGATAA
ACAAGACTTTTTCAAGAACCCAGTCTCGAAGCTTATTGTTCCGGATTATTACGATATTGTTTCAAAGCCGATGTG
CTGGAACATGATTGAAGCAAAACTAGATAGGCACGAGTATTGGGATGTTCAGGCCTTCAAAGTGCGTCTTGTTGG
CTTCATATGCACACTGTACTGACCGGAATTAGGATGACGTCGATCTTGTGGTTGCTAACGCATTGTTGTACAACA
AATCAGATTCAGCCATCTATAGGGCTGCCTCTCGGCTGAAGAAAAATATCCCACCCATTTATGCGGTACTCGATA
AAGAACGTGTTGTTTCCCAAGAGCTTTCCAATGGTATTTACACTCCAGTCCCGGAAGTAAAACCAGAACTTGGAA
TCGATACTCAATTGAACGGTCATACGACCGAAAACGATGAGGCTGTGAACTCTACTCAGCCATTGCAGGATCGCG
CTACCGTTGGCGACTTGGAGCCGCCGATGGACGTGCTTGAACTCCTTACAGTCACAGATATCATCAAACCGGACC
TCACCATGGACCTTCAAGAGGAACCTCTTCAATCTCTCTTCCGCTACGAGCTTGCTGTCCTTAAACCTCCGCCCA
CTCCCGTACCACCCCCACCGCCTAGGGCAAAGAAACCCAAACGAGACCGTAAGGCCGAGTATGAGCGAGCCAAGG
CAAAGAAAGCCGCCGCCGCTGCCGCTGCCATGGCCACTGCTGCTGAAGCTCTGACCTTATTGAATGGTGGACACA
ACCGCCACCATCACCACCCCCATAACGTACCTTTCACGGAACAAGACGTCGCACGACCACACATGGGTGCCCAAG
GGCATCTACCACCGTCACCACTGTCACCACCAGCGCATGTACCTCCTTCGTTTACCCGACCAATTCAGCAGGATT
CTTTTGAATTCAGGATGCCAATGCCAAACGAACTTTCGATTGATACAAACATGGCTGTTTATGACGGGGGTGCAG
CAACAGAACCAGCTGGGCAGCTGAGCCCCTCGTCCCCGAGATCAGAGCGACCACCTCGTCGAAAACGCCCCTCTA
TGACTTTACCGGGGCGATCAGAAGTTCCCCCCGTAGTTTCTGATGTGGATAACAGAGATTCATTCAAGATGTTTG
ATGCTGGATGGATCTTACCTCCTGACCATAAGCGCGGAGGGCGTCTACCACCTGTGGATCGGTCTACACAACCAC
CACCAAGAAAACGAGCGAAAACAGGTGTGCACGTATCTCATCAAAGATGGTTGTAGATCTGATTCCTTTTTTCTT
ATAGAACTGGCACCGTCGTCAAGACTTTCAGTTATCAGCATGTCGGCATCGGAAAATCAAATCATGCATACTTCA
CCTTTGTCAGAGCCGAATATCGCAGGACCTCCGCTTTCTCCCACCTCAACTAGATCGAATGTAGCATTTCATGAA
CAACTTCTAGCTGCACTTCCGACTCCGGAAATCAAAGCCCCCCCAGAAACGCCAGTCCTTCCAGAACCTAGTCCA
AGCAATCTGGTGGAGAAACCTATCACCGCATCGCCCTCTCCCCCTGCGTCTGCACCTGTACCTTCTTCGTCCAGG
CAACTACCACCGCTCGACTTGTCTATACTTGGAAATCGTAAAATTGTGGAAGGCGCTAACGGTACGATCATCATA
GAGGAGTTGGACACACCCGCTATACGTCGGGCCAAAAATATGAAACGAAAAGAGGAGAGACGACAAGAAATGCTA
CGCAGGGATTCTTTAATGTCCGCTATGACTGAGGGAAGTCCTGCAGCCGTACCCATGTCCATAGGGTCGTCAGTA
ATCGCGGCAGAATCGCCAAATAAACCCTCCAAAGGCACGGGTGCGGATTCGGAACTGAGTTCGTTGAGCGAATTT
GAGAGTGAGTTCGCGGACGAACCTGGTCAGCTCAAAGAACCCAAGAAAGGAAAGAGAAGGAGTTCGATTACGATG
CCCAAAGCACCTTTTTCGAAGAAAAGTTACAAGGAGGATTCAGTGGGTGTGCCAATTACAGATAAGATGCTTGAG
GGTGGGACACTTGGTACGTCTTTGTCGCTTCATCTGTTCATGTCCTTGGTAGCTAATCTTTTCAATCGTGTAGTG
TGGGCAAAAGCGGGTTAGTTTCATGTTCATCCTAGTTATATCACCAAGTTGAAGCTAGTGTTTTTATCGAAGATT
CTTACCCATGGTGGCCAGCAGTCATTTTTGAACAGGATGATCCCGACGTACCACTGAATATCCTGCAGGGCTGTC
GAGAAGCCCGAGAAAAACGCCAGATCAAGCTTCATATTCTTCGGTTCTTCGATAAGAACCAGTCCTGGTGCGCTA
CGCCCTTTTCGTAATATATTTGTTCCTGCCTAACCATTGCCATCTGCCAAGGCAATATCTACCCGTCGAGCGTCT
TGCATTGTTGGGAGAAAATCCTGGTAAGTCTGTCACCTGGATCTTAATAGTCAACATGTTTTGATTGTACGAACA
GATTTGGATGCGGAAATGCAGGCGCCGTCCTCAAAGCGGCAGCGGTGGAAGAGTCACAATATACGGAGAGATTGT
TGTGAAGCTTACAAGTGAGTTTCCGTTGGCTATTCTTCCTCGACGAGTTAATGATTTGGGAATAGGCTCGCATTG
TCAGAGATGGAGACGGGGAGCGATGCGGAGGCGCCAGGCAGACGTGTAGAAAAAGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail