Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|090610
Gene name
Locationscaffold_06:584732..586065
Strand-
Gene length (bp)1333
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 2.3E-09 29 123

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 5 183 9.0E-16
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 19 242 5.0E-14
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 22 230 6.0E-14
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 27 142 1.0E-11
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 1 130 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 5 183 9.0E-16
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 19 242 5.0E-14
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 22 230 6.0E-14
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 27 142 1.0E-11
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 1 130 2.0E-09
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 27 114 5.0E-08
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 5 243 2.0E-07
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 19 123 4.0E-07
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 21 120 1.0E-06
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 21 145 1.0E-06
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 1 112 3.0E-06
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 21 145 5.0E-06
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 21 145 5.0E-06
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 29 252 7.0E-06
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 32 114 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|090610
MFPRLVLLCFALQPSLLLTNALFTDDSLVKMLTPESFKGALEPNATSMIAFVSSSNSDCQNMAPEYEKAALGLYP
FVPSYAVNCDDEGNKDMCREQNVETFPTTKLFPRGNTEPPVVFEGSNDRSASSYFYWASRRIPSHVTKLYRVEEI
QPWAEKTKEDAVVLLLTKEKKVPMLWKVLANQYLGRLELASHRDRRGKSSVALGMEKGEKKDAKVLVYPAGSTEY
VRYEGILKMDSLSNFFEAILDGSVDLKTANDKANAEEFTPDEKELEIERKQEAQRIALAHGGLTDFIDFEKAIKA
GHGADYHDIHGYPGMMGETPKKKKSEDDDMEGEEFSPSNDDSMTEENTHRISDEL*
Coding >Agabi119p4|090610
ATGTTTCCTCGACTTGTTCTGCTTTGCTTTGCGCTGCAACCATCGCTTCTGCTAACAAATGCGTTGTTTACCGAT
GATTCTCTCGTGAAAATGCTGACGCCCGAGTCATTCAAGGGTGCTTTGGAACCGAACGCAACAAGTATGATCGCC
TTCGTTTCCTCCTCAAATTCAGATTGCCAAAATATGGCTCCCGAATATGAGAAGGCGGCACTGGGATTGTATCCA
TTTGTTCCGTCATACGCGGTGAACTGTGATGACGAGGGAAATAAAGATATGTGTCGGGAACAAAATGTCGAAACA
TTTCCAACTACTAAGCTATTTCCGCGCGGTAATACAGAACCACCCGTGGTATTTGAAGGTTCAAATGATAGAAGC
GCGAGCTCGTACTTCTATTGGGCTTCACGAAGGATACCCAGCCATGTGACAAAACTATACAGAGTCGAAGAAATC
CAACCCTGGGCTGAAAAGACAAAGGAGGATGCCGTCGTTCTTCTTTTGACTAAAGAAAAGAAAGTACCGATGCTA
TGGAAGGTGCTTGCGAATCAATACCTTGGTCGACTTGAATTAGCCTCCCATCGAGATCGTAGAGGAAAGTCATCT
GTCGCGTTGGGAATGGAGAAAGGCGAAAAGAAAGATGCCAAAGTTCTTGTGTATCCGGCAGGCTCAACAGAATAT
GTTAGATACGAAGGAATATTGAAAATGGATTCCTTGTCGAATTTCTTTGAAGCAATCCTTGATGGAAGTGTAGAT
TTGAAAACGGCAAACGACAAAGCGAACGCTGAAGAATTTACGCCAGACGAAAAGGAACTCGAGATTGAGAGGAAG
CAAGAGGCGCAGCGCATCGCTTTGGCTCATGGTGGACTTACGGATTTCATTGACTTTGAAAAGGCAATCAAGGCG
GGACATGGAGCCGACTATCATGACATCCATGGTTACCCAGGAATGATGGGCGAGACTCCTAAGAAGAAGAAAAGC
GAGGACGATGACATGGAAGGGGAAGAGTTCTCCCCAAGCAACGACGATAGTATGACAGAGGAGAACACGCATAGA
ATATCAGATGAGTTATAG
Transcript >Agabi119p4|090610
ATGTTTCCTCGACTTGTTCTGCTTTGCTTTGCGCTGCAACCATCGCTTCTGCTAACAAATGCGTTGTTTACCGAT
GATTCTCTCGTGAAAATGCTGACGCCCGAGTCATTCAAGGGTGCTTTGGAACCGAACGCAACAAGTATGATCGCC
TTCGTTTCCTCCTCAAATTCAGATTGCCAAAATATGGCTCCCGAATATGAGAAGGCGGCACTGGGATTGTATCCA
TTTGTTCCGTCATACGCGGTGAACTGTGATGACGAGGGAAATAAAGATATGTGTCGGGAACAAAATGTCGAAACA
TTTCCAACTACTAAGCTATTTCCGCGCGGTAATACAGAACCACCCGTGGTATTTGAAGGTTCAAATGATAGAAGC
GCGAGCTCGTACTTCTATTGGGCTTCACGAAGGATACCCAGCCATGTGACAAAACTATACAGAGTCGAAGAAATC
CAACCCTGGGCTGAAAAGACAAAGGAGGATGCCGTCGTTCTTCTTTTGACTAAAGAAAAGAAAGTACCGATGCTA
TGGAAGGTGCTTGCGAATCAATACCTTGGTCGACTTGAATTAGCCTCCCATCGAGATCGTAGAGGAAAGTCATCT
GTCGCGTTGGGAATGGAGAAAGGCGAAAAGAAAGATGCCAAAGTTCTTGTGTATCCGGCAGGCTCAACAGAATAT
GTTAGATACGAAGGAATATTGAAAATGGATTCCTTGTCGAATTTCTTTGAAGCAATCCTTGATGGAAGTGTAGAT
TTGAAAACGGCAAACGACAAAGCGAACGCTGAAGAATTTACGCCAGACGAAAAGGAACTCGAGATTGAGAGGAAG
CAAGAGGCGCAGCGCATCGCTTTGGCTCATGGTGGACTTACGGATTTCATTGACTTTGAAAAGGCAATCAAGGCG
GGACATGGAGCCGACTATCATGACATCCATGGTTACCCAGGAATGATGGGCGAGACTCCTAAGAAGAAGAAAAGC
GAGGACGATGACATGGAAGGGGAAGAGTTCTCCCCAAGCAACGACGATAGTATGACAGAGGAGAACACGCATAGA
ATATCAGATGAGTTATAG
Gene >Agabi119p4|090610
ATGTTTCCTCGACTTGTTCTGCTTTGCTTTGCGCTGCAACCATCGCTTCTGCTAACAAATGCGTTGTTTACCGAT
GATTCTCTCGTGAAAATGCTGACGCCCGAGTCATTCAAGGGTGCTTTGGAACCGAACGTGAGGTGCATTCGATAT
TACATGGCGTACCAGCATTGACGCGTGCGCAACTAATTGCAGGCAACAAGTATGATCGCCTTCGTTTCCTCCTCA
AATTCAGTACGCTTGTATCTTCATTTGTGATCCACTCGTACCGATACTAAAACAGGATTGCCAAAATATGGCTCC
CGAATATGAGAAGGCGGCACTGGGATTGTATCCATTTGTTCCGTCATACGCGGTGAACTGTGATGACGAGGGAAA
TAAAGATATGTGTCGGGAACAAAATGTCGAAACATTTCCAACTACTAAGGCACGCCATTTCCTTTCTTTTGGGTC
CTTTCTCCTAGAGTCTGATGATACTCTAGCTATTTCCGCGCGGTAATACAGAACCACCCGTGGTATTTGAAGGTT
CAAATGATAGAAGCGCGAGCTCGTACTTCTATTGGGCTTCACGAAGGATACCCAGCCATGTGACAAAACTATACA
GAGTCGAAGAAATCCAACCCTGGGCTGAAAAGGTCGGTAATCACTATGCCTCGAAACCAAGATTGACTGACATTC
GGAGACAGACAAAGGAGGATGCCGTCGTTCTTCTTTTGACTAAAGAAAAGAAAGTACCGATGCTATGGAAGGTGC
TTGCGAATCAATACCTTGGTCGACTTGAATTAGCCTCCCATCGAGATCGTAGAGGAAAGTCATCTGTCGCGTTGG
GAATGGAGAAAGGCGAAAAGAAAGATGCCAAAGTTCTTGTGTATCCGGCAGGCTCAACAGAATATGTTAGATACG
AAGGTAATAAAACGCCTCGAACCACGATACAAATTGCTGAGACAGAATCCTAGGAATATTGAAAATGGATTCCTT
GTCGAATTTCTTTGAAGCAATCCTTGATGGAAGTGTAGATTTGAAAACGGCAAACGACAAAGCGAACGCTGAAGA
ATTTACGCCAGACGAAAAGGAACTCGAGATTGAGAGGAAGCAAGAGGCGCAGCGCATCGCTTTGGCTCATGGTGG
ACTTACGGATTTCATTGACTTTGAAAAGGCAATCAAGGCGGGACATGGAGCCGACTATCATGACATCCATGGTTA
CCCAGGAATGATGGGCGAGACTCCTAAGAAGAAGAAAAGCGAGGACGATGACATGGAAGGGGAAGAGTTCTCCCC
AAGCAACGACGATAGTATGACAGAGGAGAACACGCATAGAATATCAGATGAGTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail