Protein ID | Agabi119p4|089150 |
Gene name | |
Location | scaffold_06:250632..252718 |
Strand | + |
Gene length (bp) | 2086 |
Transcript length (bp) | 1935 |
Coding sequence length (bp) | 1935 |
Protein length (aa) | 645 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00400 | WD40 | WD domain, G-beta repeat | 5.8E-08 | 398 | 435 |
PF00400 | WD40 | WD domain, G-beta repeat | 9.6E-06 | 440 | 475 |
PF00400 | WD40 | WD domain, G-beta repeat | 1.1E-06 | 479 | 515 |
PF00400 | WD40 | WD domain, G-beta repeat | 3.4E-04 | 562 | 595 |
PF12937 | F-box-like | F-box-like | 9.1E-11 | 126 | 168 |
PF00646 | F-box | F-box domain | 8.9E-06 | 124 | 165 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 379 | 629 | 2.0E-63 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 379 | 629 | 3.0E-63 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 379 | 629 | 3.0E-63 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 379 | 627 | 2.0E-58 |
sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 381 | 605 | 4.0E-51 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 379 | 629 | 2.0E-63 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 379 | 629 | 3.0E-63 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 379 | 629 | 3.0E-63 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 379 | 627 | 2.0E-58 |
sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 381 | 605 | 4.0E-51 |
sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 381 | 627 | 4.0E-50 |
sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 381 | 636 | 9.0E-43 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 370 | 639 | 9.0E-41 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 376 | 639 | 3.0E-39 |
sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 95 | 525 | 1.0E-38 |
sp|P07834|CDC4_YEAST | Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 | 378 | 643 | 2.0E-38 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 379 | 600 | 2.0E-37 |
sp|P53699|CDC4_CANAX | Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 | 381 | 636 | 2.0E-37 |
sp|P87060|POP1_SCHPO | WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 | 381 | 636 | 2.0E-37 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 381 | 617 | 7.0E-37 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 381 | 617 | 2.0E-36 |
sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 350 | 599 | 2.0E-36 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 381 | 617 | 1.0E-35 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 378 | 603 | 2.0E-35 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 226 | 600 | 2.0E-35 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 230 | 620 | 9.0E-35 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 382 | 617 | 1.0E-34 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 382 | 640 | 2.0E-34 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 381 | 617 | 3.0E-34 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 379 | 639 | 1.0E-33 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 379 | 637 | 1.0E-33 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 382 | 617 | 8.0E-33 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 289 | 620 | 1.0E-32 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 386 | 639 | 1.0E-32 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 381 | 617 | 9.0E-32 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 379 | 596 | 2.0E-31 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 358 | 548 | 3.0E-31 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 381 | 617 | 3.0E-31 |
sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 110 | 515 | 1.0E-30 |
sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 377 | 595 | 5.0E-30 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 382 | 603 | 1.0E-29 |
sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 110 | 515 | 1.0E-29 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 379 | 617 | 1.0E-29 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 379 | 617 | 2.0E-29 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 379 | 594 | 2.0E-29 |
sp|P87060|POP1_SCHPO | WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 | 91 | 541 | 1.0E-28 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 393 | 617 | 2.0E-28 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 379 | 594 | 5.0E-28 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 396 | 612 | 6.0E-28 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 386 | 609 | 7.0E-28 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 398 | 612 | 1.0E-27 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 402 | 616 | 1.0E-27 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 379 | 594 | 1.0E-27 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 372 | 596 | 1.0E-27 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 372 | 596 | 1.0E-27 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 372 | 596 | 1.0E-27 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 372 | 596 | 1.0E-27 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 393 | 617 | 2.0E-27 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 386 | 609 | 2.0E-27 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 372 | 596 | 2.0E-27 |
sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 363 | 599 | 2.0E-27 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 377 | 600 | 3.0E-27 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 379 | 594 | 3.0E-27 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 379 | 594 | 3.0E-27 |
sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 363 | 599 | 3.0E-27 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 372 | 527 | 4.0E-27 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 372 | 598 | 4.0E-27 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 381 | 594 | 5.0E-27 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 377 | 595 | 6.0E-27 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 379 | 528 | 8.0E-27 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 372 | 596 | 1.0E-26 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 372 | 594 | 1.0E-26 |
sp|Q6CB13|MDV1_YARLI | Mitochondrial division protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDV1 PE=3 SV=1 | 376 | 595 | 1.0E-26 |
sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 91 | 519 | 2.0E-26 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 398 | 612 | 2.0E-26 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 372 | 594 | 2.0E-26 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 372 | 596 | 2.0E-26 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 396 | 612 | 3.0E-26 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 381 | 595 | 3.0E-26 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 378 | 603 | 3.0E-26 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 423 | 617 | 4.0E-26 |
sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 381 | 595 | 4.0E-26 |
sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 381 | 595 | 4.0E-26 |
sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 378 | 570 | 6.0E-26 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 377 | 594 | 6.0E-26 |
sp|Q6CB13|MDV1_YARLI | Mitochondrial division protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDV1 PE=3 SV=1 | 397 | 605 | 6.0E-26 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 378 | 603 | 6.0E-26 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 365 | 597 | 6.0E-26 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 366 | 640 | 8.0E-26 |
sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 361 | 636 | 1.0E-25 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 428 | 637 | 3.0E-25 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 378 | 603 | 3.0E-25 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 378 | 603 | 3.0E-25 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 378 | 603 | 3.0E-25 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 378 | 603 | 3.0E-25 |
sp|Q6FT96|MDV1_CANGA | Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 | 379 | 600 | 3.0E-25 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 378 | 603 | 3.0E-25 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 378 | 603 | 3.0E-25 |
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 440 | 640 | 4.0E-25 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 377 | 594 | 4.0E-25 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 381 | 612 | 4.0E-25 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 381 | 612 | 4.0E-25 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 381 | 612 | 4.0E-25 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 381 | 612 | 4.0E-25 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 379 | 608 | 4.0E-25 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 378 | 603 | 4.0E-25 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 208 | 533 | 5.0E-25 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 381 | 612 | 5.0E-25 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 381 | 612 | 5.0E-25 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 378 | 603 | 5.0E-25 |
sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 379 | 626 | 6.0E-25 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 289 | 575 | 7.0E-25 |
sp|Q5XX13|FBW10_HUMAN | F-box/WD repeat-containing protein 10 OS=Homo sapiens GN=FBXW10 PE=2 SV=2 | 370 | 603 | 7.0E-25 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 378 | 603 | 7.0E-25 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 378 | 603 | 7.0E-25 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 443 | 640 | 8.0E-25 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 434 | 594 | 8.0E-25 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 379 | 594 | 8.0E-25 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 379 | 595 | 8.0E-25 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 443 | 640 | 9.0E-25 |
sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 377 | 603 | 9.0E-25 |
sp|Q6CJ50|MDV1_KLULA | Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 | 405 | 599 | 9.0E-25 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 423 | 617 | 1.0E-24 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 365 | 551 | 1.0E-24 |
sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 377 | 603 | 1.0E-24 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 386 | 603 | 1.0E-24 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 381 | 621 | 1.0E-24 |
sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 377 | 603 | 1.0E-24 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 381 | 612 | 2.0E-24 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 377 | 556 | 2.0E-24 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 377 | 608 | 2.0E-24 |
sp|O95170|CDRT1_HUMAN | CMT1A duplicated region transcript 1 protein OS=Homo sapiens GN=CDRT1 PE=2 SV=3 | 370 | 603 | 2.0E-24 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 381 | 608 | 2.0E-24 |
sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 377 | 603 | 3.0E-24 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 377 | 625 | 3.0E-24 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 382 | 597 | 3.0E-24 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 379 | 597 | 4.0E-24 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 386 | 605 | 4.0E-24 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 303 | 607 | 4.0E-24 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 378 | 603 | 4.0E-24 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 377 | 608 | 4.0E-24 |
sp|A7ETB3|MDV1_SCLS1 | Mitochondrial division protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdv1 PE=3 SV=1 | 376 | 638 | 4.0E-24 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 379 | 567 | 5.0E-24 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 379 | 596 | 5.0E-24 |
sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 444 | 637 | 6.0E-24 |
sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 84 | 527 | 6.0E-24 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 379 | 608 | 6.0E-24 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 381 | 612 | 7.0E-24 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 378 | 606 | 7.0E-24 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 367 | 594 | 7.0E-24 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 395 | 575 | 7.0E-24 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 382 | 640 | 8.0E-24 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 395 | 575 | 8.0E-24 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 395 | 575 | 8.0E-24 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 395 | 575 | 8.0E-24 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 381 | 548 | 1.0E-23 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 379 | 642 | 1.0E-23 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 381 | 594 | 1.0E-23 |
sp|Q5SUS0|FBW10_MOUSE | F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1 | 405 | 603 | 1.0E-23 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 377 | 624 | 1.0E-23 |
sp|B6GZA1|SCONB_PENRW | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 | 441 | 618 | 2.0E-23 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 378 | 603 | 2.0E-23 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 378 | 597 | 2.0E-23 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 378 | 607 | 2.0E-23 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 381 | 578 | 2.0E-23 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 442 | 605 | 2.0E-23 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 365 | 597 | 3.0E-23 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 395 | 575 | 3.0E-23 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 379 | 596 | 3.0E-23 |
sp|Q4WVS4|MDV1_ASPFU | Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 | 376 | 601 | 3.0E-23 |
sp|A6ZZZ8|CAF4_YEAS7 | CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF4 PE=3 SV=2 | 358 | 597 | 4.0E-23 |
sp|Q0CJD8|MDV1_ASPTN | Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2 | 376 | 601 | 4.0E-23 |
sp|Q5AXW3|MDV1_EMENI | Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2 | 376 | 634 | 4.0E-23 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 379 | 597 | 5.0E-23 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 382 | 624 | 5.0E-23 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 377 | 626 | 5.0E-23 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 395 | 598 | 6.0E-23 |
sp|A1CBP8|MDV1_ASPCL | Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 | 376 | 601 | 6.0E-23 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 376 | 581 | 6.0E-23 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 381 | 612 | 7.0E-23 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 377 | 616 | 8.0E-23 |
sp|P36130|CAF4_YEAST | CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 | 358 | 597 | 8.0E-23 |
sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 409 | 617 | 9.0E-23 |
sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 444 | 637 | 1.0E-22 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 381 | 612 | 1.0E-22 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 365 | 555 | 1.0E-22 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 375 | 597 | 1.0E-22 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 395 | 575 | 1.0E-22 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 441 | 605 | 1.0E-22 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 395 | 575 | 1.0E-22 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 299 | 597 | 1.0E-22 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 379 | 601 | 1.0E-22 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 381 | 594 | 1.0E-22 |
sp|A1DDL6|MDV1_NEOFI | Mitochondrial division protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdv1 PE=3 SV=1 | 376 | 601 | 1.0E-22 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 377 | 594 | 2.0E-22 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 379 | 597 | 2.0E-22 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 378 | 593 | 2.0E-22 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 379 | 586 | 2.0E-22 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 379 | 586 | 2.0E-22 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 441 | 605 | 2.0E-22 |
sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 378 | 597 | 2.0E-22 |
sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 378 | 593 | 2.0E-22 |
sp|Q2H139|MDV1_CHAGB | Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 | 307 | 637 | 2.0E-22 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 378 | 597 | 2.0E-22 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 441 | 605 | 2.0E-22 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 377 | 535 | 3.0E-22 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 221 | 594 | 3.0E-22 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 403 | 638 | 3.0E-22 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 377 | 535 | 3.0E-22 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 382 | 616 | 3.0E-22 |
sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 395 | 616 | 3.0E-22 |
sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 395 | 616 | 3.0E-22 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 361 | 514 | 4.0E-22 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 378 | 603 | 4.0E-22 |
sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 378 | 593 | 4.0E-22 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 397 | 597 | 4.0E-22 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 377 | 594 | 4.0E-22 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 381 | 599 | 4.0E-22 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 378 | 603 | 4.0E-22 |
sp|A8PTE4|MDV1_MALGO | Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 | 373 | 595 | 4.0E-22 |
sp|Q6FT96|MDV1_CANGA | Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 | 405 | 600 | 5.0E-22 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 382 | 602 | 5.0E-22 |
sp|A4RJV3|MDV1_MAGO7 | Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 | 376 | 595 | 5.0E-22 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 377 | 594 | 6.0E-22 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 381 | 555 | 6.0E-22 |
sp|Q7S8R5|MDV1_NEUCR | Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 | 376 | 600 | 6.0E-22 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 371 | 644 | 6.0E-22 |
sp|Q0U2T3|MDV1_PHANO | Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 | 365 | 638 | 6.0E-22 |
sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 381 | 620 | 6.0E-22 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 377 | 620 | 6.0E-22 |
sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 110 | 475 | 7.0E-22 |
sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 110 | 475 | 7.0E-22 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 381 | 555 | 7.0E-22 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 381 | 555 | 7.0E-22 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 381 | 555 | 7.0E-22 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 381 | 555 | 7.0E-22 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 441 | 605 | 7.0E-22 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 381 | 555 | 7.0E-22 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 110 | 475 | 8.0E-22 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 381 | 555 | 8.0E-22 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 381 | 555 | 8.0E-22 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 375 | 597 | 9.0E-22 |
sp|P38011|GBLP_YEAST | Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 | 374 | 580 | 9.0E-22 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 351 | 594 | 9.0E-22 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 372 | 594 | 9.0E-22 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 379 | 606 | 9.0E-22 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 382 | 602 | 9.0E-22 |
sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 377 | 644 | 9.0E-22 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 377 | 594 | 1.0E-21 |
sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 400 | 599 | 1.0E-21 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 381 | 555 | 1.0E-21 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 381 | 602 | 1.0E-21 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 381 | 555 | 1.0E-21 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 382 | 602 | 1.0E-21 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 351 | 594 | 1.0E-21 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 351 | 594 | 1.0E-21 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 373 | 642 | 1.0E-21 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 395 | 575 | 1.0E-21 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 381 | 617 | 1.0E-21 |
sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 381 | 620 | 1.0E-21 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 378 | 598 | 1.0E-21 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 377 | 608 | 1.0E-21 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 379 | 598 | 1.0E-21 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 378 | 602 | 1.0E-21 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 361 | 514 | 2.0E-21 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 400 | 603 | 2.0E-21 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 377 | 556 | 2.0E-21 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 386 | 597 | 2.0E-21 |
sp|A1CBP8|MDV1_ASPCL | Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 | 397 | 605 | 2.0E-21 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 395 | 575 | 2.0E-21 |
sp|A4RJV3|MDV1_MAGO7 | Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 | 394 | 605 | 2.0E-21 |
sp|Q0U2T3|MDV1_PHANO | Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 | 394 | 600 | 2.0E-21 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 366 | 615 | 2.0E-21 |
sp|Q758R7|MDV1_ASHGO | Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1 | 404 | 606 | 2.0E-21 |
sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 379 | 594 | 2.0E-21 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 379 | 598 | 2.0E-21 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 376 | 555 | 2.0E-21 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 365 | 597 | 2.0E-21 |
sp|A2R3Z3|MDV1_ASPNC | Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 | 397 | 600 | 2.0E-21 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 379 | 601 | 2.0E-21 |
sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 395 | 575 | 2.0E-21 |
sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 381 | 620 | 2.0E-21 |
sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 377 | 556 | 3.0E-21 |
sp|Q0CJD8|MDV1_ASPTN | Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2 | 397 | 600 | 3.0E-21 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 372 | 575 | 3.0E-21 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 379 | 616 | 3.0E-21 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 441 | 605 | 3.0E-21 |
sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 372 | 642 | 3.0E-21 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 382 | 598 | 3.0E-21 |
sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 377 | 556 | 4.0E-21 |
sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 377 | 556 | 4.0E-21 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 375 | 616 | 4.0E-21 |
sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 377 | 556 | 5.0E-21 |
sp|B6GZA1|SCONB_PENRW | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 | 400 | 575 | 5.0E-21 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 399 | 605 | 5.0E-21 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 351 | 594 | 5.0E-21 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 377 | 546 | 5.0E-21 |
sp|Q6FLI3|CAF4_CANGA | CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1 | 374 | 599 | 5.0E-21 |
sp|A7THX0|MDV1_VANPO | Mitochondrial division protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDV1 PE=3 SV=1 | 378 | 643 | 5.0E-21 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 434 | 642 | 6.0E-21 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 365 | 597 | 6.0E-21 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 395 | 589 | 6.0E-21 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 385 | 609 | 6.0E-21 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 381 | 625 | 6.0E-21 |
sp|P47025|MDV1_YEAST | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 | 402 | 637 | 6.0E-21 |
sp|Q4WVS4|MDV1_ASPFU | Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 | 397 | 600 | 7.0E-21 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 379 | 560 | 7.0E-21 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 213 | 548 | 7.0E-21 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 375 | 616 | 8.0E-21 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 381 | 595 | 8.0E-21 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 403 | 599 | 8.0E-21 |
sp|P47025|MDV1_YEAST | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 | 379 | 639 | 8.0E-21 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 378 | 595 | 8.0E-21 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 382 | 619 | 9.0E-21 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 386 | 620 | 9.0E-21 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 394 | 606 | 1.0E-20 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 394 | 606 | 1.0E-20 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 394 | 606 | 1.0E-20 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 394 | 606 | 1.0E-20 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 394 | 606 | 1.0E-20 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 378 | 546 | 1.0E-20 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 381 | 598 | 1.0E-20 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 402 | 595 | 1.0E-20 |
sp|A1DDL6|MDV1_NEOFI | Mitochondrial division protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdv1 PE=3 SV=1 | 397 | 600 | 1.0E-20 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 403 | 606 | 1.0E-20 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 403 | 606 | 1.0E-20 |
sp|Q1DIW7|MDV1_COCIM | Mitochondrial division protein 1 OS=Coccidioides immitis (strain RS) GN=MDV1 PE=3 SV=2 | 376 | 601 | 1.0E-20 |
sp|Q1DIW7|MDV1_COCIM | Mitochondrial division protein 1 OS=Coccidioides immitis (strain RS) GN=MDV1 PE=3 SV=2 | 394 | 600 | 1.0E-20 |
sp|A6ZQL5|MDV1_YEAS7 | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 | 379 | 639 | 1.0E-20 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 378 | 546 | 1.0E-20 |
sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 379 | 616 | 2.0E-20 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 395 | 641 | 2.0E-20 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 378 | 598 | 2.0E-20 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 386 | 595 | 2.0E-20 |
sp|Q8RXA7|SCD1_ARATH | DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 | 300 | 600 | 2.0E-20 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 403 | 606 | 2.0E-20 |
sp|Q2U5Z8|MDV1_ASPOR | Mitochondrial division protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdv1 PE=3 SV=2 | 397 | 605 | 2.0E-20 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 387 | 617 | 2.0E-20 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 381 | 528 | 2.0E-20 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 459 | 602 | 3.0E-20 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 381 | 555 | 3.0E-20 |
sp|Q2H139|MDV1_CHAGB | Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 | 366 | 601 | 3.0E-20 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 406 | 600 | 3.0E-20 |
sp|A6ZQL5|MDV1_YEAS7 | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 | 402 | 637 | 3.0E-20 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 388 | 603 | 3.0E-20 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 361 | 514 | 4.0E-20 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 365 | 597 | 4.0E-20 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 352 | 606 | 5.0E-20 |
sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 402 | 620 | 5.0E-20 |
sp|Q6NNP0|ATG16_ARATH | Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 | 382 | 602 | 5.0E-20 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 381 | 579 | 6.0E-20 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 375 | 616 | 7.0E-20 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 403 | 606 | 8.0E-20 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 365 | 597 | 8.0E-20 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 401 | 599 | 1.0E-19 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 381 | 602 | 1.0E-19 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 373 | 598 | 1.0E-19 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 400 | 605 | 1.0E-19 |
sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 375 | 616 | 1.0E-19 |
sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 353 | 594 | 1.0E-19 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 365 | 597 | 1.0E-19 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 365 | 597 | 1.0E-19 |
sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 353 | 594 | 1.0E-19 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 365 | 597 | 1.0E-19 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 365 | 597 | 1.0E-19 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 365 | 597 | 1.0E-19 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 365 | 597 | 1.0E-19 |
sp|A7TNS8|CAF4_VANPO | CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 | 365 | 643 | 1.0E-19 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 365 | 597 | 1.0E-19 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 365 | 597 | 1.0E-19 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 381 | 540 | 1.0E-19 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 378 | 514 | 2.0E-19 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 395 | 637 | 2.0E-19 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 403 | 606 | 2.0E-19 |
sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 379 | 604 | 2.0E-19 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 221 | 637 | 2.0E-19 |
sp|Q5SUS0|FBW10_MOUSE | F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1 | 375 | 578 | 2.0E-19 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 403 | 606 | 2.0E-19 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 366 | 594 | 2.0E-19 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 376 | 620 | 2.0E-19 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 365 | 597 | 2.0E-19 |
sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 334 | 605 | 2.0E-19 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 381 | 555 | 3.0E-19 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 379 | 546 | 3.0E-19 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 381 | 606 | 3.0E-19 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 382 | 620 | 3.0E-19 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 365 | 597 | 3.0E-19 |
sp|Q10051|PRP19_CAEEL | Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 | 379 | 617 | 3.0E-19 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 379 | 545 | 3.0E-19 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 365 | 516 | 4.0E-19 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 398 | 568 | 4.0E-19 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 377 | 600 | 4.0E-19 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 365 | 516 | 5.0E-19 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 374 | 581 | 5.0E-19 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 382 | 603 | 5.0E-19 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 294 | 577 | 5.0E-19 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 376 | 620 | 5.0E-19 |
sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 379 | 596 | 5.0E-19 |
sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 379 | 596 | 5.0E-19 |
sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 375 | 616 | 5.0E-19 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 381 | 521 | 6.0E-19 |
sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 381 | 593 | 6.0E-19 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 386 | 605 | 6.0E-19 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 401 | 599 | 7.0E-19 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 377 | 556 | 7.0E-19 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 403 | 602 | 7.0E-19 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 294 | 577 | 7.0E-19 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 375 | 624 | 9.0E-19 |
sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 377 | 561 | 9.0E-19 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 402 | 602 | 9.0E-19 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 403 | 606 | 1.0E-18 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 365 | 597 | 1.0E-18 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 381 | 605 | 1.0E-18 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 381 | 624 | 1.0E-18 |
sp|Q5A7Q3|PRP46_CANAL | Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 | 369 | 600 | 1.0E-18 |
sp|Q54R82|MKKA_DICDI | Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 | 374 | 551 | 1.0E-18 |
sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 376 | 596 | 1.0E-18 |
sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 403 | 605 | 1.0E-18 |
sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 403 | 605 | 1.0E-18 |
sp|Q9P7I3|MDV1_SCHPO | Mitochondrial division protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdv1 PE=3 SV=1 | 397 | 602 | 1.0E-18 |
sp|Q6FJZ9|PRP46_CANGA | Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 | 377 | 605 | 1.0E-18 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 361 | 514 | 2.0E-18 |
sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 452 | 603 | 2.0E-18 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 372 | 572 | 2.0E-18 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 375 | 624 | 2.0E-18 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 401 | 599 | 2.0E-18 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 378 | 603 | 2.0E-18 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 378 | 603 | 2.0E-18 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 378 | 603 | 2.0E-18 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 379 | 545 | 2.0E-18 |
sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 386 | 515 | 2.0E-18 |
sp|Q0J3D9|COPA3_ORYSJ | Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 | 375 | 616 | 2.0E-18 |
sp|Q6P1V3|WSB1_XENTR | WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 | 373 | 583 | 2.0E-18 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 381 | 602 | 2.0E-18 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 381 | 603 | 2.0E-18 |
sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 381 | 556 | 2.0E-18 |
sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 452 | 603 | 3.0E-18 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 381 | 530 | 3.0E-18 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 386 | 538 | 3.0E-18 |
sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 379 | 596 | 3.0E-18 |
sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 318 | 603 | 3.0E-18 |
sp|Q9AUR8|COPA1_ORYSJ | Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 | 375 | 613 | 3.0E-18 |
sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 366 | 603 | 3.0E-18 |
sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 375 | 616 | 3.0E-18 |
sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 381 | 595 | 3.0E-18 |
sp|Q6CJ50|MDV1_KLULA | Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 | 381 | 601 | 4.0E-18 |
sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 381 | 563 | 4.0E-18 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 381 | 602 | 4.0E-18 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 381 | 624 | 4.0E-18 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 381 | 602 | 4.0E-18 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 378 | 603 | 5.0E-18 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 381 | 620 | 5.0E-18 |
sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 381 | 597 | 5.0E-18 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 381 | 642 | 5.0E-18 |
sp|Q6BU94|PRP46_DEBHA | Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 | 369 | 603 | 5.0E-18 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 400 | 615 | 6.0E-18 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 440 | 607 | 6.0E-18 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 386 | 595 | 6.0E-18 |
sp|Q54R82|MKKA_DICDI | Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 | 400 | 595 | 6.0E-18 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 402 | 597 | 7.0E-18 |
sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 403 | 642 | 7.0E-18 |
sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 365 | 617 | 7.0E-18 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 377 | 551 | 8.0E-18 |
sp|Q758R7|MDV1_ASHGO | Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1 | 375 | 591 | 8.0E-18 |
sp|Q9AUR7|COPA2_ORYSJ | Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 | 375 | 613 | 8.0E-18 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 379 | 617 | 9.0E-18 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 378 | 603 | 9.0E-18 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 378 | 603 | 9.0E-18 |
sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 403 | 595 | 9.0E-18 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 365 | 617 | 9.0E-18 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 386 | 619 | 9.0E-18 |
sp|Q95RJ9|EBI_DROME | F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 | 375 | 559 | 9.0E-18 |
sp|A7THX0|MDV1_VANPO | Mitochondrial division protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDV1 PE=3 SV=1 | 379 | 592 | 1.0E-17 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 378 | 603 | 1.0E-17 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 378 | 603 | 1.0E-17 |
sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 382 | 620 | 1.0E-17 |
sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 382 | 620 | 1.0E-17 |
sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 377 | 591 | 1.0E-17 |
sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 377 | 591 | 1.0E-17 |
sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 381 | 617 | 1.0E-17 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 381 | 548 | 2.0E-17 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 421 | 613 | 2.0E-17 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 381 | 555 | 2.0E-17 |
sp|Q8RXA7|SCD1_ARATH | DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 | 386 | 596 | 2.0E-17 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 381 | 623 | 2.0E-17 |
sp|Q9AV81|PRP19_ORYSJ | Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 | 379 | 611 | 2.0E-17 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 376 | 628 | 2.0E-17 |
sp|Q54Y96|SMU1_DICDI | WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 | 381 | 604 | 2.0E-17 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 381 | 610 | 2.0E-17 |
sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 381 | 636 | 2.0E-17 |
sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 381 | 636 | 2.0E-17 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 381 | 617 | 2.0E-17 |
sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 349 | 558 | 2.0E-17 |
sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 401 | 577 | 2.0E-17 |
sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 403 | 642 | 2.0E-17 |
sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 349 | 558 | 2.0E-17 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 386 | 619 | 2.0E-17 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 258 | 548 | 2.0E-17 |
sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 379 | 605 | 2.0E-17 |
sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 381 | 594 | 3.0E-17 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 373 | 594 | 3.0E-17 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 381 | 595 | 3.0E-17 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 381 | 597 | 3.0E-17 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 386 | 578 | 3.0E-17 |
sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 382 | 602 | 3.0E-17 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 379 | 594 | 3.0E-17 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 389 | 613 | 3.0E-17 |
sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 365 | 617 | 3.0E-17 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 381 | 594 | 3.0E-17 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 377 | 591 | 3.0E-17 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 376 | 628 | 4.0E-17 |
sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 379 | 605 | 4.0E-17 |
sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 349 | 558 | 4.0E-17 |
sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 349 | 558 | 4.0E-17 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 377 | 591 | 4.0E-17 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 376 | 628 | 4.0E-17 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 376 | 628 | 4.0E-17 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 400 | 605 | 5.0E-17 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 401 | 606 | 5.0E-17 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 379 | 556 | 5.0E-17 |
sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 381 | 594 | 5.0E-17 |
sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 381 | 594 | 5.0E-17 |
sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 374 | 549 | 5.0E-17 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 379 | 596 | 5.0E-17 |
sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 379 | 558 | 5.0E-17 |
sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 382 | 607 | 5.0E-17 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 381 | 605 | 5.0E-17 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 377 | 591 | 5.0E-17 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 378 | 488 | 6.0E-17 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 381 | 598 | 6.0E-17 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 400 | 605 | 6.0E-17 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 378 | 603 | 6.0E-17 |
sp|Q9P7I3|MDV1_SCHPO | Mitochondrial division protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdv1 PE=3 SV=1 | 402 | 594 | 6.0E-17 |
sp|Q9CAA0|COB21_ARATH | Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 | 356 | 559 | 6.0E-17 |
sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 401 | 603 | 6.0E-17 |
sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 379 | 594 | 6.0E-17 |
sp|Q8MY12|MHCKC_DICDI | Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 | 424 | 598 | 6.0E-17 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 381 | 595 | 6.0E-17 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 381 | 595 | 6.0E-17 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 376 | 539 | 7.0E-17 |
sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 387 | 575 | 7.0E-17 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 381 | 598 | 7.0E-17 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 381 | 598 | 7.0E-17 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 403 | 599 | 7.0E-17 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 378 | 603 | 7.0E-17 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 378 | 603 | 7.0E-17 |
sp|Q9C827|COB22_ARATH | Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 | 363 | 559 | 7.0E-17 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 382 | 598 | 7.0E-17 |
sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 377 | 591 | 7.0E-17 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 376 | 539 | 8.0E-17 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 377 | 637 | 8.0E-17 |
sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 382 | 594 | 8.0E-17 |
sp|O15736|TIPD_DICDI | Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 | 379 | 608 | 8.0E-17 |
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 95 | 270 | 9.0E-17 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 377 | 637 | 9.0E-17 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 440 | 595 | 9.0E-17 |
sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 381 | 608 | 9.0E-17 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 386 | 557 | 9.0E-17 |
sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 401 | 577 | 9.0E-17 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 95 | 270 | 1.0E-16 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 397 | 607 | 1.0E-16 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 399 | 595 | 1.0E-16 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 378 | 603 | 1.0E-16 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 378 | 603 | 1.0E-16 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 382 | 597 | 1.0E-16 |
sp|Q9C1X0|YN55_SCHPO | Uncharacterized WD repeat-containing protein C713.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.05 PE=3 SV=1 | 459 | 605 | 1.0E-16 |
sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 403 | 642 | 1.0E-16 |
sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 365 | 625 | 1.0E-16 |
sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 377 | 591 | 1.0E-16 |
sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 377 | 591 | 1.0E-16 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 375 | 605 | 1.0E-16 |
sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 349 | 556 | 1.0E-16 |
sp|P25635|PWP2_YEAST | Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 | 381 | 605 | 1.0E-16 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 382 | 598 | 1.0E-16 |
sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 403 | 605 | 1.0E-16 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 381 | 594 | 2.0E-16 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 375 | 516 | 2.0E-16 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 375 | 517 | 2.0E-16 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 402 | 586 | 2.0E-16 |
sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 381 | 608 | 2.0E-16 |
sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 381 | 608 | 2.0E-16 |
sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 423 | 601 | 2.0E-16 |
sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 381 | 540 | 2.0E-16 |
sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 374 | 541 | 2.0E-16 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 403 | 603 | 2.0E-16 |
sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 382 | 624 | 2.0E-16 |
sp|P49026|GBLP_TOBAC | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 | 379 | 605 | 2.0E-16 |
sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 381 | 551 | 2.0E-16 |
sp|Q9SZQ5|VIP3_ARATH | WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 | 378 | 617 | 2.0E-16 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 377 | 591 | 2.0E-16 |
sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 381 | 617 | 2.0E-16 |
sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 403 | 642 | 2.0E-16 |
sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 403 | 642 | 2.0E-16 |
sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 403 | 642 | 2.0E-16 |
sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 403 | 642 | 2.0E-16 |
sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 403 | 642 | 2.0E-16 |
sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 403 | 642 | 2.0E-16 |
sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 403 | 642 | 2.0E-16 |
sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 377 | 591 | 2.0E-16 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 381 | 594 | 2.0E-16 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 382 | 598 | 2.0E-16 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 95 | 270 | 3.0E-16 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 375 | 516 | 3.0E-16 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 381 | 579 | 3.0E-16 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 403 | 602 | 3.0E-16 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 382 | 597 | 3.0E-16 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 377 | 594 | 3.0E-16 |
sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 377 | 591 | 3.0E-16 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 401 | 597 | 3.0E-16 |
sp|Q6H8D6|COB23_ORYSJ | Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 | 380 | 593 | 3.0E-16 |
sp|Q6CG48|LIS1_YARLI | Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 | 362 | 594 | 3.0E-16 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 382 | 597 | 3.0E-16 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 382 | 597 | 3.0E-16 |
sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 379 | 605 | 3.0E-16 |
sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 349 | 558 | 3.0E-16 |
sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 403 | 642 | 3.0E-16 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 459 | 639 | 4.0E-16 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 377 | 514 | 4.0E-16 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 380 | 594 | 4.0E-16 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 380 | 594 | 4.0E-16 |
sp|Q8MY12|MHCKC_DICDI | Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 | 381 | 594 | 4.0E-16 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 403 | 604 | 4.0E-16 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 382 | 621 | 4.0E-16 |
sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 381 | 617 | 4.0E-16 |
sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 381 | 617 | 4.0E-16 |
sp|Q6H8D5|COB22_ORYSJ | Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 | 363 | 593 | 4.0E-16 |
sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 381 | 558 | 4.0E-16 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 389 | 613 | 5.0E-16 |
sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 381 | 617 | 5.0E-16 |
sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 381 | 637 | 5.0E-16 |
sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 373 | 577 | 6.0E-16 |
sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 373 | 577 | 6.0E-16 |
sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 374 | 546 | 6.0E-16 |
sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 440 | 598 | 6.0E-16 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 381 | 559 | 6.0E-16 |
sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 381 | 559 | 6.0E-16 |
sp|Q6DH44|WDR83_DANRE | WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1 | 377 | 577 | 6.0E-16 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 213 | 508 | 7.0E-16 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 213 | 508 | 7.0E-16 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 380 | 594 | 7.0E-16 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 381 | 559 | 7.0E-16 |
sp|P91341|PWP2_CAEEL | Periodic tryptophan protein 2 homolog OS=Caenorhabditis elegans GN=F55F8.3 PE=3 SV=2 | 378 | 594 | 7.0E-16 |
sp|Q7T2F6|WSB1_DANRE | WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 | 373 | 552 | 7.0E-16 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 381 | 559 | 7.0E-16 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 389 | 613 | 7.0E-16 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 382 | 597 | 7.0E-16 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 377 | 577 | 8.0E-16 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 377 | 577 | 8.0E-16 |
sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 381 | 617 | 8.0E-16 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 381 | 559 | 8.0E-16 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 381 | 559 | 8.0E-16 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 381 | 595 | 8.0E-16 |
sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 374 | 542 | 9.0E-16 |
sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 381 | 595 | 9.0E-16 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 373 | 594 | 9.0E-16 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 423 | 643 | 1.0E-15 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 381 | 594 | 1.0E-15 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 375 | 517 | 1.0E-15 |
sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 401 | 617 | 1.0E-15 |
sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 401 | 617 | 1.0E-15 |
sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 399 | 597 | 1.0E-15 |
sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 401 | 597 | 1.0E-15 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 381 | 623 | 1.0E-15 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 381 | 579 | 1.0E-15 |
sp|Q5XGI5|WDR83_XENTR | WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 | 403 | 639 | 1.0E-15 |
sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 386 | 597 | 1.0E-15 |
sp|Q8SQS4|TAF5_ENCCU | Transcription initiation factor TFIID subunit 5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TAF5 PE=1 SV=1 | 376 | 533 | 1.0E-15 |
sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 365 | 625 | 1.0E-15 |
sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 374 | 550 | 1.0E-15 |
sp|Q94AD8|FBW3_ARATH | F-box/WD-40 repeat-containing protein At5g21040 OS=Arabidopsis thaliana GN=At5g21040 PE=2 SV=1 | 379 | 597 | 1.0E-15 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 401 | 603 | 2.0E-15 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 377 | 539 | 2.0E-15 |
sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 374 | 542 | 2.0E-15 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 379 | 586 | 2.0E-15 |
sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 379 | 566 | 2.0E-15 |
sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 379 | 566 | 2.0E-15 |
sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 379 | 549 | 2.0E-15 |
sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 379 | 549 | 2.0E-15 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 401 | 597 | 2.0E-15 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 401 | 597 | 2.0E-15 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 381 | 579 | 2.0E-15 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 381 | 579 | 2.0E-15 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 381 | 579 | 2.0E-15 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 381 | 579 | 2.0E-15 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 381 | 579 | 2.0E-15 |
sp|Q9Y6I7|WSB1_HUMAN | WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 | 373 | 583 | 2.0E-15 |
sp|P41811|COPB2_YEAST | Coatomer subunit beta' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC27 PE=1 SV=1 | 381 | 589 | 2.0E-15 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 382 | 620 | 2.0E-15 |
sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 403 | 605 | 2.0E-15 |
sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 381 | 606 | 2.0E-15 |
sp|A8Q2R5|WDR48_BRUMA | WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 | 380 | 577 | 2.0E-15 |
sp|P53699|CDC4_CANAX | Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 | 372 | 520 | 3.0E-15 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 379 | 599 | 3.0E-15 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 379 | 599 | 3.0E-15 |
sp|Q54R82|MKKA_DICDI | Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 | 380 | 594 | 3.0E-15 |
sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 401 | 617 | 3.0E-15 |
sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 374 | 550 | 3.0E-15 |
sp|Q6DH44|WDR83_DANRE | WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1 | 406 | 630 | 3.0E-15 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 381 | 579 | 3.0E-15 |
sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 373 | 595 | 3.0E-15 |
sp|P49027|GBLPA_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 | 381 | 605 | 3.0E-15 |
sp|O54929|WSB2_MOUSE | WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 | 365 | 551 | 3.0E-15 |
sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 349 | 558 | 3.0E-15 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 400 | 605 | 4.0E-15 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 379 | 546 | 4.0E-15 |
sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 381 | 578 | 4.0E-15 |
sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 381 | 578 | 4.0E-15 |
sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 423 | 620 | 4.0E-15 |
sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 381 | 580 | 4.0E-15 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 389 | 613 | 4.0E-15 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 400 | 639 | 4.0E-15 |
sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 381 | 610 | 4.0E-15 |
sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 349 | 558 | 4.0E-15 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 386 | 552 | 5.0E-15 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 386 | 552 | 5.0E-15 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 386 | 552 | 5.0E-15 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 401 | 617 | 5.0E-15 |
sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 386 | 605 | 5.0E-15 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 381 | 640 | 5.0E-15 |
sp|P36408|GBB_DICDI | Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 | 373 | 638 | 5.0E-15 |
sp|O35142|COPB2_RAT | Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 | 381 | 559 | 5.0E-15 |
sp|Q9DAJ4|WDR83_MOUSE | WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 | 400 | 639 | 5.0E-15 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 374 | 515 | 6.0E-15 |
sp|Q0V8J1|WSB2_BOVIN | WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 | 365 | 551 | 6.0E-15 |
sp|B6GZA1|SCONB_PENRW | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 | 379 | 637 | 7.0E-15 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 386 | 552 | 7.0E-15 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 379 | 546 | 7.0E-15 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 401 | 617 | 7.0E-15 |
sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 364 | 605 | 7.0E-15 |
sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 364 | 605 | 7.0E-15 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 388 | 621 | 7.0E-15 |
sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 364 | 605 | 7.0E-15 |
sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 364 | 605 | 7.0E-15 |
sp|Q6H8D6|COB23_ORYSJ | Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 | 391 | 619 | 7.0E-15 |
sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 402 | 602 | 7.0E-15 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 442 | 612 | 8.0E-15 |
sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 403 | 602 | 8.0E-15 |
sp|Q6FJS0|PFS2_CANGA | Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 | 365 | 594 | 8.0E-15 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 402 | 605 | 9.0E-15 |
sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 401 | 595 | 9.0E-15 |
sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 401 | 595 | 9.0E-15 |
sp|Q9SZQ5|VIP3_ARATH | WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 | 417 | 640 | 9.0E-15 |
sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 381 | 621 | 9.0E-15 |
sp|O62621|COPB2_DROME | Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 | 363 | 551 | 9.0E-15 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 374 | 515 | 1.0E-14 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 374 | 515 | 1.0E-14 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 402 | 605 | 1.0E-14 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 374 | 515 | 1.0E-14 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 373 | 528 | 1.0E-14 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 379 | 514 | 1.0E-14 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 379 | 549 | 1.0E-14 |
sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 346 | 598 | 1.0E-14 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 381 | 578 | 1.0E-14 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 381 | 578 | 1.0E-14 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 381 | 578 | 1.0E-14 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 386 | 620 | 1.0E-14 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 339 | 598 | 1.0E-14 |
sp|Q9NYS7|WSB2_HUMAN | WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 | 365 | 551 | 1.0E-14 |
sp|O94365|UTP15_SCHPO | U3 small nucleolar RNA-associated protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp15 PE=3 SV=1 | 421 | 595 | 1.0E-14 |
sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 394 | 597 | 1.0E-14 |
sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 374 | 594 | 1.0E-14 |
sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 394 | 597 | 1.0E-14 |
sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 374 | 594 | 1.0E-14 |
sp|Q3SZK1|AAMP_BOVIN | Angio-associated migratory cell protein OS=Bos taurus GN=AAMP PE=2 SV=1 | 375 | 625 | 1.0E-14 |
sp|Q9UTN4|PFS2_SCHPO | Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 | 400 | 594 | 1.0E-14 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 373 | 644 | 2.0E-14 |
sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 386 | 641 | 2.0E-14 |
sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 401 | 597 | 2.0E-14 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 401 | 617 | 2.0E-14 |
sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 381 | 578 | 2.0E-14 |
sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 381 | 578 | 2.0E-14 |
sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 381 | 578 | 2.0E-14 |
sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 374 | 542 | 2.0E-14 |
sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 391 | 619 | 2.0E-14 |
sp|Q6H8D5|COB22_ORYSJ | Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 | 391 | 619 | 2.0E-14 |
sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 403 | 595 | 2.0E-14 |
sp|Q25189|GBLP_HYDVU | Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 | 403 | 643 | 2.0E-14 |
sp|Q5DFU0|CIAO1_SCHJA | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 | 362 | 594 | 2.0E-14 |
sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 353 | 603 | 2.0E-14 |
sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 373 | 620 | 2.0E-14 |
sp|O14435|GBB_CRYPA | Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 | 381 | 514 | 2.0E-14 |
sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 379 | 542 | 2.0E-14 |
sp|Q7PS24|CIAO1_ANOGA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 | 400 | 594 | 2.0E-14 |
sp|Q9BRX9|WDR83_HUMAN | WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1 | 400 | 639 | 2.0E-14 |
sp|Q15269|PWP2_HUMAN | Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2 | 366 | 515 | 2.0E-14 |
sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 403 | 605 | 2.0E-14 |
sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 379 | 594 | 2.0E-14 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 399 | 606 | 3.0E-14 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 374 | 515 | 3.0E-14 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 403 | 602 | 3.0E-14 |
sp|A7TNS8|CAF4_VANPO | CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 | 379 | 593 | 3.0E-14 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 379 | 542 | 3.0E-14 |
sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 373 | 600 | 3.0E-14 |
sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 373 | 600 | 3.0E-14 |
sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 373 | 600 | 3.0E-14 |
sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 373 | 600 | 3.0E-14 |
sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 379 | 542 | 3.0E-14 |
sp|Q54SF9|MHCKD_DICDI | Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 | 382 | 600 | 3.0E-14 |
sp|Q9C0J8|WDR33_HUMAN | pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 | 386 | 548 | 3.0E-14 |
sp|Q6Q0C0|TRAF7_HUMAN | E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 | 384 | 514 | 3.0E-14 |
sp|Q13685|AAMP_HUMAN | Angio-associated migratory cell protein OS=Homo sapiens GN=AAMP PE=1 SV=2 | 375 | 625 | 3.0E-14 |
sp|P53699|CDC4_CANAX | Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 | 403 | 599 | 4.0E-14 |
sp|A8PTE4|MDV1_MALGO | Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 | 381 | 556 | 4.0E-14 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 401 | 603 | 4.0E-14 |
sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 381 | 595 | 4.0E-14 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 381 | 578 | 4.0E-14 |
sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 381 | 578 | 4.0E-14 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 376 | 594 | 4.0E-14 |
sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 364 | 605 | 4.0E-14 |
sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 386 | 610 | 4.0E-14 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 423 | 594 | 4.0E-14 |
sp|Q4I7X1|PFS2_GIBZE | Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 | 402 | 594 | 4.0E-14 |
sp|Q9C270|PWP2_NEUCR | Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 | 386 | 514 | 4.0E-14 |
sp|Q5RCG7|AAMP_PONAB | Angio-associated migratory cell protein OS=Pongo abelii GN=AAMP PE=2 SV=2 | 375 | 625 | 4.0E-14 |
sp|Q9H2Y7|ZN106_HUMAN | Zinc finger protein 106 OS=Homo sapiens GN=ZNF106 PE=1 SV=1 | 377 | 592 | 4.0E-14 |
sp|Q7YR70|AAMP_CANLF | Angio-associated migratory cell protein OS=Canis lupus familiaris GN=AAMP PE=3 SV=1 | 375 | 625 | 4.0E-14 |
sp|Q8W117|SMU1_ARATH | Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 | 348 | 539 | 4.0E-14 |
sp|Q27954|COPA_BOVIN | Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 | 379 | 560 | 4.0E-14 |
sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 401 | 603 | 4.0E-14 |
sp|P53621|COPA_HUMAN | Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 | 379 | 560 | 4.0E-14 |
sp|Q10282|GBB_SCHPO | Guanine nucleotide-binding protein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git5 PE=3 SV=2 | 375 | 514 | 4.0E-14 |
sp|Q8CIE6|COPA_MOUSE | Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 | 379 | 560 | 4.0E-14 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 399 | 606 | 5.0E-14 |
sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 418 | 620 | 5.0E-14 |
sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 381 | 578 | 5.0E-14 |
sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 394 | 597 | 5.0E-14 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 376 | 642 | 5.0E-14 |
sp|B0X2V9|WDR48_CULQU | WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 | 381 | 578 | 5.0E-14 |
sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 423 | 594 | 5.0E-14 |
sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 423 | 594 | 5.0E-14 |
sp|Q8K4P0|WDR33_MOUSE | pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 | 386 | 548 | 5.0E-14 |
sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 373 | 600 | 5.0E-14 |
sp|C7GWC1|LIS1_YEAS2 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain JAY291) GN=PAC1 PE=3 SV=1 | 400 | 594 | 5.0E-14 |
sp|Q20636|GBB2_CAEEL | Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 | 403 | 576 | 5.0E-14 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 403 | 605 | 6.0E-14 |
sp|Q5XX13|FBW10_HUMAN | F-box/WD repeat-containing protein 10 OS=Homo sapiens GN=FBXW10 PE=2 SV=2 | 381 | 528 | 6.0E-14 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 386 | 556 | 6.0E-14 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 381 | 573 | 6.0E-14 |
sp|O15736|TIPD_DICDI | Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 | 404 | 607 | 6.0E-14 |
sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 364 | 605 | 6.0E-14 |
sp|P49027|GBLPA_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 | 402 | 642 | 6.0E-14 |
sp|P0CS47|PFS2_CRYNB | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 | 400 | 594 | 6.0E-14 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 423 | 594 | 6.0E-14 |
sp|Q8WWQ0|PHIP_HUMAN | PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 | 443 | 594 | 6.0E-14 |
sp|Q8VDD9|PHIP_MOUSE | PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 | 443 | 594 | 6.0E-14 |
sp|Q922B6|TRAF7_MOUSE | E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 | 384 | 514 | 6.0E-14 |
sp|Q9I9H8|APAF_DANRE | Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 | 378 | 615 | 6.0E-14 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 381 | 561 | 7.0E-14 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 379 | 514 | 7.0E-14 |
sp|Q95RJ9|EBI_DROME | F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 | 373 | 605 | 7.0E-14 |
sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 401 | 603 | 7.0E-14 |
sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 402 | 594 | 7.0E-14 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 401 | 605 | 7.0E-14 |
sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 373 | 602 | 7.0E-14 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 382 | 607 | 7.0E-14 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 372 | 558 | 7.0E-14 |
sp|P0CS46|PFS2_CRYNJ | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 | 400 | 594 | 7.0E-14 |
sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 423 | 594 | 7.0E-14 |
sp|Q6FJ73|CIAO1_CANGA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 | 345 | 595 | 7.0E-14 |
sp|Q8BU03|PWP2_MOUSE | Periodic tryptophan protein 2 homolog OS=Mus musculus GN=Pwp2 PE=1 SV=1 | 366 | 515 | 7.0E-14 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 98 | 270 | 8.0E-14 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 418 | 620 | 8.0E-14 |
sp|O54927|WSB1_MOUSE | WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 | 373 | 552 | 8.0E-14 |
sp|O88466|ZN106_MOUSE | Zinc finger protein 106 OS=Mus musculus GN=Znf106 PE=1 SV=3 | 377 | 640 | 8.0E-14 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 355 | 475 | 9.0E-14 |
sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 376 | 595 | 9.0E-14 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 403 | 602 | 9.0E-14 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 391 | 619 | 9.0E-14 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 391 | 626 | 9.0E-14 |
sp|Q94AD8|FBW3_ARATH | F-box/WD-40 repeat-containing protein At5g21040 OS=Arabidopsis thaliana GN=At5g21040 PE=2 SV=1 | 398 | 597 | 9.0E-14 |
sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 379 | 594 | 9.0E-14 |
sp|A2AHJ4|BRWD3_MOUSE | Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=1 SV=1 | 443 | 594 | 9.0E-14 |
sp|Q6RI45|BRWD3_HUMAN | Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2 | 377 | 608 | 9.0E-14 |
sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 423 | 594 | 9.0E-14 |
sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 415 | 599 | 1.0E-13 |
sp|P07834|CDC4_YEAST | Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 | 403 | 595 | 1.0E-13 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 374 | 515 | 1.0E-13 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 355 | 475 | 1.0E-13 |
sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 442 | 605 | 1.0E-13 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 348 | 475 | 1.0E-13 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 355 | 475 | 1.0E-13 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 462 | 551 | 1.0E-13 |
sp|P36130|CAF4_YEAST | CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 | 379 | 594 | 1.0E-13 |
sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 386 | 556 | 1.0E-13 |
sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 386 | 556 | 1.0E-13 |
sp|Q7S8R5|MDV1_NEUCR | Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 | 381 | 551 | 1.0E-13 |
sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 418 | 620 | 1.0E-13 |
sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 379 | 557 | 1.0E-13 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 391 | 619 | 1.0E-13 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 391 | 619 | 1.0E-13 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 391 | 619 | 1.0E-13 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 374 | 514 | 1.0E-13 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 381 | 578 | 1.0E-13 |
sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 381 | 620 | 1.0E-13 |
sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 381 | 620 | 1.0E-13 |
sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 381 | 514 | 1.0E-13 |
sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 381 | 514 | 1.0E-13 |
sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 381 | 514 | 1.0E-13 |
sp|Q6RI45|BRWD3_HUMAN | Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2 | 443 | 594 | 1.0E-13 |
sp|Q9NSI6|BRWD1_HUMAN | Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 | 443 | 594 | 1.0E-13 |
sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 381 | 617 | 1.0E-13 |
sp|Q6BVZ3|PFS2_DEBHA | Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 | 391 | 594 | 1.0E-13 |
sp|Q921C3|BRWD1_MOUSE | Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 | 443 | 594 | 1.0E-13 |
sp|A7TMF9|YTM1_VANPO | Ribosome biogenesis protein YTM1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=YTM1 PE=3 SV=1 | 367 | 624 | 1.0E-13 |
sp|Q9Y263|PLAP_HUMAN | Phospholipase A-2-activating protein OS=Homo sapiens GN=PLAA PE=1 SV=2 | 362 | 578 | 1.0E-13 |
sp|Q5RFQ3|PWP2_PONAB | Periodic tryptophan protein 2 homolog OS=Pongo abelii GN=PWP2 PE=2 SV=1 | 366 | 515 | 1.0E-13 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 374 | 475 | 2.0E-13 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 374 | 475 | 2.0E-13 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 374 | 475 | 2.0E-13 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 374 | 475 | 2.0E-13 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 374 | 475 | 2.0E-13 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 374 | 475 | 2.0E-13 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 374 | 475 | 2.0E-13 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 374 | 475 | 2.0E-13 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 440 | 619 | 2.0E-13 |
sp|O95170|CDRT1_HUMAN | CMT1A duplicated region transcript 1 protein OS=Homo sapiens GN=CDRT1 PE=2 SV=3 | 375 | 528 | 2.0E-13 |
sp|B6GZA1|SCONB_PENRW | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 | 462 | 556 | 2.0E-13 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 403 | 605 | 2.0E-13 |
sp|A6ZZZ8|CAF4_YEAS7 | CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF4 PE=3 SV=2 | 379 | 594 | 2.0E-13 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 462 | 554 | 2.0E-13 |
sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 460 | 602 | 2.0E-13 |
sp|Q6P1V3|WSB1_XENTR | WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 | 365 | 560 | 2.0E-13 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 381 | 514 | 2.0E-13 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 418 | 620 | 2.0E-13 |
sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 332 | 595 | 2.0E-13 |
sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 401 | 560 | 2.0E-13 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 374 | 558 | 2.0E-13 |
sp|O54929|WSB2_MOUSE | WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 | 379 | 519 | 2.0E-13 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 381 | 514 | 2.0E-13 |
sp|A2AHJ4|BRWD3_MOUSE | Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=1 SV=1 | 377 | 608 | 2.0E-13 |
sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 381 | 514 | 2.0E-13 |
sp|B6K1G6|CFD1_SCHJY | Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 | 402 | 600 | 2.0E-13 |
sp|Q12024|YTM1_YEAST | Ribosome biogenesis protein YTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTM1 PE=1 SV=1 | 366 | 614 | 2.0E-13 |
sp|A6ZPA9|YTM1_YEAS7 | Ribosome biogenesis protein YTM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=YTM1 PE=3 SV=1 | 366 | 614 | 2.0E-13 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 386 | 556 | 3.0E-13 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 440 | 619 | 3.0E-13 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 379 | 594 | 3.0E-13 |
sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 381 | 569 | 3.0E-13 |
sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 381 | 557 | 3.0E-13 |
sp|Q7T2F6|WSB1_DANRE | WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 | 365 | 551 | 3.0E-13 |
sp|Q0V8J1|WSB2_BOVIN | WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 | 350 | 519 | 3.0E-13 |
sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 381 | 603 | 3.0E-13 |
sp|B3LJT5|LIS1_YEAS1 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PAC1 PE=3 SV=1 | 400 | 594 | 3.0E-13 |
sp|P39946|LIS1_YEAST | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAC1 PE=1 SV=2 | 400 | 594 | 3.0E-13 |
sp|A6ZPA6|LIS1_YEAS7 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PAC1 PE=3 SV=1 | 400 | 594 | 3.0E-13 |
sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 381 | 608 | 3.0E-13 |
sp|Q5ZME8|SMU1_CHICK | WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 | 329 | 521 | 3.0E-13 |
sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 373 | 596 | 3.0E-13 |
sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 373 | 596 | 3.0E-13 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 374 | 557 | 3.0E-13 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 374 | 556 | 3.0E-13 |
sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 373 | 596 | 3.0E-13 |
sp|O22785|PR19B_ARATH | Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 | 381 | 611 | 3.0E-13 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 293 | 524 | 3.0E-13 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 459 | 607 | 4.0E-13 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 381 | 514 | 4.0E-13 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 381 | 514 | 4.0E-13 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 382 | 515 | 4.0E-13 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 457 | 606 | 4.0E-13 |
sp|A8Q2R5|WDR48_BRUMA | WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 | 382 | 591 | 4.0E-13 |
sp|O35142|COPB2_RAT | Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 | 391 | 619 | 4.0E-13 |
sp|Q0V8J1|WSB2_BOVIN | WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 | 421 | 594 | 4.0E-13 |
sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 382 | 607 | 4.0E-13 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 381 | 514 | 4.0E-13 |
sp|Q9I9H8|APAF_DANRE | Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 | 389 | 603 | 4.0E-13 |
sp|Q6BVZ3|PFS2_DEBHA | Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 | 365 | 616 | 4.0E-13 |
sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 381 | 594 | 4.0E-13 |
sp|Q7ZVA0|SMU1_DANRE | WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 | 329 | 526 | 4.0E-13 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 428 | 640 | 5.0E-13 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 406 | 595 | 5.0E-13 |
sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 379 | 540 | 5.0E-13 |
sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 379 | 541 | 5.0E-13 |
sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 379 | 541 | 5.0E-13 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 379 | 514 | 5.0E-13 |
sp|Q5XGI5|WDR83_XENTR | WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 | 377 | 577 | 5.0E-13 |
sp|Q9NYS7|WSB2_HUMAN | WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 | 350 | 519 | 5.0E-13 |
sp|P27612|PLAP_MOUSE | Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 | 381 | 578 | 5.0E-13 |
sp|Q3UKJ7|SMU1_MOUSE | WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 | 329 | 521 | 5.0E-13 |
sp|Q2TAY7|SMU1_HUMAN | WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 | 329 | 521 | 5.0E-13 |
sp|Q76B40|SMU1_CRIGR | WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 | 329 | 521 | 5.0E-13 |
sp|Q2TBS9|SMU1_BOVIN | WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 | 329 | 521 | 5.0E-13 |
sp|Q99M63|SMU1_RAT | WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 | 329 | 521 | 5.0E-13 |
sp|A2RRU3|UTP15_RAT | U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 | 373 | 563 | 5.0E-13 |
sp|Q1DIW7|MDV1_COCIM | Mitochondrial division protein 1 OS=Coccidioides immitis (strain RS) GN=MDV1 PE=3 SV=2 | 381 | 551 | 6.0E-13 |
sp|Q9C827|COB22_ARATH | Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 | 389 | 621 | 6.0E-13 |
sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 379 | 599 | 6.0E-13 |
sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 379 | 599 | 6.0E-13 |
sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 379 | 599 | 6.0E-13 |
sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 379 | 599 | 6.0E-13 |
sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 379 | 599 | 6.0E-13 |
sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 379 | 599 | 6.0E-13 |
sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 379 | 599 | 6.0E-13 |
sp|C8ZH19|LIS1_YEAS8 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=PAC1 PE=3 SV=1 | 400 | 594 | 6.0E-13 |
sp|P54319|PLAP_RAT | Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 | 381 | 578 | 6.0E-13 |
sp|Q6NRT3|SMU1_XENLA | WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 | 329 | 521 | 6.0E-13 |
sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 373 | 596 | 6.0E-13 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 429 | 640 | 7.0E-13 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 379 | 539 | 7.0E-13 |
sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 462 | 556 | 7.0E-13 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 379 | 594 | 7.0E-13 |
sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 401 | 560 | 7.0E-13 |
sp|Q9CAA0|COB21_ARATH | Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 | 389 | 619 | 7.0E-13 |
sp|O54929|WSB2_MOUSE | WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 | 421 | 594 | 7.0E-13 |
sp|Q9BRX9|WDR83_HUMAN | WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1 | 377 | 577 | 7.0E-13 |
sp|B0XAF3|CIAO1_CULQU | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 | 400 | 600 | 7.0E-13 |
sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 373 | 596 | 7.0E-13 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 381 | 519 | 7.0E-13 |
sp|Q8C7V3|UTP15_MOUSE | U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 | 373 | 563 | 7.0E-13 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 423 | 642 | 8.0E-13 |
sp|Q9DAJ4|WDR83_MOUSE | WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 | 437 | 605 | 8.0E-13 |
sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 402 | 600 | 8.0E-13 |
sp|A7MB12|UTP15_BOVIN | U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 | 373 | 589 | 8.0E-13 |
sp|C5DF48|LIS1_LACTC | Nuclear distribution protein PAC1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=PAC1 PE=3 SV=1 | 387 | 591 | 8.0E-13 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 459 | 605 | 9.0E-13 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 400 | 637 | 9.0E-13 |
sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 391 | 621 | 9.0E-13 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 431 | 604 | 9.0E-13 |
sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 373 | 596 | 9.0E-13 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 459 | 605 | 1.0E-12 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 374 | 475 | 1.0E-12 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 462 | 556 | 1.0E-12 |
sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 406 | 595 | 1.0E-12 |
sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 406 | 595 | 1.0E-12 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 374 | 514 | 1.0E-12 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 374 | 514 | 1.0E-12 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 440 | 605 | 1.0E-12 |
sp|Q0V8J1|WSB2_BOVIN | WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 | 449 | 605 | 1.0E-12 |
sp|Q9NYS7|WSB2_HUMAN | WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 | 421 | 594 | 1.0E-12 |
sp|Q9NYS7|WSB2_HUMAN | WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 | 449 | 605 | 1.0E-12 |
sp|P53621|COPA_HUMAN | Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 | 388 | 594 | 1.0E-12 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 484 | 602 | 2.0E-12 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 379 | 517 | 2.0E-12 |
sp|Q0CJD8|MDV1_ASPTN | Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2 | 381 | 551 | 2.0E-12 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 374 | 514 | 2.0E-12 |
sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 330 | 599 | 2.0E-12 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 353 | 578 | 2.0E-12 |
sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 379 | 594 | 2.0E-12 |
sp|Q6DH44|WDR83_DANRE | WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1 | 440 | 605 | 2.0E-12 |
sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 374 | 541 | 2.0E-12 |
sp|Q9Y6I7|WSB1_HUMAN | WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 | 365 | 551 | 2.0E-12 |
sp|O54929|WSB2_MOUSE | WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 | 449 | 605 | 2.0E-12 |
sp|Q6Q0C0|TRAF7_HUMAN | E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 | 348 | 618 | 2.0E-12 |
sp|Q27954|COPA_BOVIN | Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 | 388 | 594 | 2.0E-12 |
sp|Q8CIE6|COPA_MOUSE | Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 | 388 | 594 | 2.0E-12 |
sp|B0X2V9|WDR48_CULQU | WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 | 424 | 615 | 2.0E-12 |
sp|Q922B6|TRAF7_MOUSE | E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 | 348 | 618 | 2.0E-12 |
sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 379 | 515 | 2.0E-12 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 386 | 514 | 3.0E-12 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 381 | 561 | 3.0E-12 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 379 | 514 | 3.0E-12 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 406 | 595 | 3.0E-12 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 406 | 595 | 3.0E-12 |
sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 377 | 543 | 3.0E-12 |
sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 401 | 595 | 3.0E-12 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 400 | 597 | 4.0E-12 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 381 | 504 | 4.0E-12 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 383 | 554 | 4.0E-12 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 379 | 514 | 4.0E-12 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 406 | 595 | 4.0E-12 |
sp|Q9C1X0|YN55_SCHPO | Uncharacterized WD repeat-containing protein C713.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.05 PE=3 SV=1 | 415 | 615 | 4.0E-12 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 377 | 577 | 4.0E-12 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 379 | 514 | 5.0E-12 |
sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 442 | 641 | 5.0E-12 |
sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 442 | 641 | 5.0E-12 |
sp|A4RJV3|MDV1_MAGO7 | Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 | 381 | 551 | 5.0E-12 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 353 | 578 | 5.0E-12 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 369 | 639 | 5.0E-12 |
sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 380 | 540 | 5.0E-12 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 442 | 641 | 6.0E-12 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 381 | 570 | 6.0E-12 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 317 | 539 | 6.0E-12 |
sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 379 | 599 | 6.0E-12 |
sp|Q54SF9|MHCKD_DICDI | Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 | 399 | 598 | 6.0E-12 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 405 | 605 | 6.0E-12 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 376 | 515 | 7.0E-12 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 403 | 605 | 7.0E-12 |
sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 400 | 597 | 7.0E-12 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 353 | 564 | 7.0E-12 |
sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 406 | 595 | 7.0E-12 |
sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 406 | 595 | 7.0E-12 |
sp|Q9DAJ4|WDR83_MOUSE | WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 | 377 | 577 | 7.0E-12 |
sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 400 | 597 | 8.0E-12 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 374 | 514 | 8.0E-12 |
sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 406 | 595 | 8.0E-12 |
sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 370 | 550 | 8.0E-12 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 82 | 171 | 9.0E-12 |
sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 406 | 615 | 9.0E-12 |
sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 406 | 615 | 9.0E-12 |
sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 379 | 515 | 9.0E-12 |
sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 379 | 515 | 9.0E-12 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 459 | 617 | 1.0E-11 |
sp|B6GZA1|SCONB_PENRW | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 | 381 | 597 | 1.0E-11 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 371 | 514 | 1.0E-11 |
sp|A1CBP8|MDV1_ASPCL | Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 | 381 | 551 | 1.0E-11 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 243 | 475 | 1.0E-11 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 375 | 515 | 1.0E-11 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 247 | 514 | 1.0E-11 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 353 | 552 | 1.0E-11 |
sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 377 | 482 | 1.0E-11 |
sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 377 | 482 | 1.0E-11 |
sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 382 | 515 | 1.0E-11 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 382 | 515 | 1.0E-11 |
sp|Q9C1X0|YN55_SCHPO | Uncharacterized WD repeat-containing protein C713.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.05 PE=3 SV=1 | 373 | 520 | 1.0E-11 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 406 | 615 | 1.0E-11 |
sp|Q6FJS0|PFS2_CANGA | Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 | 402 | 595 | 1.0E-11 |
sp|Q9BRX9|WDR83_HUMAN | WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1 | 437 | 605 | 1.0E-11 |
sp|Q10282|GBB_SCHPO | Guanine nucleotide-binding protein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git5 PE=3 SV=2 | 381 | 620 | 1.0E-11 |
sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 381 | 515 | 1.0E-11 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 459 | 607 | 2.0E-11 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 381 | 565 | 2.0E-11 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 381 | 548 | 2.0E-11 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 379 | 514 | 2.0E-11 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 379 | 594 | 2.0E-11 |
sp|Q6NNP0|ATG16_ARATH | Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 | 381 | 554 | 2.0E-11 |
sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 379 | 544 | 2.0E-11 |
sp|Q10051|PRP19_CAEEL | Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 | 452 | 607 | 2.0E-11 |
sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 375 | 539 | 2.0E-11 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 369 | 639 | 2.0E-11 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 423 | 548 | 2.0E-11 |
sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 379 | 515 | 2.0E-11 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 369 | 598 | 2.0E-11 |
sp|Q9C0J8|WDR33_HUMAN | pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 | 400 | 604 | 2.0E-11 |
sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 379 | 515 | 2.0E-11 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 82 | 171 | 3.0E-11 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 82 | 171 | 3.0E-11 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 82 | 171 | 3.0E-11 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 401 | 532 | 3.0E-11 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 401 | 532 | 3.0E-11 |
sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 442 | 641 | 3.0E-11 |
sp|A2R3Z3|MDV1_ASPNC | Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 | 381 | 634 | 3.0E-11 |
sp|Q2U5Z8|MDV1_ASPOR | Mitochondrial division protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdv1 PE=3 SV=2 | 381 | 601 | 3.0E-11 |
sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 382 | 515 | 3.0E-11 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 295 | 578 | 3.0E-11 |
sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 452 | 640 | 3.0E-11 |
sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 452 | 640 | 3.0E-11 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 369 | 639 | 3.0E-11 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 424 | 613 | 3.0E-11 |
sp|Q25189|GBLP_HYDVU | Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 | 347 | 594 | 3.0E-11 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 379 | 539 | 3.0E-11 |
sp|Q8K4P0|WDR33_MOUSE | pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 | 400 | 604 | 3.0E-11 |
sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 377 | 543 | 3.0E-11 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 401 | 595 | 3.0E-11 |
sp|O54927|WSB1_MOUSE | WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 | 365 | 551 | 3.0E-11 |
sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 386 | 602 | 3.0E-11 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 82 | 268 | 4.0E-11 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 340 | 475 | 4.0E-11 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 377 | 520 | 4.0E-11 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 366 | 551 | 4.0E-11 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 372 | 514 | 4.0E-11 |
sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 376 | 476 | 4.0E-11 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 382 | 515 | 4.0E-11 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 406 | 582 | 4.0E-11 |
sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 452 | 640 | 4.0E-11 |
sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 452 | 640 | 4.0E-11 |
sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 483 | 643 | 4.0E-11 |
sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 379 | 539 | 4.0E-11 |
sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 379 | 539 | 4.0E-11 |
sp|Q921C3|BRWD1_MOUSE | Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 | 377 | 608 | 4.0E-11 |
sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 377 | 543 | 4.0E-11 |
sp|A1DDL6|MDV1_NEOFI | Mitochondrial division protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdv1 PE=3 SV=1 | 381 | 551 | 5.0E-11 |
sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 400 | 597 | 5.0E-11 |
sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 418 | 582 | 5.0E-11 |
sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 373 | 514 | 5.0E-11 |
sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 439 | 640 | 5.0E-11 |
sp|Q8SQS4|TAF5_ENCCU | Transcription initiation factor TFIID subunit 5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TAF5 PE=1 SV=1 | 401 | 595 | 5.0E-11 |
sp|Q4WVS4|MDV1_ASPFU | Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 | 381 | 551 | 6.0E-11 |
sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 82 | 171 | 6.0E-11 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 402 | 624 | 6.0E-11 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 375 | 514 | 6.0E-11 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 379 | 546 | 6.0E-11 |
sp|Q9Y6I7|WSB1_HUMAN | WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 | 462 | 605 | 6.0E-11 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 379 | 539 | 6.0E-11 |
sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 82 | 171 | 7.0E-11 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 335 | 617 | 7.0E-11 |
sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 82 | 171 | 7.0E-11 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 351 | 475 | 7.0E-11 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 379 | 482 | 7.0E-11 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 379 | 482 | 7.0E-11 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 379 | 482 | 8.0E-11 |
sp|Q6P1V3|WSB1_XENTR | WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 | 462 | 605 | 8.0E-11 |
sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 379 | 539 | 8.0E-11 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 439 | 640 | 9.0E-11 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 375 | 555 | 9.0E-11 |
sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 436 | 600 | 9.0E-11 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 443 | 607 | 9.0E-11 |
sp|Q20636|GBB2_CAEEL | Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 | 460 | 596 | 9.0E-11 |
sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 379 | 539 | 9.0E-11 |
sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 377 | 543 | 9.0E-11 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 82 | 268 | 1.0E-10 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 396 | 606 | 1.0E-10 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 82 | 171 | 1.0E-10 |
sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 375 | 476 | 1.0E-10 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 379 | 531 | 1.0E-10 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 406 | 582 | 1.0E-10 |
sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 403 | 532 | 1.0E-10 |
sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 379 | 616 | 1.0E-10 |
sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 381 | 515 | 1.0E-10 |
sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 381 | 515 | 1.0E-10 |
sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 381 | 515 | 1.0E-10 |
sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 381 | 515 | 1.0E-10 |
sp|Q54SF9|MHCKD_DICDI | Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 | 382 | 515 | 1.0E-10 |
sp|Q9C0J8|WDR33_HUMAN | pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 | 381 | 639 | 1.0E-10 |
sp|O54927|WSB1_MOUSE | WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 | 462 | 605 | 1.0E-10 |
sp|Q9Y263|PLAP_HUMAN | Phospholipase A-2-activating protein OS=Homo sapiens GN=PLAA PE=1 SV=2 | 376 | 594 | 1.0E-10 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 406 | 605 | 1.0E-10 |
sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 381 | 515 | 1.0E-10 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 378 | 521 | 2.0E-10 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 381 | 514 | 2.0E-10 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 82 | 268 | 2.0E-10 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 82 | 171 | 2.0E-10 |
sp|Q7S8R5|MDV1_NEUCR | Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 | 479 | 616 | 2.0E-10 |
sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 436 | 600 | 2.0E-10 |
sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 307 | 468 | 2.0E-10 |
sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 307 | 468 | 2.0E-10 |
sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 382 | 515 | 2.0E-10 |
sp|Q9SZQ5|VIP3_ARATH | WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 | 370 | 563 | 2.0E-10 |
sp|Q5XGI5|WDR83_XENTR | WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 | 380 | 637 | 2.0E-10 |
sp|O94365|UTP15_SCHPO | U3 small nucleolar RNA-associated protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp15 PE=3 SV=1 | 379 | 563 | 2.0E-10 |
sp|Q54SF9|MHCKD_DICDI | Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 | 403 | 598 | 2.0E-10 |
sp|Q8K4P0|WDR33_MOUSE | pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 | 381 | 639 | 2.0E-10 |
sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 377 | 543 | 2.0E-10 |
sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 377 | 543 | 2.0E-10 |
sp|O22785|PR19B_ARATH | Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 | 410 | 605 | 2.0E-10 |
sp|A2RRU3|UTP15_RAT | U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1 | 400 | 605 | 2.0E-10 |
sp|P54319|PLAP_RAT | Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 | 376 | 594 | 2.0E-10 |
sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 377 | 543 | 2.0E-10 |
sp|A7ETB3|MDV1_SCLS1 | Mitochondrial division protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdv1 PE=3 SV=1 | 439 | 616 | 3.0E-10 |
sp|Q6FLI3|CAF4_CANGA | CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1 | 377 | 515 | 3.0E-10 |
sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 403 | 605 | 3.0E-10 |
sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 379 | 594 | 3.0E-10 |
sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 379 | 594 | 3.0E-10 |
sp|Q8WWQ0|PHIP_HUMAN | PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 | 377 | 608 | 3.0E-10 |
sp|Q9NSI6|BRWD1_HUMAN | Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 | 377 | 608 | 3.0E-10 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 372 | 540 | 4.0E-10 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 399 | 594 | 4.0E-10 |
sp|Q7T2F6|WSB1_DANRE | WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 | 427 | 605 | 4.0E-10 |
sp|O62621|COPB2_DROME | Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 | 410 | 621 | 4.0E-10 |
sp|A7MB12|UTP15_BOVIN | U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1 | 400 | 632 | 4.0E-10 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 381 | 477 | 5.0E-10 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 381 | 597 | 5.0E-10 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 372 | 540 | 5.0E-10 |
sp|Q8VDD9|PHIP_MOUSE | PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 | 377 | 608 | 5.0E-10 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 454 | 600 | 5.0E-10 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 372 | 540 | 6.0E-10 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 372 | 540 | 6.0E-10 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 372 | 540 | 6.0E-10 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 372 | 540 | 6.0E-10 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 406 | 582 | 6.0E-10 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 454 | 600 | 6.0E-10 |
sp|Q8C7V3|UTP15_MOUSE | U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1 | 400 | 605 | 6.0E-10 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 441 | 621 | 7.0E-10 |
sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 417 | 600 | 7.0E-10 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 372 | 540 | 7.0E-10 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 82 | 171 | 8.0E-10 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 307 | 468 | 8.0E-10 |
sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 307 | 468 | 8.0E-10 |
sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 483 | 613 | 8.0E-10 |
sp|O14435|GBB_CRYPA | Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 | 383 | 594 | 8.0E-10 |
sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 381 | 515 | 8.0E-10 |
sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 381 | 515 | 8.0E-10 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 473 | 620 | 8.0E-10 |
sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 377 | 543 | 8.0E-10 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 455 | 612 | 9.0E-10 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 411 | 600 | 9.0E-10 |
sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 307 | 468 | 9.0E-10 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 479 | 612 | 1.0E-09 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 479 | 612 | 1.0E-09 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 379 | 548 | 1.0E-09 |
sp|Q4WVS4|MDV1_ASPFU | Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 | 439 | 613 | 1.0E-09 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 377 | 477 | 1.0E-09 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 82 | 171 | 1.0E-09 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 439 | 640 | 1.0E-09 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 441 | 621 | 1.0E-09 |
sp|Q95RJ9|EBI_DROME | F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 | 402 | 620 | 1.0E-09 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 213 | 495 | 1.0E-09 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 307 | 468 | 1.0E-09 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 307 | 468 | 1.0E-09 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 307 | 468 | 1.0E-09 |
sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 307 | 468 | 1.0E-09 |
sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 307 | 468 | 1.0E-09 |
sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 307 | 468 | 1.0E-09 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 406 | 582 | 1.0E-09 |
sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 378 | 515 | 1.0E-09 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 372 | 540 | 1.0E-09 |
sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 382 | 515 | 1.0E-09 |
sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 379 | 515 | 1.0E-09 |
sp|Q6Q0C0|TRAF7_HUMAN | E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 | 387 | 551 | 1.0E-09 |
sp|Q7ZVA0|SMU1_DANRE | WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 | 401 | 556 | 1.0E-09 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 373 | 520 | 1.0E-09 |
sp|A8PTE4|MDV1_MALGO | Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 | 350 | 514 | 2.0E-09 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 366 | 498 | 2.0E-09 |
sp|Q9SZQ5|VIP3_ARATH | WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 | 355 | 515 | 2.0E-09 |
sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 402 | 620 | 2.0E-09 |
sp|P49027|GBLPA_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 | 379 | 601 | 2.0E-09 |
sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 402 | 620 | 2.0E-09 |
sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 445 | 600 | 2.0E-09 |
sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 402 | 620 | 2.0E-09 |
sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 377 | 543 | 2.0E-09 |
sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 377 | 543 | 2.0E-09 |
sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 377 | 543 | 2.0E-09 |
sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 377 | 543 | 2.0E-09 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 461 | 602 | 2.0E-09 |
sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 461 | 602 | 2.0E-09 |
sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 461 | 602 | 2.0E-09 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 461 | 602 | 2.0E-09 |
sp|Q8WWQ0|PHIP_HUMAN | PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 | 405 | 597 | 2.0E-09 |
sp|Q8VDD9|PHIP_MOUSE | PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 | 405 | 597 | 2.0E-09 |
sp|Q922B6|TRAF7_MOUSE | E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 | 387 | 551 | 2.0E-09 |
sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 461 | 602 | 2.0E-09 |
sp|P07834|CDC4_YEAST | Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 | 90 | 286 | 3.0E-09 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 423 | 602 | 3.0E-09 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 379 | 450 | 3.0E-09 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 399 | 586 | 3.0E-09 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 403 | 597 | 3.0E-09 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 403 | 597 | 3.0E-09 |
sp|B6GZA1|SCONB_PENRW | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 | 82 | 171 | 4.0E-09 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 423 | 514 | 4.0E-09 |
sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 485 | 620 | 4.0E-09 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 379 | 514 | 4.0E-09 |
sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 402 | 620 | 4.0E-09 |
sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 402 | 620 | 4.0E-09 |
sp|A8Q2R5|WDR48_BRUMA | WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 | 406 | 615 | 4.0E-09 |
sp|Q9UTN4|PFS2_SCHPO | Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 | 373 | 491 | 4.0E-09 |
sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 403 | 597 | 4.0E-09 |
sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 403 | 597 | 4.0E-09 |
sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 461 | 599 | 4.0E-09 |
sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 403 | 597 | 4.0E-09 |
sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 403 | 597 | 4.0E-09 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 473 | 620 | 4.0E-09 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 382 | 520 | 4.0E-09 |
sp|B0XAF3|CIAO1_CULQU | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 | 372 | 594 | 4.0E-09 |
sp|Q9AUR7|COPA2_ORYSJ | Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 | 407 | 557 | 5.0E-09 |
sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 379 | 594 | 5.0E-09 |
sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 379 | 594 | 5.0E-09 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 436 | 605 | 5.0E-09 |
sp|P0CS47|PFS2_CRYNB | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 | 373 | 497 | 5.0E-09 |
sp|P0CS46|PFS2_CRYNJ | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 | 373 | 497 | 5.0E-09 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 389 | 595 | 5.0E-09 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 440 | 603 | 6.0E-09 |
sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 436 | 605 | 7.0E-09 |
sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 436 | 605 | 7.0E-09 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 343 | 514 | 7.0E-09 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 373 | 514 | 7.0E-09 |
sp|Q6RI45|BRWD3_HUMAN | Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2 | 353 | 559 | 7.0E-09 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 479 | 612 | 8.0E-09 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 479 | 612 | 8.0E-09 |
sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 436 | 605 | 8.0E-09 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 443 | 607 | 8.0E-09 |
sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 402 | 617 | 8.0E-09 |
sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 402 | 617 | 8.0E-09 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 443 | 607 | 9.0E-09 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 374 | 475 | 9.0E-09 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 436 | 605 | 9.0E-09 |
sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 379 | 594 | 9.0E-09 |
sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 379 | 594 | 9.0E-09 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 376 | 474 | 1.0E-08 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 376 | 474 | 1.0E-08 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 519 | 644 | 1.0E-08 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 387 | 522 | 1.0E-08 |
sp|Q6FLI3|CAF4_CANGA | CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1 | 438 | 602 | 1.0E-08 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 259 | 475 | 1.0E-08 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 379 | 533 | 1.0E-08 |
sp|Q0J3D9|COPA3_ORYSJ | Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 | 407 | 556 | 1.0E-08 |
sp|Q9AUR8|COPA1_ORYSJ | Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 | 407 | 540 | 1.0E-08 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 403 | 605 | 1.0E-08 |
sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 379 | 594 | 1.0E-08 |
sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 373 | 514 | 1.0E-08 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 395 | 609 | 1.0E-08 |
sp|C5DF48|LIS1_LACTC | Nuclear distribution protein PAC1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=PAC1 PE=3 SV=1 | 377 | 554 | 1.0E-08 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 376 | 478 | 2.0E-08 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 480 | 612 | 2.0E-08 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 483 | 637 | 2.0E-08 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 375 | 630 | 2.0E-08 |
sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 407 | 556 | 2.0E-08 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 483 | 625 | 2.0E-08 |
sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 382 | 515 | 2.0E-08 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 343 | 514 | 2.0E-08 |
sp|Q27954|COPA_BOVIN | Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 | 407 | 557 | 2.0E-08 |
sp|Q8CIE6|COPA_MOUSE | Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 | 407 | 557 | 2.0E-08 |
sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 381 | 543 | 2.0E-08 |
sp|Q20636|GBB2_CAEEL | Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 | 379 | 539 | 2.0E-08 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 389 | 595 | 2.0E-08 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 381 | 540 | 2.0E-08 |
sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 182 | 445 | 3.0E-08 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 492 | 639 | 3.0E-08 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 423 | 514 | 3.0E-08 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 484 | 640 | 3.0E-08 |
sp|B6GZA1|SCONB_PENRW | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 | 517 | 644 | 3.0E-08 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 479 | 612 | 3.0E-08 |
sp|Q54R82|MKKA_DICDI | Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 | 380 | 477 | 3.0E-08 |
sp|A8PTE4|MDV1_MALGO | Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 | 435 | 602 | 4.0E-08 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 400 | 639 | 4.0E-08 |
sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 402 | 620 | 4.0E-08 |
sp|P53621|COPA_HUMAN | Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 | 407 | 557 | 4.0E-08 |
sp|Q20636|GBB2_CAEEL | Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2 | 381 | 514 | 4.0E-08 |
sp|Q9Y263|PLAP_HUMAN | Phospholipase A-2-activating protein OS=Homo sapiens GN=PLAA PE=1 SV=2 | 400 | 532 | 4.0E-08 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 378 | 475 | 4.0E-08 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 379 | 449 | 5.0E-08 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 91 | 171 | 5.0E-08 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 478 | 613 | 5.0E-08 |
sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 386 | 643 | 5.0E-08 |
sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 381 | 514 | 5.0E-08 |
sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 381 | 514 | 5.0E-08 |
sp|B0X2V9|WDR48_CULQU | WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 | 307 | 468 | 5.0E-08 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 485 | 625 | 6.0E-08 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 485 | 625 | 6.0E-08 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 485 | 625 | 6.0E-08 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 485 | 625 | 6.0E-08 |
sp|Q6FT96|MDV1_CANGA | Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 | 377 | 479 | 6.0E-08 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 377 | 522 | 6.0E-08 |
sp|Q8MY12|MHCKC_DICDI | Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 | 434 | 605 | 6.0E-08 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 238 | 515 | 6.0E-08 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 485 | 625 | 7.0E-08 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 82 | 171 | 7.0E-08 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 483 | 606 | 7.0E-08 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 483 | 606 | 7.0E-08 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 353 | 516 | 7.0E-08 |
sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 382 | 548 | 7.0E-08 |
sp|O94365|UTP15_SCHPO | U3 small nucleolar RNA-associated protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp15 PE=3 SV=1 | 377 | 549 | 7.0E-08 |
sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 405 | 640 | 7.0E-08 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 381 | 540 | 7.0E-08 |
sp|Q54SF9|MHCKD_DICDI | Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 | 377 | 551 | 8.0E-08 |
sp|P0CS47|PFS2_CRYNB | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 | 373 | 514 | 8.0E-08 |
sp|P27612|PLAP_MOUSE | Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 | 376 | 620 | 8.0E-08 |
sp|P54319|PLAP_RAT | Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 | 376 | 532 | 8.0E-08 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 405 | 643 | 9.0E-08 |
sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 479 | 612 | 9.0E-08 |
sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 445 | 600 | 9.0E-08 |
sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 407 | 556 | 9.0E-08 |
sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 379 | 594 | 9.0E-08 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 238 | 475 | 9.0E-08 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 441 | 617 | 1.0E-07 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 485 | 625 | 1.0E-07 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 333 | 474 | 1.0E-07 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 519 | 644 | 1.0E-07 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 462 | 602 | 1.0E-07 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 462 | 602 | 1.0E-07 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 462 | 602 | 1.0E-07 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 462 | 602 | 1.0E-07 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 462 | 612 | 1.0E-07 |
sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 444 | 599 | 1.0E-07 |
sp|Q4I7X1|PFS2_GIBZE | Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 | 381 | 511 | 1.0E-07 |
sp|P0CS46|PFS2_CRYNJ | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 | 373 | 514 | 1.0E-07 |
sp|Q5ZME8|SMU1_CHICK | WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 | 365 | 486 | 1.0E-07 |
sp|Q5ZME8|SMU1_CHICK | WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 | 405 | 551 | 1.0E-07 |
sp|Q3UKJ7|SMU1_MOUSE | WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 | 401 | 556 | 1.0E-07 |
sp|Q2TAY7|SMU1_HUMAN | WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 | 401 | 556 | 1.0E-07 |
sp|Q76B40|SMU1_CRIGR | WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 | 401 | 556 | 1.0E-07 |
sp|Q2TBS9|SMU1_BOVIN | WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 | 401 | 556 | 1.0E-07 |
sp|Q99M63|SMU1_RAT | WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 | 401 | 556 | 1.0E-07 |
sp|Q6NRT3|SMU1_XENLA | WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 | 401 | 556 | 1.0E-07 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 432 | 617 | 2.0E-07 |
sp|Q6CJ50|MDV1_KLULA | Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 | 477 | 599 | 2.0E-07 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 494 | 617 | 2.0E-07 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 371 | 474 | 2.0E-07 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 371 | 474 | 2.0E-07 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 423 | 513 | 2.0E-07 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 378 | 515 | 2.0E-07 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 462 | 612 | 2.0E-07 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 462 | 612 | 2.0E-07 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 221 | 514 | 2.0E-07 |
sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 379 | 540 | 2.0E-07 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 385 | 602 | 2.0E-07 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 385 | 602 | 2.0E-07 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 376 | 514 | 2.0E-07 |
sp|A8Q2R5|WDR48_BRUMA | WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 | 379 | 537 | 2.0E-07 |
sp|O14435|GBB_CRYPA | Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 | 403 | 597 | 2.0E-07 |
sp|Q3UKJ7|SMU1_MOUSE | WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 | 365 | 486 | 2.0E-07 |
sp|Q2TAY7|SMU1_HUMAN | WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 | 365 | 486 | 2.0E-07 |
sp|Q76B40|SMU1_CRIGR | WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 | 365 | 486 | 2.0E-07 |
sp|Q2TBS9|SMU1_BOVIN | WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 | 365 | 486 | 2.0E-07 |
sp|Q99M63|SMU1_RAT | WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 | 365 | 486 | 2.0E-07 |
sp|Q6NRT3|SMU1_XENLA | WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 | 365 | 486 | 2.0E-07 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 519 | 644 | 3.0E-07 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 305 | 474 | 3.0E-07 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 440 | 640 | 3.0E-07 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 317 | 473 | 3.0E-07 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 443 | 607 | 3.0E-07 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 358 | 457 | 3.0E-07 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 358 | 457 | 3.0E-07 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 358 | 457 | 3.0E-07 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 358 | 457 | 3.0E-07 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 358 | 457 | 3.0E-07 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 358 | 457 | 3.0E-07 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 366 | 457 | 3.0E-07 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 376 | 514 | 3.0E-07 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 381 | 468 | 3.0E-07 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 381 | 468 | 3.0E-07 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 381 | 468 | 3.0E-07 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 358 | 457 | 3.0E-07 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 381 | 468 | 3.0E-07 |
sp|Q6RI45|BRWD3_HUMAN | Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2 | 405 | 594 | 3.0E-07 |
sp|Q9NSI6|BRWD1_HUMAN | Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 | 405 | 594 | 3.0E-07 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 462 | 612 | 4.0E-07 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 436 | 600 | 4.0E-07 |
sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 377 | 515 | 4.0E-07 |
sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 377 | 561 | 4.0E-07 |
sp|A2AHJ4|BRWD3_MOUSE | Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=1 SV=1 | 405 | 594 | 4.0E-07 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 484 | 595 | 4.0E-07 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 462 | 612 | 5.0E-07 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 443 | 607 | 5.0E-07 |
sp|Q921C3|BRWD1_MOUSE | Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 | 405 | 594 | 5.0E-07 |
sp|B6K1G6|CFD1_SCHJY | Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 | 399 | 515 | 5.0E-07 |
sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 335 | 449 | 6.0E-07 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 376 | 473 | 6.0E-07 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 455 | 639 | 6.0E-07 |
sp|P25635|PWP2_YEAST | Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 | 389 | 551 | 6.0E-07 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 381 | 455 | 6.0E-07 |
sp|Q9DAJ4|WDR83_MOUSE | WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 | 349 | 617 | 6.0E-07 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 367 | 474 | 7.0E-07 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 307 | 476 | 7.0E-07 |
sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 376 | 517 | 7.0E-07 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 519 | 644 | 8.0E-07 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 423 | 513 | 9.0E-07 |
sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 462 | 600 | 9.0E-07 |
sp|C5DF48|LIS1_LACTC | Nuclear distribution protein PAC1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=PAC1 PE=3 SV=1 | 442 | 602 | 9.0E-07 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 376 | 478 | 1.0E-06 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 376 | 478 | 1.0E-06 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 376 | 478 | 1.0E-06 |
sp|Q54Y96|SMU1_DICDI | WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 | 462 | 609 | 1.0E-06 |
sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 389 | 555 | 1.0E-06 |
sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 441 | 600 | 1.0E-06 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 286 | 497 | 1.0E-06 |
sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 436 | 600 | 1.0E-06 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 455 | 639 | 1.0E-06 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 455 | 639 | 1.0E-06 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 384 | 617 | 1.0E-06 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 421 | 555 | 1.0E-06 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 482 | 597 | 2.0E-06 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 378 | 481 | 2.0E-06 |
sp|Q6FLI3|CAF4_CANGA | CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1 | 479 | 603 | 2.0E-06 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 462 | 612 | 2.0E-06 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 462 | 612 | 2.0E-06 |
sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 374 | 446 | 2.0E-06 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 376 | 514 | 2.0E-06 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 436 | 600 | 2.0E-06 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 436 | 595 | 2.0E-06 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 455 | 639 | 2.0E-06 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 455 | 639 | 2.0E-06 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 455 | 639 | 2.0E-06 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 455 | 639 | 2.0E-06 |
sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 373 | 468 | 2.0E-06 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 423 | 618 | 2.0E-06 |
sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 436 | 595 | 2.0E-06 |
sp|O35142|COPB2_RAT | Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 | 381 | 468 | 2.0E-06 |
sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 436 | 624 | 2.0E-06 |
sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 436 | 624 | 2.0E-06 |
sp|Q3SZK1|AAMP_BOVIN | Angio-associated migratory cell protein OS=Bos taurus GN=AAMP PE=2 SV=1 | 381 | 554 | 2.0E-06 |
sp|Q4I7X1|PFS2_GIBZE | Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 | 373 | 468 | 2.0E-06 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 492 | 639 | 3.0E-06 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 366 | 514 | 3.0E-06 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 379 | 640 | 3.0E-06 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 455 | 639 | 3.0E-06 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 408 | 618 | 3.0E-06 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 522 | 617 | 4.0E-06 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 408 | 618 | 4.0E-06 |
sp|Q9C270|PWP2_NEUCR | Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 | 406 | 559 | 4.0E-06 |
sp|C7GWC1|LIS1_YEAS2 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain JAY291) GN=PAC1 PE=3 SV=1 | 381 | 484 | 4.0E-06 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 376 | 474 | 5.0E-06 |
sp|O62621|COPB2_DROME | Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 | 381 | 434 | 5.0E-06 |
sp|B3LJT5|LIS1_YEAS1 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PAC1 PE=3 SV=1 | 381 | 484 | 5.0E-06 |
sp|P39946|LIS1_YEAST | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAC1 PE=1 SV=2 | 381 | 484 | 5.0E-06 |
sp|A6ZPA6|LIS1_YEAS7 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PAC1 PE=3 SV=1 | 381 | 484 | 5.0E-06 |
sp|O22785|PR19B_ARATH | Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 | 462 | 640 | 5.0E-06 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 367 | 480 | 6.0E-06 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 519 | 644 | 7.0E-06 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 477 | 643 | 7.0E-06 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 462 | 621 | 7.0E-06 |
sp|P25635|PWP2_YEAST | Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 | 392 | 559 | 7.0E-06 |
sp|Q9C270|PWP2_NEUCR | Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 | 389 | 548 | 8.0E-06 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 504 | 597 | 9.0E-06 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 377 | 518 | 1.0E-05 |
GO Term | Description | Terminal node |
---|---|---|
GO:0005515 | protein binding | Yes |
GO:0003674 | molecular_function | No |
GO:0005488 | binding | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 41 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Agabi119p4|089150 MTSLHRSSDDSARGTGYNDSPRIYPMTAHFAAPLQDMVHAQTRPSAQTLYMPIESPPTPAPSPGPTSTRPNSFPL DLASNHLFNTQDPLFRRQILVSILSSCTSSELLFISTTIAPMLKRDFLFWLPTELSLHILNYVDDPKSLVRASQV SKHWYRLVNEECVWRGLCHSHGFEDFDDDYPSPSVWREDFSYRRHYKLSHGIMRSWRHGGSLLQSHRLPIFNPDS GVVTSLALDRDWIVVGLANSKIQIFSATTGILSRTLVGHEMGVWAVCLVSKGGFMATPPDRDDDSYVHRRRRKDV NGLSSAVERLAISSTQEQYISPSLKVALGLDLDEANGSTSSRSSNGDEENHPQFPDDTSPGKRSDNSFASQGWGQ PNALAVSGGCDKVLRVWDIKTGYCIYVLSGHSSTIRCIRVLHNRPIAVSGSRDGTVRVWDIQRGRALRVLQGHQH SVRCLDVCGNKIVSGSYDTTCRLWDVDTGQCLHVLRGHYHEVYSVAFDGVRIASGGIDTTVRVWDAHTGSCVALL QGHTALVCQLQLSPSILATGGSDGRVITFDLSKYTVLHRIAAHDSSVTSLQFDKNFLVTGGNDGRVRLYDTKTGN YIRDFTDVSDTVWKVAYLKDTCAIMCRRAGMTAVEIWSMKPKST* |
Coding | >Agabi119p4|089150 ATGACCTCTCTGCATCGCTCGTCCGATGATTCTGCCAGAGGAACGGGCTACAATGACTCGCCCCGTATATATCCG ATGACCGCACACTTCGCCGCACCCTTACAAGACATGGTCCATGCACAGACGAGACCCTCTGCGCAGACGTTATAT ATGCCAATCGAATCACCACCTACCCCTGCCCCATCTCCTGGTCCGACCTCTACACGACCTAACTCGTTTCCTCTC GACTTGGCGAGCAACCACCTTTTTAACACTCAAGACCCCCTCTTTCGACGCCAAATTCTTGTTTCCATCTTGTCA TCATGTACATCCTCCGAACTCCTCTTTATTTCCACAACAATCGCTCCGATGTTAAAACGTGACTTCCTGTTTTGG CTGCCAACGGAGTTGTCGCTACACATATTGAATTATGTTGACGACCCGAAATCCCTTGTGAGAGCATCACAAGTG AGCAAGCATTGGTACAGGCTTGTGAACGAAGAATGTGTCTGGCGGGGGTTGTGCCATTCACATGGATTCGAAGAT TTCGACGACGATTATCCGAGTCCTAGTGTTTGGAGGGAAGATTTTTCCTATAGACGACACTATAAACTATCCCAT GGCATCATGAGGAGCTGGCGCCATGGTGGTTCGTTGCTACAATCCCATCGACTACCGATATTCAACCCGGATAGT GGAGTCGTTACATCCCTAGCGCTCGATCGTGACTGGATTGTGGTTGGACTTGCCAATTCCAAGATCCAAATCTTC AGTGCTACCACTGGAATTCTTTCGCGGACGCTCGTTGGACACGAGATGGGCGTGTGGGCGGTGTGCTTGGTGTCC AAAGGTGGTTTCATGGCTACACCACCTGATAGAGATGATGATTCGTACGTTCACCGAAGGAGGAGAAAAGATGTC AATGGATTGAGCTCTGCAGTCGAACGACTCGCTATCTCCTCTACTCAAGAGCAATATATATCCCCCTCTTTGAAA GTAGCGCTGGGACTCGATCTTGACGAGGCCAATGGATCAACCTCAAGTCGGTCATCTAATGGGGATGAAGAAAAC CATCCGCAATTTCCAGACGACACGTCCCCCGGAAAACGAAGTGATAATTCGTTCGCGTCCCAAGGATGGGGACAG CCAAACGCTTTAGCTGTGAGTGGAGGATGCGATAAAGTGTTGAGAGTCTGGGACATTAAGACAGGGTATTGCATT TACGTGCTTTCTGGACATAGCTCAACCATTCGGTGTATTCGTGTCCTGCACAATCGGCCGATCGCCGTATCAGGA TCGCGCGATGGCACTGTACGCGTTTGGGATATACAGCGCGGTAGAGCCTTGCGTGTCTTGCAAGGTCATCAACAT AGCGTTCGCTGCTTGGATGTCTGTGGTAATAAAATTGTCAGTGGCAGTTATGATACAACGTGCCGCCTTTGGGAC GTGGATACGGGGCAGTGCTTACATGTTCTTCGAGGTCACTATCATGAAGTTTATTCTGTCGCTTTTGATGGTGTC CGAATTGCATCTGGAGGTATTGACACGACGGTTCGCGTCTGGGACGCGCACACCGGGAGTTGCGTGGCATTACTC CAAGGCCACACCGCCCTCGTTTGTCAACTTCAACTTTCGCCATCCATCCTCGCAACAGGCGGTTCCGACGGTCGT GTCATCACATTCGACTTATCCAAATACACAGTCCTCCATCGTATAGCCGCCCACGACTCCTCTGTCACCTCTCTT CAATTCGACAAAAACTTCCTGGTGACGGGTGGGAATGATGGACGTGTGAGGTTGTATGATACTAAAACTGGGAAT TATATTCGTGATTTTACTGATGTGAGTGATACTGTTTGGAAGGTGGCGTATCTAAAGGATACTTGTGCCATTATG TGTCGGAGAGCTGGGATGACTGCTGTTGAGATTTGGAGCATGAAGCCCAAGAGTACATAA |
Transcript | >Agabi119p4|089150 ATGACCTCTCTGCATCGCTCGTCCGATGATTCTGCCAGAGGAACGGGCTACAATGACTCGCCCCGTATATATCCG ATGACCGCACACTTCGCCGCACCCTTACAAGACATGGTCCATGCACAGACGAGACCCTCTGCGCAGACGTTATAT ATGCCAATCGAATCACCACCTACCCCTGCCCCATCTCCTGGTCCGACCTCTACACGACCTAACTCGTTTCCTCTC GACTTGGCGAGCAACCACCTTTTTAACACTCAAGACCCCCTCTTTCGACGCCAAATTCTTGTTTCCATCTTGTCA TCATGTACATCCTCCGAACTCCTCTTTATTTCCACAACAATCGCTCCGATGTTAAAACGTGACTTCCTGTTTTGG CTGCCAACGGAGTTGTCGCTACACATATTGAATTATGTTGACGACCCGAAATCCCTTGTGAGAGCATCACAAGTG AGCAAGCATTGGTACAGGCTTGTGAACGAAGAATGTGTCTGGCGGGGGTTGTGCCATTCACATGGATTCGAAGAT TTCGACGACGATTATCCGAGTCCTAGTGTTTGGAGGGAAGATTTTTCCTATAGACGACACTATAAACTATCCCAT GGCATCATGAGGAGCTGGCGCCATGGTGGTTCGTTGCTACAATCCCATCGACTACCGATATTCAACCCGGATAGT GGAGTCGTTACATCCCTAGCGCTCGATCGTGACTGGATTGTGGTTGGACTTGCCAATTCCAAGATCCAAATCTTC AGTGCTACCACTGGAATTCTTTCGCGGACGCTCGTTGGACACGAGATGGGCGTGTGGGCGGTGTGCTTGGTGTCC AAAGGTGGTTTCATGGCTACACCACCTGATAGAGATGATGATTCGTACGTTCACCGAAGGAGGAGAAAAGATGTC AATGGATTGAGCTCTGCAGTCGAACGACTCGCTATCTCCTCTACTCAAGAGCAATATATATCCCCCTCTTTGAAA GTAGCGCTGGGACTCGATCTTGACGAGGCCAATGGATCAACCTCAAGTCGGTCATCTAATGGGGATGAAGAAAAC CATCCGCAATTTCCAGACGACACGTCCCCCGGAAAACGAAGTGATAATTCGTTCGCGTCCCAAGGATGGGGACAG CCAAACGCTTTAGCTGTGAGTGGAGGATGCGATAAAGTGTTGAGAGTCTGGGACATTAAGACAGGGTATTGCATT TACGTGCTTTCTGGACATAGCTCAACCATTCGGTGTATTCGTGTCCTGCACAATCGGCCGATCGCCGTATCAGGA TCGCGCGATGGCACTGTACGCGTTTGGGATATACAGCGCGGTAGAGCCTTGCGTGTCTTGCAAGGTCATCAACAT AGCGTTCGCTGCTTGGATGTCTGTGGTAATAAAATTGTCAGTGGCAGTTATGATACAACGTGCCGCCTTTGGGAC GTGGATACGGGGCAGTGCTTACATGTTCTTCGAGGTCACTATCATGAAGTTTATTCTGTCGCTTTTGATGGTGTC CGAATTGCATCTGGAGGTATTGACACGACGGTTCGCGTCTGGGACGCGCACACCGGGAGTTGCGTGGCATTACTC CAAGGCCACACCGCCCTCGTTTGTCAACTTCAACTTTCGCCATCCATCCTCGCAACAGGCGGTTCCGACGGTCGT GTCATCACATTCGACTTATCCAAATACACAGTCCTCCATCGTATAGCCGCCCACGACTCCTCTGTCACCTCTCTT CAATTCGACAAAAACTTCCTGGTGACGGGTGGGAATGATGGACGTGTGAGGTTGTATGATACTAAAACTGGGAAT TATATTCGTGATTTTACTGATGTGAGTGATACTGTTTGGAAGGTGGCGTATCTAAAGGATACTTGTGCCATTATG TGTCGGAGAGCTGGGATGACTGCTGTTGAGATTTGGAGCATGAAGCCCAAGAGTACATAA |
Gene | >Agabi119p4|089150 ATGACCTCTCTGCATCGCTCGTCCGATGATTCTGCCAGAGGAACGGGCTACAATGACTCGCCCCGTATATATCCG ATGACCGCACACTTCGCCGCACCCTTACAAGACATGGTCCATGCACAGACGAGACCCTCTGCGCAGACGTTATAT ATGCCAATCGAATCACCACCTACCCCTGCCCCATCTCCTGGTCCGACCTCTACACGACCTAACTCGTTTCCTCTC GACTTGGCGAGCAACCACCTTTTTAACACTCAAGACCCCCTCTTTCGACGCCAAATTCTTGTTTCCATCTTGTCA TCATGTACATCCTCCGAACTCCTCTTTATTTCCACAACAATCGCTCCGATGTTAAAACGTGACTTCCTGTTTTGG CTGCCAACGGAGTTGTCGCTACACATATTGAATTATGTTGACGACCCGAAATCCCTTGTGAGAGCATCACAAGTG AGCAAGCATTGGTACAGGCTTGTGAACGAAGAATGTGTCTGGCGGGGGTTGTGCCATTCACATGGATTCGAAGAT TTCGACGACGATTATCCGAGTCCTAGTGTTTGGAGGGAAGATTTTTCCTATAGACGACACTATAAACTATCCCAT GGCATCATGAGGAGCTGGCGCCATGGTGGTTCGTTGCTACAATCCCATCGACTACCGATATTCAACCCGGATAGT GGAGTCGTTACATCCCTAGCGCTCGATCGTGACTGGATTGTGGTTGGACTTGCCAATTCCAAGATCCAAATCTTC AGTGCTACCACTGGAATTCTTTCGCGGACGCTCGTTGGACACGAGATGGGCGTGTGGGCGGTGTGCTTGGTGTCC AAAGGTGGTTTCATGGCTACACCACCTGATAGAGATGATGATTCGTACGTTCACCGAAGGAGGAGAAAAGATGTC AATGGATTGAGCTCTGCAGTCGAACGACTCGCTATCTCCTCTACTCAAGAGCAATATATATCCCCCTCTTTGAAA GTAGCGCTGGGACTCGATCTTGACGAGGCCAATGGATCAACCTCAAGTCGGTCATCTAATGGGGATGAAGAAAAC CATCCGCAATTTCCAGACGACACGTCCCCCGGAAAACGAAGTGATAATTCGTTCGCGTCCCAAGGATGGGGACAG CCAAACGCTTTAGCTGTGAGTGGAGGATGCGATAAAGTGTTGAGAGTCTGGGACATTAAGACAGGGTAGGTGTTC CTGCGACGCTTCTTATTGTTTCTGATGATCGTGGCACAGGTATTGCATTTACGTGCTTTCTGGACATAGCTCAAC CATTCGGTGTATTCGTGTCCTGCACAATCGGCCGATCGCCGTATCAGGATCGCGCGATGGCACTGTACGCGTTTG GGATATACAGCGCGGTAGAGCCTTGCGTGTCTTGCAAGGTCATCAACATAGCGTTCGCTGCTTGGATGTCTGTGG TAATAAAATTGTCAGTGGCAGTTATGATACAACGTGCCGCGTAAGTTTTCTTATTGCATTTGTCGGGATATTTTT CTCATGCTCCTGTAGCTTTGGGACGTGGATACGGGGCAGTGCTTACATGTTCTTCGAGGTCACTATCATGAAGTT TATTCTGTCGCTTTTGATGGTGTCCGAATTGCATCTGGAGGTATTGACACGACGGTTCGCGTCTGGGACGCGCAC ACCGGGTAATATTCAAGCTCAGTTTTCATTTTGTGGTTTCTAACTTGTGATTTACAGGAGTTGCGTGGCATTACT CCAAGGCCACACCGCCCTCGTTTGTCAACTTCAACTTTCGCCATCCATCCTCGCAACAGGCGGTTCCGACGGTCG TGTCATCACATTCGACTTATCCAAATACACAGTCCTCCATCGTATAGCCGCCCACGACTCCTCTGTCACCTCTCT TCAATTCGACAAAAACTTCCTGGTGACGGGTGGGAATGATGGACGTGTGAGGTTGTATGATACTAAAACTGGGAA TTATATTCGTGATTTTACTGATGTGAGTGATACTGTTTGGAAGGTGGCGTATCTAAAGGATACTTGTGCCATTAT GTGTCGGAGAGCTGGGATGACTGCTGTTGAGATTTGGAGCATGAAGCCCAAGAGTACATAA |