Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|090110
Gene name
Locationscaffold_06:434738..437197
Strand-
Gene length (bp)2459
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 3.6E-05 87 144
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 2.5E-11 204 264
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 1.3E-08 268 320
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 3.7E-07 251 278

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NYE2|RCC2_DANRE Protein RCC2 homolog OS=Danio rerio GN=rcc2 PE=2 SV=1 21 434 1.0E-44
sp|Q8BK67|RCC2_MOUSE Protein RCC2 OS=Mus musculus GN=Rcc2 PE=1 SV=1 21 432 7.0E-44
sp|Q52KW8|RCC2_XENLA Protein RCC2 homolog OS=Xenopus laevis GN=rcc2 PE=2 SV=1 21 432 2.0E-43
sp|Q9P258|RCC2_HUMAN Protein RCC2 OS=Homo sapiens GN=RCC2 PE=1 SV=2 21 432 3.0E-42
sp|Q9N1T2|RPGR_CANLF X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris GN=RPGR PE=2 SV=1 75 433 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NYE2|RCC2_DANRE Protein RCC2 homolog OS=Danio rerio GN=rcc2 PE=2 SV=1 21 434 1.0E-44
sp|Q8BK67|RCC2_MOUSE Protein RCC2 OS=Mus musculus GN=Rcc2 PE=1 SV=1 21 432 7.0E-44
sp|Q52KW8|RCC2_XENLA Protein RCC2 homolog OS=Xenopus laevis GN=rcc2 PE=2 SV=1 21 432 2.0E-43
sp|Q9P258|RCC2_HUMAN Protein RCC2 OS=Homo sapiens GN=RCC2 PE=1 SV=2 21 432 3.0E-42
sp|Q9N1T2|RPGR_CANLF X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris GN=RPGR PE=2 SV=1 75 433 2.0E-19
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 52 356 4.0E-19
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 21 379 6.0E-19
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 21 379 1.0E-18
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 52 327 4.0E-18
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 56 295 4.0E-18
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 56 295 5.0E-18
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 52 327 8.0E-18
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 56 295 9.0E-18
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 56 295 9.0E-18
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 101 324 1.0E-17
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 52 356 1.0E-17
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 101 324 1.0E-17
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 58 342 2.0E-17
sp|Q92834|RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 72 434 2.0E-17
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 101 324 3.0E-17
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 100 324 1.0E-16
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 62 324 2.0E-16
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 58 341 3.0E-16
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 58 341 3.0E-16
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 58 341 3.0E-16
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 62 324 4.0E-16
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 44 299 4.0E-16
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 90 360 5.0E-16
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 58 295 5.0E-16
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 137 435 6.0E-16
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 62 324 7.0E-16
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 62 324 7.0E-16
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 60 330 2.0E-15
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 72 313 2.0E-15
sp|Q9R0X5|RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 75 433 2.0E-15
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 133 301 4.0E-15
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 72 313 5.0E-15
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 58 301 5.0E-15
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 72 313 5.0E-15
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 131 324 6.0E-15
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 121 337 7.0E-15
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 55 317 2.0E-14
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 55 317 3.0E-14
sp|P25183|RCC1_XENLA Regulator of chromosome condensation OS=Xenopus laevis GN=rcc1 PE=2 SV=1 97 432 9.0E-14
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 22 294 1.0E-13
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 10 301 6.0E-13
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 133 331 6.0E-12
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 54 396 7.0E-12
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 138 466 9.0E-12
sp|Q9CYF5|WBS16_MOUSE Williams-Beuren syndrome chromosomal region 16 protein homolog OS=Mus musculus GN=Wbscr16 PE=2 SV=1 89 432 1.0E-11
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 187 396 2.0E-11
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 135 343 2.0E-11
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 192 432 3.0E-11
sp|Q9UGK8|SRGEF_HUMAN Secretion-regulating guanine nucleotide exchange factor OS=Homo sapiens GN=SERGEF PE=1 SV=2 136 297 6.0E-11
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 192 432 7.0E-11
sp|Q3MHW0|SRGEF_BOVIN Secretion-regulating guanine nucleotide exchange factor OS=Bos taurus GN=SERGEF PE=2 SV=1 136 308 7.0E-11
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 192 432 8.0E-11
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 150 285 9.0E-11
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 104 435 1.0E-10
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 131 320 1.0E-10
sp|Q80YD6|SRGEF_MOUSE Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus GN=Sergef PE=2 SV=2 136 281 1.0E-10
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 53 264 3.0E-10
sp|Q8VE37|RCC1_MOUSE Regulator of chromosome condensation OS=Mus musculus GN=Rcc1 PE=1 SV=1 72 324 3.0E-10
sp|Q8BTU7|RCCD1_MOUSE RCC1 domain-containing protein 1 OS=Mus musculus GN=Rccd1 PE=2 SV=2 187 283 4.0E-10
sp|P18754|RCC1_HUMAN Regulator of chromosome condensation OS=Homo sapiens GN=RCC1 PE=1 SV=1 72 324 6.0E-10
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 80 300 7.0E-10
sp|Q96I51|WBS16_HUMAN Williams-Beuren syndrome chromosomal region 16 protein OS=Homo sapiens GN=WBSCR16 PE=1 SV=2 107 432 7.0E-10
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 53 222 1.0E-09
sp|P23800|RCC1_MESAU Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 72 324 1.0E-09
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 54 322 1.0E-09
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 68 323 2.0E-09
sp|P28745|RCC1_SCHPO Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 21 345 2.0E-09
sp|Q4R828|RCCD1_MACFA RCC1 domain-containing protein 1 OS=Macaca fascicularis GN=RCCD1 PE=2 SV=1 189 283 2.0E-09
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 133 301 3.0E-09
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 57 287 3.0E-09
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 22 375 3.0E-09
sp|P52499|RCC1_CANAX Protein RCC1 OS=Candida albicans GN=RCC1 PE=3 SV=1 55 318 3.0E-09
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 133 301 5.0E-09
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 52 274 5.0E-09
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 52 274 5.0E-09
sp|Q9CYF5|WBS16_MOUSE Williams-Beuren syndrome chromosomal region 16 protein homolog OS=Mus musculus GN=Wbscr16 PE=2 SV=1 103 285 5.0E-09
sp|A6NED2|RCCD1_HUMAN RCC1 domain-containing protein 1 OS=Homo sapiens GN=RCCD1 PE=1 SV=1 189 283 5.0E-09
sp|Q3MHW0|SRGEF_BOVIN Secretion-regulating guanine nucleotide exchange factor OS=Bos taurus GN=SERGEF PE=2 SV=1 124 334 9.0E-09
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 52 274 1.0E-08
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 129 324 1.0E-08
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 54 295 1.0E-08
sp|Q5DX34|RPGRH_CAEEL X-linked retinitis pigmentosa GTPase regulator homolog OS=Caenorhabditis elegans GN=glo-4 PE=1 SV=2 136 276 1.0E-08
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 52 274 2.0E-08
sp|O42645|YF94_SCHPO RCC1 repeat-containing protein C10F6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.04 PE=3 SV=1 93 337 2.0E-08
sp|Q18211|RCC1_CAEEL Regulator of chromosome condensation OS=Caenorhabditis elegans GN=ran-3 PE=3 SV=1 120 300 2.0E-08
sp|Q96I51|WBS16_HUMAN Williams-Beuren syndrome chromosomal region 16 protein OS=Homo sapiens GN=WBSCR16 PE=1 SV=2 119 285 3.0E-08
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 54 295 3.0E-08
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 21 264 4.0E-08
sp|P18754|RCC1_HUMAN Regulator of chromosome condensation OS=Homo sapiens GN=RCC1 PE=1 SV=1 49 322 4.0E-08
sp|P23800|RCC1_MESAU Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 49 322 4.0E-08
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 160 295 5.0E-08
sp|Q920R0|ALS2_MOUSE Alsin OS=Mus musculus GN=Als2 PE=1 SV=3 187 310 5.0E-08
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 73 285 7.0E-08
sp|P0C5Y8|ALS2_RAT Alsin OS=Rattus norvegicus GN=Als2 PE=1 SV=1 187 310 8.0E-08
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 73 285 1.0E-07
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 54 295 2.0E-07
sp|P21827|RCC1_YEAST Guanine nucleotide exchange factor SRM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRM1 PE=1 SV=1 52 331 2.0E-07
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 58 279 3.0E-07
sp|P25183|RCC1_XENLA Regulator of chromosome condensation OS=Xenopus laevis GN=rcc1 PE=2 SV=1 49 323 3.0E-07
sp|Q5DX34|RPGRH_CAEEL X-linked retinitis pigmentosa GTPase regulator homolog OS=Caenorhabditis elegans GN=glo-4 PE=1 SV=2 136 296 3.0E-07
sp|Q920R0|ALS2_MOUSE Alsin OS=Mus musculus GN=Als2 PE=1 SV=3 205 327 3.0E-07
sp|P0C5Y8|ALS2_RAT Alsin OS=Rattus norvegicus GN=Als2 PE=1 SV=1 205 327 3.0E-07
sp|Q9UGK8|SRGEF_HUMAN Secretion-regulating guanine nucleotide exchange factor OS=Homo sapiens GN=SERGEF PE=1 SV=2 138 334 4.0E-07
sp|P21827|RCC1_YEAST Guanine nucleotide exchange factor SRM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRM1 PE=1 SV=1 80 284 4.0E-07
sp|P18754|RCC1_HUMAN Regulator of chromosome condensation OS=Homo sapiens GN=RCC1 PE=1 SV=1 97 282 5.0E-07
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 129 307 6.0E-07
sp|Q5BIW4|ALS2_PANTR Alsin OS=Pan troglodytes GN=ALS2 PE=2 SV=1 205 327 7.0E-07
sp|Q8BTU7|RCCD1_MOUSE RCC1 domain-containing protein 1 OS=Mus musculus GN=Rccd1 PE=2 SV=2 138 319 8.0E-07
sp|Q96Q42|ALS2_HUMAN Alsin OS=Homo sapiens GN=ALS2 PE=1 SV=2 205 327 9.0E-07
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 138 295 1.0E-06
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 53 295 1.0E-06
sp|Q5BIW4|ALS2_PANTR Alsin OS=Pan troglodytes GN=ALS2 PE=2 SV=1 187 310 1.0E-06
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 240 340 2.0E-06
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 240 340 2.0E-06
sp|Q9UGK8|SRGEF_HUMAN Secretion-regulating guanine nucleotide exchange factor OS=Homo sapiens GN=SERGEF PE=1 SV=2 21 295 2.0E-06
sp|Q8VE37|RCC1_MOUSE Regulator of chromosome condensation OS=Mus musculus GN=Rcc1 PE=1 SV=1 97 282 2.0E-06
sp|P28745|RCC1_SCHPO Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 80 295 2.0E-06
sp|Q18211|RCC1_CAEEL Regulator of chromosome condensation OS=Caenorhabditis elegans GN=ran-3 PE=3 SV=1 22 434 2.0E-06
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 74 285 2.0E-06
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 53 295 2.0E-06
sp|P21827|RCC1_YEAST Guanine nucleotide exchange factor SRM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRM1 PE=1 SV=1 97 295 2.0E-06
sp|Q96Q42|ALS2_HUMAN Alsin OS=Homo sapiens GN=ALS2 PE=1 SV=2 187 310 2.0E-06
sp|P25171|RCC1_DROME Regulator of chromosome condensation OS=Drosophila melanogaster GN=Rcc1 PE=1 SV=2 20 299 2.0E-06
sp|Q9NB71|HIW_DROME E3 ubiquitin-protein ligase highwire OS=Drosophila melanogaster GN=hiw PE=1 SV=2 111 218 2.0E-06
sp|Q4R828|RCCD1_MACFA RCC1 domain-containing protein 1 OS=Macaca fascicularis GN=RCCD1 PE=2 SV=1 138 319 3.0E-06
sp|A6NED2|RCCD1_HUMAN RCC1 domain-containing protein 1 OS=Homo sapiens GN=RCCD1 PE=1 SV=1 110 319 3.0E-06
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 138 295 3.0E-06
sp|P23800|RCC1_MESAU Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 97 282 4.0E-06
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 190 286 4.0E-06
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 198 468 5.0E-06
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 101 331 5.0E-06
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 41 331 6.0E-06
sp|P18754|RCC1_HUMAN Regulator of chromosome condensation OS=Homo sapiens GN=RCC1 PE=1 SV=1 149 274 7.0E-06
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 54 263 8.0E-06
sp|Q3MHW0|SRGEF_BOVIN Secretion-regulating guanine nucleotide exchange factor OS=Bos taurus GN=SERGEF PE=2 SV=1 21 296 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|090110
MSANNSDAATDGLATGQPQWGRVLICGGTDWPRLGRKDRPGTINPETGEPLNPDLLEPHILRSLSNVKVASVHAS
CAGCHFVAIDIEGNAWLFGRNGSSCLGTSGPGEEYISENAPRMVRPTDLGAQGDTKFVYAACGRNHTLLVGSDGS
VWTAGVNNLGQCGHSLSPEVSAFKGVKVMYNGSKEYVVQASAGITFSLVLTDAGRVFAFGSAEKGQLGNGTTGER
ITTGNKTAFDVEEKPIYVKALDGKNIVQIASGQQHSIALDDTGVVYVWGYNGYCRLGLGNQVDVLKPKPVPQFSG
QSESALATTVAAGPTNSVVVDKQGLYHMAGKWKNSGEGSSGSPYSSFRFIQDIMGCKVSHPRSGGVTHWLITPDD
DGTPMTVCWGQNAANGELGLGPEEPKSSTKPTKNNPLAHIEILDIAAGQNTTLLLAKPNDKNVSGVRRTTEILWN
VTSATLHGIYSAPVGLWRDTKSNRKRQRAESPIGDHGKSKAGSKKKKQ*
Coding >Agabi119p4|090110
ATGAGCGCAAACAACAGCGACGCCGCCACCGACGGACTGGCTACCGGCCAGCCTCAGTGGGGCAGAGTCCTAATT
TGTGGTGGCACTGACTGGCCTCGATTAGGAAGAAAGGATCGTCCTGGGACGATTAATCCAGAAACTGGGGAACCC
CTAAATCCAGACCTGCTCGAACCACATATACTTCGTTCCCTGAGCAATGTTAAAGTGGCTTCGGTGCATGCATCG
TGTGCAGGTTGCCATTTTGTCGCCATCGACATCGAAGGGAACGCATGGCTATTTGGCAGGAATGGGTCATCTTGC
CTCGGCACTTCGGGCCCGGGCGAAGAATATATCTCGGAGAACGCACCCAGAATGGTCAGGCCCACTGATTTGGGC
GCGCAGGGGGATACGAAATTCGTGTATGCCGCTTGTGGTCGAAACCACACGCTTCTGGTGGGAAGCGACGGGAGC
GTTTGGACTGCTGGGGTCAACAACCTGGGTCAGTGTGGCCACTCGTTGAGCCCTGAGGTCTCAGCTTTCAAAGGA
GTGAAAGTCATGTACAATGGCTCTAAAGAGTATGTCGTGCAAGCCTCCGCCGGGATCACATTCTCCCTCGTACTC
ACTGACGCTGGCAGAGTCTTTGCCTTCGGGAGTGCAGAGAAAGGACAACTCGGAAATGGTACCACTGGTGAACGC
ATCACAACTGGGAATAAGACAGCCTTTGATGTTGAAGAGAAACCGATCTACGTCAAAGCACTCGACGGAAAGAAC
ATTGTACAGATTGCATCAGGACAACAACACAGCATTGCATTGGATGACACAGGGGTTGTGTACGTATGGGGTTAT
AACGGCTATTGTCGACTTGGACTTGGCAACCAAGTTGACGTCCTTAAGCCTAAGCCAGTTCCTCAATTCTCCGGT
CAAAGCGAATCAGCACTTGCTACTACGGTTGCTGCTGGTCCCACGAACTCTGTCGTGGTGGATAAACAAGGTTTA
TACCATATGGCAGGCAAATGGAAAAACAGTGGAGAAGGATCATCTGGTTCCCCATATTCCTCGTTCCGTTTCATA
CAAGATATAATGGGCTGCAAAGTCTCCCATCCCCGTTCGGGTGGTGTGACCCACTGGCTCATTACCCCTGATGAT
GATGGTACTCCAATGACCGTTTGTTGGGGACAGAATGCGGCCAATGGAGAACTTGGCTTAGGCCCCGAGGAGCCG
AAGAGCTCAACTAAGCCCACTAAGAACAATCCGTTGGCTCACATCGAAATTCTTGATATTGCCGCCGGTCAAAAT
ACCACTCTGCTACTAGCGAAGCCCAATGACAAGAATGTGTCGGGTGTAAGAAGGACGACGGAGATCCTTTGGAAT
GTGACAAGTGCGACGCTCCATGGCATTTACAGCGCGCCGGTGGGTCTCTGGAGGGATACGAAGAGTAATCGCAAG
AGGCAACGAGCGGAGTCTCCCATCGGGGATCATGGCAAAAGCAAAGCTGGCTCCAAGAAAAAGAAGCAATAG
Transcript >Agabi119p4|090110
ATGAGCGCAAACAACAGCGACGCCGCCACCGACGGACTGGCTACCGGCCAGCCTCAGTGGGGCAGAGTCCTAATT
TGTGGTGGCACTGACTGGCCTCGATTAGGAAGAAAGGATCGTCCTGGGACGATTAATCCAGAAACTGGGGAACCC
CTAAATCCAGACCTGCTCGAACCACATATACTTCGTTCCCTGAGCAATGTTAAAGTGGCTTCGGTGCATGCATCG
TGTGCAGGTTGCCATTTTGTCGCCATCGACATCGAAGGGAACGCATGGCTATTTGGCAGGAATGGGTCATCTTGC
CTCGGCACTTCGGGCCCGGGCGAAGAATATATCTCGGAGAACGCACCCAGAATGGTCAGGCCCACTGATTTGGGC
GCGCAGGGGGATACGAAATTCGTGTATGCCGCTTGTGGTCGAAACCACACGCTTCTGGTGGGAAGCGACGGGAGC
GTTTGGACTGCTGGGGTCAACAACCTGGGTCAGTGTGGCCACTCGTTGAGCCCTGAGGTCTCAGCTTTCAAAGGA
GTGAAAGTCATGTACAATGGCTCTAAAGAGTATGTCGTGCAAGCCTCCGCCGGGATCACATTCTCCCTCGTACTC
ACTGACGCTGGCAGAGTCTTTGCCTTCGGGAGTGCAGAGAAAGGACAACTCGGAAATGGTACCACTGGTGAACGC
ATCACAACTGGGAATAAGACAGCCTTTGATGTTGAAGAGAAACCGATCTACGTCAAAGCACTCGACGGAAAGAAC
ATTGTACAGATTGCATCAGGACAACAACACAGCATTGCATTGGATGACACAGGGGTTGTGTACGTATGGGGTTAT
AACGGCTATTGTCGACTTGGACTTGGCAACCAAGTTGACGTCCTTAAGCCTAAGCCAGTTCCTCAATTCTCCGGT
CAAAGCGAATCAGCACTTGCTACTACGGTTGCTGCTGGTCCCACGAACTCTGTCGTGGTGGATAAACAAGGTTTA
TACCATATGGCAGGCAAATGGAAAAACAGTGGAGAAGGATCATCTGGTTCCCCATATTCCTCGTTCCGTTTCATA
CAAGATATAATGGGCTGCAAAGTCTCCCATCCCCGTTCGGGTGGTGTGACCCACTGGCTCATTACCCCTGATGAT
GATGGTACTCCAATGACCGTTTGTTGGGGACAGAATGCGGCCAATGGAGAACTTGGCTTAGGCCCCGAGGAGCCG
AAGAGCTCAACTAAGCCCACTAAGAACAATCCGTTGGCTCACATCGAAATTCTTGATATTGCCGCCGGTCAAAAT
ACCACTCTGCTACTAGCGAAGCCCAATGACAAGAATGTGTCGGGTGTAAGAAGGACGACGGAGATCCTTTGGAAT
GTGACAAGTGCGACGCTCCATGGCATTTACAGCGCGCCGGTGGGTCTCTGGAGGGATACGAAGAGTAATCGCAAG
AGGCAACGAGCGGAGTCTCCCATCGGGGATCATGGCAAAAGCAAAGCTGGCTCCAAGAAAAAGAAGCAATAG
Gene >Agabi119p4|090110
ATGAGCGCAAACAACAGCGACGCCGCCACCGACGGACTGGCTACCGGCCAGCCTCAGTGGGGCAGAGGTATGCAT
AACCCTCGTTTACATGCCTCTAGGAGTACTGACAGCCAATTCACGTCCAGTCCTAATTTGTGGTGGCACTGACTG
GTAGGCCTGACCTTCTCTCACAGTCGAACAATGCCCATTCACATGTGTCCTGTCCTCTTTTATAACTCATCAGGC
CTCGATTAGGAAGAAAGGATCGTCCTGGGACGATTAATCCAGAAACTGGGGAACCCCTGTGAGCATATTTCGTTT
CAATTTCAATTGTAGCGTCTGACTTGCAACTTCACCACTCCCCGGCCCAACAGAAATCCAGACCTGCTCGAACCA
CATATACTTCGTTCCCTGAGCAATGTTAAAGTGGCTTCGGTGCATGCATCGTGTGCAGGTTGCCATTTTGTCGCC
ATCGACATCGAAGGGAACGCATGGCTATTTGGCAGGAATGGGTCATCTTGCCTCGGCACTTCGGGCCCGGGCGAA
GAATATATCTCGGAGAACGCACCCAGAATGGTCAGGCCCACTGATTTGGGCGCGCAGGGGGATACGAAATTCGTG
TATGCCGCTTGTGGTCGAAACCACACGCTTCTGGTGGGAAGCGACGGGAGCGTTTGGACTGCTGGGGTCAACAAC
CTGGGTCAGGTGTGTGGTTTATTTCTTAATGAGTGCAGCGACTGTTCCTTGACAATGCACGGTAGTGTGGCCACT
CGTTGAGCCCTGAGGTCTCAGCTTTCAAAGGAGTGAAAGTCATGTACAATGGCTCTAAAGAGTATGTCGTGCAAG
CCTCCGCCGGGATCACATTCTCCCTCGTACTCACTGACGCTGGCAGAGGTAATTCTTTGCTCGCGTCTCGTGAAT
TTTGACTCAACTGATACCTCCTTCTTTTACTAGTCTTTGCCTTCGGGAGTGCAGAGAAAGGACAACTCGGAAATG
GTACCACTGGTGAACGCATCACAACTGGGAATAAGACAGCCTTTGATGTTGAAGAGAAACCGAGTGCGTTCTCAA
TTTTCATTCATACTCTAACTGACGTTTGTGTAGTCTACGTCAAAGCACTCGACGGAAAGAACATTGTACAGATTG
CATCAGGACAACAACACAGCATTGCATTGGATGACACAGGGTACGTGGTCCTTTAGTTACTCACATTAGTATTTC
TCGACTGAAACACCTGCTTCAAGGGTTGTGTACGTATGGGGTTATAACGGCTATTGTCGACTTGGACTTGGCAAC
CAAGTTGACGTCCTTAAGCCTAAGCCAGTTCCTCAAGTATACCTTCTTACTACCTATCTCACTTCTATCACACTG
AAGTCTATAATCGCTAGTTCTCCGGTCAAAGCGAATCAGCACTTGCTACTACGGTTGCTGCTGGTCCCACGAACT
CTGTCGTGGTGGATAAACAAGGTTTATACCATATGGCAGGCAAAGTGTGTCACGATTAGTCCCATTTTCTCCGTT
CCGATAGCTAATCTCTTTCAATTTATTAGTGGAAAAACAGTGGAGAAGGTGAGTAGAATTCAGTATATGTGGGCT
GGGTATTTATAGTCTGGTGGAAGGATCATCTGGTTCCCCATATTCCTCGTTCCGTTTCATACAAGATATAATGTC
AGTCCATTCCCAGTCTATCATCGTCTCATATTGGTTTTTTAACCCTTCGTATTTAACCAGGGGCTGCAAAGTCTC
CCATCCCCGTTCGGGTGGTGTGACCCACTGGCTCATTACCCCTGATGATGATGGTACTCCAATGACCGTTTGTTG
GGGACAGAATGCGGCCAATGGAGAACTTGGCTTAGGCCCCGAGGAGCCGAAGAGCTCAACTAAGCCCACTAAGAA
CAATCCGTTGGCTCACATCGAAATTCTTGAGTGAGATCTTTGATCCTTCATCGGCGTATGTGAATGGCGCGTAAT
GATGTTTCCGTTTATAGTATTGCCGCCGGTCAAAATACCACTCTGCTACTAGCGAAGCCCAATGACAAGTATTCC
GACTTACCCAGACATCCAATTGATGTTCAACCTCCCCAGGAATGTGTCGGGTGTAAGAAGGACGACGGAGATCCT
TTGGAATGTGACAAGGTCAATTCACGATCTCTATCAATGTATTGATTCTTAATATACCCTTTTTTTTCAGTGCGA
CGCTCCATGGCATTTACAGTGCTTGAACCCTCCGTTGAGTGAGATACCTGAAGGTGAATGGTTTTGTCCCCAATG
TATCGATGATCCAGGCGCGCCGGTGGGTCTCTGGAGGGATACGAAGAGTAATCGCAAGAGGCAACGAGCGGAGTC
TCCCATCGGGGATCATGGCAAAAGCAAAGCTGGTATGCATCTGTTTTTTTTCATTATCGCAGTAAACGTATTCGT
ATGTTCTCATGATCCGCACCATTGTGGTATTAATAGGCTCCAAGAAAAAGAAGCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail