Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|090620
Gene name
Locationscaffold_06:586395..587440
Strand-
Gene length (bp)1045
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 8.0E-11 28 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 7 181 1.0E-17
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 1 185 4.0E-17
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 18 234 4.0E-11
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 1 111 5.0E-09
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 26 111 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 7 181 1.0E-17
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 1 185 4.0E-17
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 18 234 4.0E-11
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 1 111 5.0E-09
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 26 111 5.0E-08
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 28 133 3.0E-07
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 24 149 3.0E-07
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 23 146 3.0E-07
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 28 133 4.0E-07
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 28 133 6.0E-07
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 26 232 1.0E-06
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 3 176 5.0E-06
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 4 154 7.0E-06
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 28 254 7.0E-06
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 4 145 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|090620
MKLLSQLFVLALASSLAFGSLFSASSHVQMLDSKSFKKAMKTNQTSLVVYVTTSSGHCRHMAAEMDQASEKLHPL
IPTYAVDCDNEKNKALCAEEWVQKLPTVTLFPRGNTLTPTICPERKAAGVVKWTSSHIPDYVTQLSNIDDIESWK
EKTKEETTLLLLTKEKKVPLLWRVLANKYSGRLELAAHWDEHGQAANDLGLDSNTKVLIYPAGDSRPVKYEGTTK
YEPLTKFFDSILDGTADIGTASEGQKLSDRPDDEL*
Coding >Agabi119p4|090620
ATGAAATTATTATCGCAATTATTCGTGCTGGCTCTGGCCTCTTCTTTAGCGTTCGGTTCCCTGTTTTCCGCTAGC
TCCCATGTGCAGATGCTGGATTCAAAGTCATTTAAGAAGGCGATGAAAACTAATCAAACTAGCTTGGTAGTCTAT
GTGACCACCTCTAGCGGACATTGTCGACATATGGCTGCGGAAATGGATCAAGCTTCTGAAAAATTACACCCTCTC
ATTCCTACCTATGCTGTTGATTGCGACAACGAAAAAAATAAAGCTTTATGTGCAGAAGAATGGGTGCAGAAACTC
CCTACTGTGACGCTGTTCCCTCGCGGAAATACACTTACGCCCACGATTTGTCCGGAACGCAAGGCGGCTGGAGTT
GTTAAATGGACATCGTCACATATTCCCGATTATGTGACCCAGCTTTCAAACATTGACGACATCGAGTCATGGAAA
GAAAAGACGAAGGAGGAAACCACACTTCTTCTTCTGACAAAAGAGAAGAAAGTCCCGCTACTTTGGAGAGTTCTT
GCCAACAAATATTCCGGAAGGCTCGAGTTAGCCGCCCACTGGGATGAGCACGGACAAGCGGCCAACGATCTCGGA
CTTGACAGCAATACCAAAGTTCTCATATACCCCGCCGGTGATTCAAGACCTGTCAAATATGAGGGCACCACCAAA
TACGAGCCTTTGACAAAGTTCTTTGATTCGATCCTCGACGGTACAGCAGACATCGGGACAGCAAGCGAGGGGCAG
AAGTTATCCGACCGTCCGGACGATGAACTATAA
Transcript >Agabi119p4|090620
ATGAAATTATTATCGCAATTATTCGTGCTGGCTCTGGCCTCTTCTTTAGCGTTCGGTTCCCTGTTTTCCGCTAGC
TCCCATGTGCAGATGCTGGATTCAAAGTCATTTAAGAAGGCGATGAAAACTAATCAAACTAGCTTGGTAGTCTAT
GTGACCACCTCTAGCGGACATTGTCGACATATGGCTGCGGAAATGGATCAAGCTTCTGAAAAATTACACCCTCTC
ATTCCTACCTATGCTGTTGATTGCGACAACGAAAAAAATAAAGCTTTATGTGCAGAAGAATGGGTGCAGAAACTC
CCTACTGTGACGCTGTTCCCTCGCGGAAATACACTTACGCCCACGATTTGTCCGGAACGCAAGGCGGCTGGAGTT
GTTAAATGGACATCGTCACATATTCCCGATTATGTGACCCAGCTTTCAAACATTGACGACATCGAGTCATGGAAA
GAAAAGACGAAGGAGGAAACCACACTTCTTCTTCTGACAAAAGAGAAGAAAGTCCCGCTACTTTGGAGAGTTCTT
GCCAACAAATATTCCGGAAGGCTCGAGTTAGCCGCCCACTGGGATGAGCACGGACAAGCGGCCAACGATCTCGGA
CTTGACAGCAATACCAAAGTTCTCATATACCCCGCCGGTGATTCAAGACCTGTCAAATATGAGGGCACCACCAAA
TACGAGCCTTTGACAAAGTTCTTTGATTCGATCCTCGACGGTACAGCAGACATCGGGACAGCAAGCGAGGGGCAG
AAGTTATCCGACCGTCCGGACGATGAACTATAA
Gene >Agabi119p4|090620
ATGAAATTATTATCGCAATTATTCGTGCTGGCTCTGGCCTCTTCTTTAGCGTTCGGTTCCCTGTTTTCCGCTAGC
TCCCATGTGCAGATGCTGGATTCAAAGTCATTTAAGAAGGCGATGAAAACTAATGTGAATGCTTTAATTATCTAC
GTGACCATTCCAATGCTGACATCTTATCATAGCAAACTAGCTTGGTAGTCTATGTGACCACCTCTAGCGGAGTGA
GCTTTAGGTCTATTTTTTAGAACAACGGACTAATTATTCCAACAGCATTGTCGACATATGGCTGCGGAAATGGAT
CAAGCTTCTGAAAAATTACACCCTCTCATTCCTACCTATGCTGTTGATTGCGACAACGAAAAAAATAAAGCTTTA
TGTGCAGAAGAATGGGTGCAGAAACTCCCTACTGTGACGGTTTGAATTTTATTTTGTGCCTCATTAACGCGCCCG
CAATCTTATGATCATTTGTAGCTGTTCCCTCGCGGAAATACACTTACGCCCACGATTTGTCCGGAACGCAAGGCG
GCTGGAGTTGTTAAATGGACATCGTCACATATTCCCGATTATGTGACCCAGCTTTCAAACATTGACGACATCGAG
TCATGGAAAGAAAAGGCTAGTAGTATCTTTGCCTTTAACGCCGCGACACTCATGGTTTATTTGTAGACGAAGGAG
GAAACCACACTTCTTCTTCTGACAAAAGAGAAGAAAGTCCCGCTACTTTGGAGAGTTCTTGCCAACAAATATTCC
GGAAGGCTCGAGTTAGCCGCCCACTGGGATGAGCACGGACAAGCGGCCAACGATCTCGGACTTGACAGCAATACC
AAAGTTCTCATATACCCCGCCGGTGATTCAAGACCTGTCAAATATGAGGGTATGTTGGCGTTTTCTAATGTTAAA
TTGTACCCGTGGTGACGACTTTACAGGCACCACCAAATACGAGCCTTTGACAAAGTTCTTTGATTCGATCCTCGA
CGGTACAGCAGACATCGGGACAGCAAGCGAGGGGCAGAAGTTATCCGACCGTCCGGACGATGAACTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail