Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|089110
Gene name
Locationscaffold_06:235974..241292
Strand+
Gene length (bp)5318
Transcript length (bp)4272
Coding sequence length (bp)4272
Protein length (aa) 1424

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15902 Sortilin-Vps10 Sortilin, neurotensin receptor 3, 1.4E-143 56 520
PF15902 Sortilin-Vps10 Sortilin, neurotensin receptor 3, 8.7E-138 725 1143
PF15901 Sortilin_C Sortilin, neurotensin receptor 3, C-terminal 8.6E-52 525 685
PF15901 Sortilin_C Sortilin, neurotensin receptor 3, C-terminal 1.7E-38 1145 1304

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0E2U2|VPS10_LACBS Vacuolar protein sorting/targeting protein 10 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=VPS10 PE=3 SV=1 20 1423 0.0E+00
sp|A8PE82|VPS10_COPC7 Vacuolar protein sorting/targeting protein 10 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=VPS10 PE=3 SV=2 4 1423 0.0E+00
sp|Q4P3I9|VPS10_USTMA Vacuolar protein sorting/targeting protein 10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=VPS10 PE=3 SV=2 18 1423 0.0E+00
sp|C5GVC6|VPS10_AJEDR Vacuolar protein sorting/targeting protein 10 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=VPS10 PE=3 SV=1 24 1409 0.0E+00
sp|C5JC96|VPS10_AJEDS Vacuolar protein sorting/targeting protein 10 OS=Ajellomyces dermatitidis (strain SLH14081) GN=VPS10 PE=3 SV=1 24 1409 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0E2U2|VPS10_LACBS Vacuolar protein sorting/targeting protein 10 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=VPS10 PE=3 SV=1 20 1423 0.0E+00
sp|A8PE82|VPS10_COPC7 Vacuolar protein sorting/targeting protein 10 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=VPS10 PE=3 SV=2 4 1423 0.0E+00
sp|Q4P3I9|VPS10_USTMA Vacuolar protein sorting/targeting protein 10 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=VPS10 PE=3 SV=2 18 1423 0.0E+00
sp|C5GVC6|VPS10_AJEDR Vacuolar protein sorting/targeting protein 10 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=VPS10 PE=3 SV=1 24 1409 0.0E+00
sp|C5JC96|VPS10_AJEDS Vacuolar protein sorting/targeting protein 10 OS=Ajellomyces dermatitidis (strain SLH14081) GN=VPS10 PE=3 SV=1 24 1409 0.0E+00
sp|C0NKP8|VPS10_AJECG Vacuolar protein sorting/targeting protein 10 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=VPS10 PE=3 SV=1 24 1409 0.0E+00
sp|C1GTA5|VPS10_PARBA Vacuolar protein sorting/targeting protein 10 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=VPS10 PE=3 SV=1 2 1359 0.0E+00
sp|C1FZI7|VPS10_PARBD Vacuolar protein sorting/targeting protein 10 OS=Paracoccidioides brasiliensis (strain Pb18) GN=VPS10 PE=3 SV=1 2 1415 0.0E+00
sp|C0S7J1|VPS10_PARBP Vacuolar protein sorting/targeting protein 10 OS=Paracoccidioides brasiliensis (strain Pb03) GN=VPS10 PE=3 SV=1 2 1415 0.0E+00
sp|Q4WBM1|VPS10_ASPFU Vacuolar protein sorting/targeting protein 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vps10 PE=3 SV=1 8 1405 0.0E+00
sp|B0YA89|VPS10_ASPFC Vacuolar protein sorting/targeting protein 10 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=vps10 PE=3 SV=1 8 1405 0.0E+00
sp|A1DAY6|VPS10_NEOFI Vacuolar protein sorting/targeting protein 10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=vps10 PE=3 SV=1 8 1405 0.0E+00
sp|Q2TVY7|VPS10_ASPOR Vacuolar protein sorting/targeting protein 10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vps10 PE=3 SV=1 29 1367 0.0E+00
sp|B8NX76|VPS10_ASPFN Vacuolar protein sorting/targeting protein 10 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=vps10 PE=3 SV=1 29 1367 0.0E+00
sp|Q0C7E3|VPS10_ASPTN Vacuolar protein sorting/targeting protein 10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=vps10 PE=3 SV=2 7 1405 0.0E+00
sp|A6QWZ2|VPS10_AJECN Vacuolar protein sorting/targeting protein 10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=VPS10 PE=3 SV=1 24 1409 0.0E+00
sp|C5P311|VPS10_COCP7 Vacuolar protein sorting/targeting protein 10 OS=Coccidioides posadasii (strain C735) GN=VPS10 PE=3 SV=2 17 1408 0.0E+00
sp|C4JI06|VPS10_UNCRE Vacuolar protein sorting/targeting protein 10 OS=Uncinocarpus reesii (strain UAMH 1704) GN=VPS10 PE=3 SV=1 24 1362 0.0E+00
sp|A2QHH4|VPS10_ASPNC Vacuolar protein sorting/targeting protein 10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=vps10 PE=3 SV=1 7 1405 0.0E+00
sp|Q0TVB2|VPS10_PHANO Vacuolar protein sorting/targeting protein 10 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VPS10 PE=3 SV=2 24 1353 0.0E+00
sp|E3QER5|VPS10_COLGM Vacuolar protein sorting/targeting protein 10 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=VPS10 PE=3 SV=1 5 1359 0.0E+00
sp|A4RF05|VPS10_MAGO7 Vacuolar protein sorting/targeting protein 10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VPS10 PE=3 SV=2 23 1396 0.0E+00
sp|B8MG72|VPS10_TALSN Vacuolar protein sorting/targeting protein 10 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=vps10 PE=3 SV=1 16 1409 0.0E+00
sp|A1C8D8|VPS10_ASPCL Vacuolar protein sorting/targeting protein 10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=vps10 PE=3 SV=1 18 1357 0.0E+00
sp|B6QMS8|VPS10_TALMQ Vacuolar protein sorting/targeting protein 10 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=vps10 PE=3 SV=1 16 1317 0.0E+00
sp|D4AQV3|VPS10_ARTBC Vacuolar protein sorting/targeting protein 10 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=VPS10 PE=3 SV=1 17 1409 0.0E+00
sp|D4D4B1|VPS10_TRIVH Vacuolar protein sorting/targeting protein 10 OS=Trichophyton verrucosum (strain HKI 0517) GN=VPS10 PE=3 SV=1 17 1409 0.0E+00
sp|E4UV76|VPS10_ARTGP Vacuolar protein sorting/targeting protein 10 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=VPS10 PE=3 SV=1 18 1353 0.0E+00
sp|B6H711|VPS10_PENRW Vacuolar protein sorting/targeting protein 10 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=vps10 PE=3 SV=1 18 1386 0.0E+00
sp|Q2HAB1|VPS10_CHAGB Vacuolar protein sorting/targeting protein 10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VPS10 PE=3 SV=1 6 1353 0.0E+00
sp|C6HAY7|VPS10_AJECH Vacuolar protein sorting/targeting protein 10 OS=Ajellomyces capsulatus (strain H143) GN=VPS10 PE=3 SV=1 24 1409 0.0E+00
sp|C5FYX2|VPS10_ARTOC Vacuolar protein sorting/targeting protein 10 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=VPS10 PE=3 SV=2 16 1353 0.0E+00
sp|C9SM62|VPS10_VERA1 Vacuolar protein sorting/targeting protein 10 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VPS10 PE=3 SV=1 6 1353 0.0E+00
sp|Q7SH60|VPS10_NEUCR Vacuolar protein sorting/targeting protein 10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vps10 PE=3 SV=1 24 1353 0.0E+00
sp|Q5AS50|VPS10_EMENI Vacuolar protein sorting/targeting protein 10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=vps10 PE=3 SV=1 7 1408 0.0E+00
sp|B5RU30|VPS10_DEBHA Vacuolar protein sorting/targeting protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VPS10 PE=3 SV=1 1 1417 0.0E+00
sp|O42930|VPS10_SCHPO Vacuolar protein sorting/targeting protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps10 PE=1 SV=1 5 1382 0.0E+00
sp|B9W9N8|VPS10_CANDC Vacuolar protein sorting/targeting protein 10 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=VPS10 PE=3 SV=1 1 1356 0.0E+00
sp|A5E1P1|VPS10_LODEL Vacuolar protein sorting/targeting protein 10 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=VPS10 PE=3 SV=1 9 1363 0.0E+00
sp|B6JY29|VPS10_SCHJY Vacuolar protein sorting/targeting protein 10 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=vps10 PE=3 SV=1 3 1423 0.0E+00
sp|C4Y3C1|VPS10_CLAL4 Vacuolar protein sorting/targeting protein 10 OS=Clavispora lusitaniae (strain ATCC 42720) GN=VPS10 PE=3 SV=1 6 1357 9.0E-163
sp|A6ZKT1|VPS10_YEAS7 Vacuolar protein sorting/targeting protein PEP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PEP1 PE=3 SV=1 5 1409 2.0E-154
sp|P32319|VPS10_YEAST Vacuolar protein sorting/targeting protein VPS10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP1 PE=1 SV=1 5 1409 2.0E-153
sp|C8ZAZ9|VTH2_YEAS8 VPS10 homolog 2 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=VTH2 PE=3 SV=2 41 1363 4.0E-153
sp|C8Z3X9|VPS10_YEAS8 Vacuolar protein sorting/targeting protein PEP1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=PEP1 PE=3 SV=1 5 1409 7.0E-151
sp|B3LNF5|VPS10_YEAS1 Vacuolar protein sorting/targeting protein PEP1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PEP1 PE=3 SV=1 5 1409 1.0E-150
sp|B5VDW2|VPS10_YEAS6 Vacuolar protein sorting/targeting protein PEP1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=PEP1 PE=3 SV=1 5 1409 1.0E-150
sp|C7GX93|VPS10_YEAS2 Vacuolar protein sorting/targeting protein PEP1 OS=Saccharomyces cerevisiae (strain JAY291) GN=PEP1 PE=3 SV=1 5 1409 1.0E-150
sp|A7TT43|VPS10_VANPO Vacuolar protein sorting/targeting protein 10 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=VPS10 PE=3 SV=1 38 1313 2.0E-150
sp|P40438|VTH1_YEAST VPS10 homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTH1 PE=1 SV=1 1 1363 8.0E-149
sp|P40890|VTH2_YEAST VPS10 homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTH2 PE=1 SV=1 1 1363 1.0E-148
sp|C4R192|VPS10_PICPG Vacuolar protein sorting/targeting protein 10 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=VPS10 PE=3 SV=1 39 1423 1.0E-147
sp|E4ZVX1|VPS10_LEPMJ Vacuolar protein sorting/targeting protein 10 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=VPS10 PE=3 SV=2 744 1353 4.0E-145
sp|C4YG73|VPS10_CANAW Vacuolar protein sorting/targeting protein 10 OS=Candida albicans (strain WO-1) GN=VPS10 PE=3 SV=1 1 1356 3.0E-143
sp|B2WDP9|VPS10_PYRTR Vacuolar protein sorting/targeting protein 10 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=vps10 PE=3 SV=1 748 1386 3.0E-141
sp|Q6CNR4|VPS10_KLULA Vacuolar protein sorting/targeting protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VPS10 PE=3 SV=1 378 1394 1.0E-140
sp|B2WDP9|VPS10_PYRTR Vacuolar protein sorting/targeting protein 10 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=vps10 PE=3 SV=1 23 707 2.0E-140
sp|C5DU19|VPS10_ZYGRC Vacuolar protein sorting/targeting protein 10 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=VPS10 PE=3 SV=1 1 1356 3.0E-140
sp|E3RE00|VPS10_PYRTT Vacuolar protein sorting/targeting protein 10 OS=Pyrenophora teres f. teres (strain 0-1) GN=vps10 PE=3 SV=1 748 1386 7.0E-139
sp|E3RE00|VPS10_PYRTT Vacuolar protein sorting/targeting protein 10 OS=Pyrenophora teres f. teres (strain 0-1) GN=vps10 PE=3 SV=1 23 707 3.0E-136
sp|E4ZVX1|VPS10_LEPMJ Vacuolar protein sorting/targeting protein 10 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=VPS10 PE=3 SV=2 17 701 6.0E-136
sp|P53751|YN94_YEAST Uncharacterized membrane glycoprotein YNR065C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR065C PE=4 SV=1 440 1422 3.0E-133
sp|Q6FPF1|VPS10_CANGA Vacuolar protein sorting/targeting protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VPS10 PE=3 SV=1 24 1317 4.0E-131
sp|Q754Q4|VPS10_ASHGO Vacuolar protein sorting/targeting protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VPS10 PE=3 SV=2 41 1375 6.0E-130
sp|C7YGZ0|VPS10_NECH7 Vacuolar protein sorting/targeting protein 10 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=VPS10 PE=3 SV=1 4 685 6.0E-129
sp|D1Z9Q3|VPS10_SORMK Vacuolar protein sorting/targeting protein 10 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=vps10 PE=3 SV=2 24 685 4.0E-128
sp|C7YGZ0|VPS10_NECH7 Vacuolar protein sorting/targeting protein 10 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=VPS10 PE=3 SV=1 705 1362 5.0E-108
sp|D1Z9Q3|VPS10_SORMK Vacuolar protein sorting/targeting protein 10 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=vps10 PE=3 SV=2 732 1353 2.0E-100
sp|P53751|YN94_YEAST Uncharacterized membrane glycoprotein YNR065C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR065C PE=4 SV=1 55 728 7.0E-91
sp|E4ZVX1|VPS10_LEPMJ Vacuolar protein sorting/targeting protein 10 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=VPS10 PE=3 SV=2 43 673 7.0E-87
sp|A7TT43|VPS10_VANPO Vacuolar protein sorting/targeting protein 10 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=VPS10 PE=3 SV=1 31 675 7.0E-83
sp|B2WDP9|VPS10_PYRTR Vacuolar protein sorting/targeting protein 10 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=vps10 PE=3 SV=1 54 679 4.0E-81
sp|Q6CNR4|VPS10_KLULA Vacuolar protein sorting/targeting protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VPS10 PE=3 SV=1 57 675 2.0E-80
sp|E3RE00|VPS10_PYRTT Vacuolar protein sorting/targeting protein 10 OS=Pyrenophora teres f. teres (strain 0-1) GN=vps10 PE=3 SV=1 43 679 4.0E-80
sp|C7YGZ0|VPS10_NECH7 Vacuolar protein sorting/targeting protein 10 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=VPS10 PE=3 SV=1 54 679 1.0E-72
sp|D1Z9Q3|VPS10_SORMK Vacuolar protein sorting/targeting protein 10 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=vps10 PE=3 SV=2 55 674 4.0E-71
sp|E4ZVX1|VPS10_LEPMJ Vacuolar protein sorting/targeting protein 10 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=VPS10 PE=3 SV=2 725 1347 2.0E-60
sp|B2WDP9|VPS10_PYRTR Vacuolar protein sorting/targeting protein 10 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=vps10 PE=3 SV=1 726 1311 4.0E-60
sp|C7YGZ0|VPS10_NECH7 Vacuolar protein sorting/targeting protein 10 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=VPS10 PE=3 SV=1 734 1298 4.0E-60
sp|E3RE00|VPS10_PYRTT Vacuolar protein sorting/targeting protein 10 OS=Pyrenophora teres f. teres (strain 0-1) GN=vps10 PE=3 SV=1 726 1311 6.0E-59
sp|B6QMS8|VPS10_TALMQ Vacuolar protein sorting/targeting protein 10 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=vps10 PE=3 SV=1 726 1349 3.0E-58
sp|D1Z9Q3|VPS10_SORMK Vacuolar protein sorting/targeting protein 10 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=vps10 PE=3 SV=2 734 1298 6.0E-57
sp|Q98930|SORL_CHICK Sortilin-related receptor (Fragment) OS=Gallus gallus GN=SORL1 PE=2 SV=1 214 717 3.0E-44
sp|Q95209|SORL_RABIT Sortilin-related receptor OS=Oryctolagus cuniculus GN=SORL1 PE=2 SV=1 215 674 6.0E-42
sp|Q92673|SORL_HUMAN Sortilin-related receptor OS=Homo sapiens GN=SORL1 PE=1 SV=2 215 674 6.0E-42
sp|O88307|SORL_MOUSE Sortilin-related receptor OS=Mus musculus GN=Sorl1 PE=1 SV=3 215 674 1.0E-41
sp|Q8VI51|SORC3_MOUSE VPS10 domain-containing receptor SorCS3 OS=Mus musculus GN=Sorcs3 PE=1 SV=1 321 692 4.0E-40
sp|Q96PQ0|SORC2_HUMAN VPS10 domain-containing receptor SorCS2 OS=Homo sapiens GN=SORCS2 PE=1 SV=3 321 692 4.0E-39
sp|Q98930|SORL_CHICK Sortilin-related receptor (Fragment) OS=Gallus gallus GN=SORL1 PE=2 SV=1 797 1297 6.0E-38
sp|Q9EPR5|SORC2_MOUSE VPS10 domain-containing receptor SorCS2 OS=Mus musculus GN=Sorcs2 PE=1 SV=2 329 690 7.0E-38
sp|Q9UPU3|SORC3_HUMAN VPS10 domain-containing receptor SorCS3 OS=Homo sapiens GN=SORCS3 PE=2 SV=2 321 692 2.0E-37
sp|Q8WY21|SORC1_HUMAN VPS10 domain-containing receptor SorCS1 OS=Homo sapiens GN=SORCS1 PE=1 SV=3 321 692 6.0E-36
sp|Q95209|SORL_RABIT Sortilin-related receptor OS=Oryctolagus cuniculus GN=SORL1 PE=2 SV=1 797 1297 7.0E-36
sp|Q9JLC4|SORC1_MOUSE VPS10 domain-containing receptor SorCS1 OS=Mus musculus GN=Sorcs1 PE=1 SV=1 321 692 8.0E-35
sp|O88307|SORL_MOUSE Sortilin-related receptor OS=Mus musculus GN=Sorl1 PE=1 SV=3 797 1297 2.0E-34
sp|Q6PHU5|SORT_MOUSE Sortilin OS=Mus musculus GN=Sort1 PE=1 SV=1 212 728 3.0E-34
sp|Q92673|SORL_HUMAN Sortilin-related receptor OS=Homo sapiens GN=SORL1 PE=1 SV=2 797 1297 4.0E-34
sp|Q99523|SORT_HUMAN Sortilin OS=Homo sapiens GN=SORT1 PE=1 SV=3 212 728 4.0E-34
sp|O54861|SORT_RAT Sortilin OS=Rattus norvegicus GN=Sort1 PE=1 SV=3 212 728 3.0E-33
sp|Q6NUT7|SORT1_DANRE Sortilin OS=Danio rerio GN=sort1 PE=2 SV=1 91 739 1.0E-32
sp|Q6PHU5|SORT_MOUSE Sortilin OS=Mus musculus GN=Sort1 PE=1 SV=1 793 1298 2.0E-32
sp|O54861|SORT_RAT Sortilin OS=Rattus norvegicus GN=Sort1 PE=1 SV=3 793 1298 4.0E-32
sp|Q99523|SORT_HUMAN Sortilin OS=Homo sapiens GN=SORT1 PE=1 SV=3 793 1298 1.0E-31
sp|Q6NUT7|SORT1_DANRE Sortilin OS=Danio rerio GN=sort1 PE=2 SV=1 724 1298 2.0E-31
sp|Q8WY21|SORC1_HUMAN VPS10 domain-containing receptor SorCS1 OS=Homo sapiens GN=SORCS1 PE=1 SV=3 942 1318 6.0E-31
sp|Q8VI51|SORC3_MOUSE VPS10 domain-containing receptor SorCS3 OS=Mus musculus GN=Sorcs3 PE=1 SV=1 942 1318 4.0E-29
sp|Q9JLC4|SORC1_MOUSE VPS10 domain-containing receptor SorCS1 OS=Mus musculus GN=Sorcs1 PE=1 SV=1 942 1318 1.0E-28
sp|Q9UPU3|SORC3_HUMAN VPS10 domain-containing receptor SorCS3 OS=Homo sapiens GN=SORCS3 PE=2 SV=2 942 1318 6.0E-28
sp|Q96PQ0|SORC2_HUMAN VPS10 domain-containing receptor SorCS2 OS=Homo sapiens GN=SORCS2 PE=1 SV=3 942 1318 4.0E-23
sp|Q9EPR5|SORC2_MOUSE VPS10 domain-containing receptor SorCS2 OS=Mus musculus GN=Sorcs2 PE=1 SV=2 942 1318 9.0E-23
sp|P25606|YCZ0_YEAST Uncharacterized protein YCR100C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR100C PE=4 SV=1 269 559 8.0E-16
sp|P53752|YN95_YEAST Uncharacterized membrane glycoprotein YNR066C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR066C PE=4 SV=1 41 422 3.0E-13
sp|Q6CNR4|VPS10_KLULA Vacuolar protein sorting/targeting protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VPS10 PE=3 SV=1 995 1261 4.0E-11
sp|P25657|YCY9_YEAST Uncharacterized protein YCR099C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR099C PE=4 SV=1 552 676 3.0E-10
sp|P25606|YCZ0_YEAST Uncharacterized protein YCR100C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR100C PE=4 SV=1 1000 1158 6.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 1319 1341 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|089110
MRCYYALWLALMAFVGFATGQSDPTHQITHFDNPPARLFFFDDTNSVIYHDSFEGNVHVSEDEGKTWELADIPQG
QVDRVVEHPFNNRIAFILTAGTTHYRTEDKGRTWRSFKTPIAPARVQQPLSFHSDPDKNGYILFQGGICDRMGWS
AVCHDETFYTTDAFSSDVKKLLSDTSRCQFAHSSKDFKHDAHPDLVYCVAYDTPASAGGRTLESSRLYSSTDFFA
SDKNIEDLGLKRNSRGVVALAIVSKYAIVAMKDVSEASDGEMLLYVTIDTKTWAKAQFPHASSARLRENAYTIVE
STTHSLGVDVLLHDSGAIGTLFLSNSNGTFFVESLKDTNRNEIGFVDYEKVYGVDGVGIANIVDNVKDVESRMAD
KLLKSRITYNDGRTWSPIKPPTQDYEGKPIDCDPSDGERCSLHLYSVTTPHNYGRIFSSPAPGIVMGVGSIGQHL
KPYTDCDTFLSIDAGITWQMVRRDAHKYEFGDQGSILVVVNDEEVTDEIRYSLDLGKTWKTYNLGQKFIAQALVT
LPDSTSQKFLLLGSIPKGERTKESGRIVVIYLDFQPTRGRKCEDDDFEKWYARKDDSECIMGHKQWYTRRKPDAQ
CYVGKKYMDPVEHDENCPCSDDDYECDYNFILQDSKCVAAGPEPIPAGVCEGSRRTFLGSSGYRKIPGNTCSGGM
KKDEKVEKDCSKAEPPRVKPYTRSMTSNRKLFSTPISRSLLLFSFVYMTILFGNQAEFFFTTNFGQDWHTGHAPT
PPNTFNAQVIRFHPTNSDSIIWVGNLDCGEFTSPTCRAEAKYSLNNGRTWERVDDYVKNCAWARDTFLEADPTEI
ICESYKDKQGSQRNMGGPGSHLQLVAGAGYYKRKKALFTNVVGFAKFSEFLVVAELHPERRVLELQVSLDGNHFA
SGQFPPTMHPSGHAYTVLESNTHSLFLHMTMSEPPEAPFWGNILKSNSNGTYFGLSAEYVNRNQDGYVDFEKLIG
LDGVALVNVVADPGQATVTGRKNLQSRITHNDGATWKPLTPPARDSLGQKYECDTTKCALHIHGYTERRDPRATY
SSPGVVGLLLAVGNVGETLKPYVDSNTFLSRDAGFTWEEIHKDAYMWEFGDSGSILVIVNDEGPTDRVLYSTDEG
LNWREYRFSDEKIRVDSIVTVPEDTSRRFILFGSRLRAPGSVAVHLDFSALTKKRCVYNPDKPNDDDFELWSPSI
EREEICLFGRQTLYHRRAREANCIVGDKAKVPEKLIQNCPCSAVDFECEFNHLRNAEGDCVLVPGTQPLPDDLAE
CESGSEYWYERTAYRIIPYSSCESDYRLDRGARHVCPGFKSKGPLFWFFVLLLPFAFTALVGYYYYRRGGHVRGN
IRLPGDLSSSSDGKFQRALDTAASVPWFLIGLAHIAIQWVTSRVDVSNLRSRRGYRNVPIDEDAQILRFEDEE*
Coding >Agabi119p4|089110
ATGAGGTGCTATTATGCATTATGGCTGGCTCTAATGGCCTTCGTTGGCTTCGCCACCGGCCAGTCCGACCCCACA
CATCAGATCACCCACTTTGACAATCCGCCAGCTCGCTTATTTTTTTTCGACGATACTAATTCAGTGATATATCAT
GATTCATTCGAGGGAAACGTTCACGTCTCGGAAGATGAGGGCAAAACATGGGAGTTGGCTGATATACCTCAAGGC
CAAGTAGACAGAGTCGTCGAACACCCGTTTAATAACCGCATTGCATTCATCTTGACTGCTGGCACTACACATTAC
CGCACCGAAGACAAGGGCCGGACATGGCGGTCTTTCAAAACTCCAATAGCTCCAGCGCGCGTTCAGCAGCCACTC
TCCTTTCATTCTGACCCGGATAAAAACGGCTATATTTTGTTCCAAGGAGGCATTTGTGACCGTATGGGTTGGAGT
GCCGTTTGCCACGATGAGACCTTCTATACCACCGATGCATTCAGCAGTGATGTCAAGAAATTGCTTTCGGACACT
TCACGTTGCCAATTCGCCCATAGCAGCAAAGACTTCAAGCATGACGCTCATCCAGACCTCGTCTACTGCGTGGCC
TACGATACTCCCGCCTCTGCCGGCGGCAGAACCTTGGAATCCAGTCGACTCTACTCCAGTACCGATTTCTTTGCC
AGCGATAAAAACATCGAGGATTTGGGTCTTAAAAGGAATTCAAGGGGTGTTGTCGCTCTCGCCATCGTATCCAAA
TATGCTATTGTGGCCATGAAAGATGTTTCAGAGGCATCTGATGGCGAAATGCTACTCTATGTGACAATCGACACT
AAAACATGGGCGAAAGCACAGTTCCCTCATGCCTCTTCTGCTCGGTTACGCGAAAATGCGTATACTATCGTGGAG
AGCACGACTCATTCACTTGGTGTCGATGTCTTACTGCATGATAGCGGTGCTATTGGCACTCTATTTCTCAGCAAC
TCGAACGGGACTTTCTTCGTTGAAAGTTTGAAGGATACAAATAGGAATGAGATAGGGTTTGTGGATTATGAGAAG
GTTTACGGTGTTGATGGTGTTGGAATTGCGAATATCGTGGATAATGTCAAAGATGTCGAATCGAGGATGGCGGAC
AAGCTTCTGAAAAGTCGCATCACCTATAACGACGGTCGTACTTGGTCTCCTATCAAACCGCCCACCCAAGATTAC
GAAGGCAAGCCAATTGATTGCGACCCCAGCGATGGCGAACGCTGCTCACTCCATTTATACTCTGTTACGACTCCT
CATAATTATGGCCGCATTTTCTCATCCCCTGCTCCTGGTATCGTTATGGGCGTCGGTTCAATCGGACAGCATTTG
AAGCCGTATACGGATTGCGATACTTTCCTCAGTATCGACGCTGGAATAACATGGCAAATGGTTCGGAGAGACGCT
CATAAATATGAATTTGGTGATCAAGGCAGTATTTTGGTTGTGGTGAACGACGAAGAAGTGACGGACGAGATTCGC
TACTCACTTGATCTCGGGAAAACTTGGAAAACATATAATCTTGGGCAAAAGTTTATTGCTCAGGCATTGGTCACA
CTACCAGATTCAACGTCGCAAAAGTTTTTGCTTCTAGGTTCGATACCTAAGGGAGAACGGACGAAAGAAAGTGGA
CGAATAGTGGTGATTTATCTCGATTTTCAACCTACTCGGGGACGTAAATGCGAGGATGATGATTTTGAGAAATGG
TATGCTAGGAAAGATGATTCAGAGTGTATCATGGGACACAAACAATGGTATACTAGACGTAAGCCTGATGCTCAG
TGTTACGTTGGGAAGAAGTATATGGACCCTGTGGAACACGACGAGAATTGTCCTTGCTCGGATGACGATTACGAA
TGTGATTACAACTTTATCCTTCAGGACAGTAAATGCGTTGCTGCTGGTCCTGAACCCATTCCGGCTGGTGTATGT
GAAGGATCGAGAAGGACATTCCTGGGTTCCTCTGGGTATCGCAAGATTCCCGGCAACACTTGCTCAGGAGGGATG
AAGAAGGATGAGAAAGTCGAGAAGGATTGCTCGAAAGCTGAACCCCCGAGGGTCAAGCCATACACCAGATCCATG
ACTTCAAATCGCAAATTGTTCAGCACGCCTATTTCAAGGAGTCTACTGCTATTCTCGTTCGTCTACATGACAATA
CTGTTTGGCAATCAAGCAGAATTCTTCTTTACAACCAACTTCGGTCAAGATTGGCATACAGGTCACGCACCCACT
CCGCCGAATACATTTAATGCTCAGGTCATTCGATTCCATCCAACCAATTCTGATAGTATAATCTGGGTTGGTAAT
CTTGATTGTGGGGAGTTTACTAGTCCGACTTGCCGAGCTGAAGCGAAATATTCATTGAATAATGGAAGGACTTGG
GAACGCGTTGATGACTATGTGAAGAATTGTGCTTGGGCTAGGGATACCTTTTTGGAAGCGGATCCTACGGAAATT
ATCTGTGAATCGTATAAGGATAAGCAGGGAAGTCAAAGGAATATGGGCGGACCTGGGAGTCACTTGCAGTTGGTT
GCTGGAGCAGGGTATTATAAGAGGAAGAAGGCTTTGTTTACAAACGTGGTTGGGTTTGCGAAGTTTTCCGAGTTT
TTGGTTGTTGCTGAGTTACACCCTGAGAGACGCGTTCTAGAGCTACAAGTGTCGCTCGATGGAAATCATTTCGCG
AGTGGTCAATTCCCGCCGACTATGCATCCCAGTGGACACGCGTATACGGTTCTAGAATCGAACACTCATTCACTC
TTCCTACATATGACAATGTCCGAACCACCAGAAGCTCCTTTTTGGGGTAACATCTTGAAATCCAACTCGAATGGA
ACTTATTTCGGATTATCAGCAGAGTATGTTAACCGGAATCAAGATGGTTATGTGGATTTTGAAAAACTTATTGGA
TTGGATGGGGTTGCTCTTGTCAATGTTGTTGCTGATCCCGGTCAGGCGACAGTCACTGGAAGGAAGAATTTGCAA
TCGAGGATTACTCATAATGATGGTGCGACTTGGAAACCTTTGACCCCTCCTGCACGAGATTCCTTGGGTCAGAAG
TATGAATGTGATACTACGAAGTGCGCGCTACATATCCATGGATACACCGAACGCAGAGATCCGCGAGCCACATAC
AGCAGTCCTGGCGTAGTCGGCCTCCTGCTAGCAGTCGGAAACGTCGGCGAAACACTCAAACCTTACGTCGATAGT
AACACCTTTCTGAGTCGAGATGCGGGATTCACTTGGGAAGAAATTCATAAAGATGCATATATGTGGGAATTCGGT
GATTCAGGATCGATTCTGGTTATCGTGAATGATGAAGGACCAACGGATCGTGTGCTTTATAGTACGGATGAGGGA
TTGAATTGGAGAGAATATAGGTTCTCAGATGAGAAGATTAGGGTTGATTCGATTGTGACTGTTCCAGAGGATACG
AGTAGGAGGTTTATCTTATTTGGGAGTAGGTTGAGGGCACCGGGATCGGTCGCGGTGCATCTCGATTTCTCGGCG
TTGACAAAGAAAAGATGTGTTTATAACCCTGATAAGCCGAATGATGACGATTTTGAGTTGTGGAGTCCTAGTATT
GAGAGAGAAGAGATTTGTCTATTTGGCCGTCAGACACTGTATCATCGTCGTGCGAGGGAAGCCAATTGTATAGTT
GGGGATAAAGCCAAGGTGCCAGAGAAGCTTATACAAAATTGTCCTTGCTCAGCAGTAGATTTCGAATGTGAATTC
AACCATCTTCGTAACGCTGAAGGAGACTGTGTCCTCGTTCCTGGAACACAACCCCTACCTGATGATTTAGCAGAA
TGTGAGAGTGGGTCGGAGTATTGGTATGAGAGGACTGCGTACAGGATTATACCGTATTCAAGTTGCGAGAGCGAT
TACCGGCTTGATAGGGGTGCAAGACATGTGTGCCCGGGGTTCAAGTCCAAAGGGCCACTATTCTGGTTTTTCGTA
CTTCTACTACCTTTCGCATTCACTGCACTAGTGGGTTACTACTATTATCGTCGTGGTGGTCATGTCAGAGGGAAT
ATCCGACTTCCAGGAGATCTATCGAGCTCCTCGGATGGCAAATTCCAAAGAGCATTGGATACTGCTGCGTCGGTG
CCATGGTTCCTTATTGGACTTGCCCACATCGCGATTCAATGGGTCACTTCACGGGTGGATGTTAGTAACTTGAGA
TCGAGAAGAGGTTATAGAAACGTTCCTATCGATGAAGATGCACAGATTTTGCGGTTTGAAGATGAGGAGTAA
Transcript >Agabi119p4|089110
ATGAGGTGCTATTATGCATTATGGCTGGCTCTAATGGCCTTCGTTGGCTTCGCCACCGGCCAGTCCGACCCCACA
CATCAGATCACCCACTTTGACAATCCGCCAGCTCGCTTATTTTTTTTCGACGATACTAATTCAGTGATATATCAT
GATTCATTCGAGGGAAACGTTCACGTCTCGGAAGATGAGGGCAAAACATGGGAGTTGGCTGATATACCTCAAGGC
CAAGTAGACAGAGTCGTCGAACACCCGTTTAATAACCGCATTGCATTCATCTTGACTGCTGGCACTACACATTAC
CGCACCGAAGACAAGGGCCGGACATGGCGGTCTTTCAAAACTCCAATAGCTCCAGCGCGCGTTCAGCAGCCACTC
TCCTTTCATTCTGACCCGGATAAAAACGGCTATATTTTGTTCCAAGGAGGCATTTGTGACCGTATGGGTTGGAGT
GCCGTTTGCCACGATGAGACCTTCTATACCACCGATGCATTCAGCAGTGATGTCAAGAAATTGCTTTCGGACACT
TCACGTTGCCAATTCGCCCATAGCAGCAAAGACTTCAAGCATGACGCTCATCCAGACCTCGTCTACTGCGTGGCC
TACGATACTCCCGCCTCTGCCGGCGGCAGAACCTTGGAATCCAGTCGACTCTACTCCAGTACCGATTTCTTTGCC
AGCGATAAAAACATCGAGGATTTGGGTCTTAAAAGGAATTCAAGGGGTGTTGTCGCTCTCGCCATCGTATCCAAA
TATGCTATTGTGGCCATGAAAGATGTTTCAGAGGCATCTGATGGCGAAATGCTACTCTATGTGACAATCGACACT
AAAACATGGGCGAAAGCACAGTTCCCTCATGCCTCTTCTGCTCGGTTACGCGAAAATGCGTATACTATCGTGGAG
AGCACGACTCATTCACTTGGTGTCGATGTCTTACTGCATGATAGCGGTGCTATTGGCACTCTATTTCTCAGCAAC
TCGAACGGGACTTTCTTCGTTGAAAGTTTGAAGGATACAAATAGGAATGAGATAGGGTTTGTGGATTATGAGAAG
GTTTACGGTGTTGATGGTGTTGGAATTGCGAATATCGTGGATAATGTCAAAGATGTCGAATCGAGGATGGCGGAC
AAGCTTCTGAAAAGTCGCATCACCTATAACGACGGTCGTACTTGGTCTCCTATCAAACCGCCCACCCAAGATTAC
GAAGGCAAGCCAATTGATTGCGACCCCAGCGATGGCGAACGCTGCTCACTCCATTTATACTCTGTTACGACTCCT
CATAATTATGGCCGCATTTTCTCATCCCCTGCTCCTGGTATCGTTATGGGCGTCGGTTCAATCGGACAGCATTTG
AAGCCGTATACGGATTGCGATACTTTCCTCAGTATCGACGCTGGAATAACATGGCAAATGGTTCGGAGAGACGCT
CATAAATATGAATTTGGTGATCAAGGCAGTATTTTGGTTGTGGTGAACGACGAAGAAGTGACGGACGAGATTCGC
TACTCACTTGATCTCGGGAAAACTTGGAAAACATATAATCTTGGGCAAAAGTTTATTGCTCAGGCATTGGTCACA
CTACCAGATTCAACGTCGCAAAAGTTTTTGCTTCTAGGTTCGATACCTAAGGGAGAACGGACGAAAGAAAGTGGA
CGAATAGTGGTGATTTATCTCGATTTTCAACCTACTCGGGGACGTAAATGCGAGGATGATGATTTTGAGAAATGG
TATGCTAGGAAAGATGATTCAGAGTGTATCATGGGACACAAACAATGGTATACTAGACGTAAGCCTGATGCTCAG
TGTTACGTTGGGAAGAAGTATATGGACCCTGTGGAACACGACGAGAATTGTCCTTGCTCGGATGACGATTACGAA
TGTGATTACAACTTTATCCTTCAGGACAGTAAATGCGTTGCTGCTGGTCCTGAACCCATTCCGGCTGGTGTATGT
GAAGGATCGAGAAGGACATTCCTGGGTTCCTCTGGGTATCGCAAGATTCCCGGCAACACTTGCTCAGGAGGGATG
AAGAAGGATGAGAAAGTCGAGAAGGATTGCTCGAAAGCTGAACCCCCGAGGGTCAAGCCATACACCAGATCCATG
ACTTCAAATCGCAAATTGTTCAGCACGCCTATTTCAAGGAGTCTACTGCTATTCTCGTTCGTCTACATGACAATA
CTGTTTGGCAATCAAGCAGAATTCTTCTTTACAACCAACTTCGGTCAAGATTGGCATACAGGTCACGCACCCACT
CCGCCGAATACATTTAATGCTCAGGTCATTCGATTCCATCCAACCAATTCTGATAGTATAATCTGGGTTGGTAAT
CTTGATTGTGGGGAGTTTACTAGTCCGACTTGCCGAGCTGAAGCGAAATATTCATTGAATAATGGAAGGACTTGG
GAACGCGTTGATGACTATGTGAAGAATTGTGCTTGGGCTAGGGATACCTTTTTGGAAGCGGATCCTACGGAAATT
ATCTGTGAATCGTATAAGGATAAGCAGGGAAGTCAAAGGAATATGGGCGGACCTGGGAGTCACTTGCAGTTGGTT
GCTGGAGCAGGGTATTATAAGAGGAAGAAGGCTTTGTTTACAAACGTGGTTGGGTTTGCGAAGTTTTCCGAGTTT
TTGGTTGTTGCTGAGTTACACCCTGAGAGACGCGTTCTAGAGCTACAAGTGTCGCTCGATGGAAATCATTTCGCG
AGTGGTCAATTCCCGCCGACTATGCATCCCAGTGGACACGCGTATACGGTTCTAGAATCGAACACTCATTCACTC
TTCCTACATATGACAATGTCCGAACCACCAGAAGCTCCTTTTTGGGGTAACATCTTGAAATCCAACTCGAATGGA
ACTTATTTCGGATTATCAGCAGAGTATGTTAACCGGAATCAAGATGGTTATGTGGATTTTGAAAAACTTATTGGA
TTGGATGGGGTTGCTCTTGTCAATGTTGTTGCTGATCCCGGTCAGGCGACAGTCACTGGAAGGAAGAATTTGCAA
TCGAGGATTACTCATAATGATGGTGCGACTTGGAAACCTTTGACCCCTCCTGCACGAGATTCCTTGGGTCAGAAG
TATGAATGTGATACTACGAAGTGCGCGCTACATATCCATGGATACACCGAACGCAGAGATCCGCGAGCCACATAC
AGCAGTCCTGGCGTAGTCGGCCTCCTGCTAGCAGTCGGAAACGTCGGCGAAACACTCAAACCTTACGTCGATAGT
AACACCTTTCTGAGTCGAGATGCGGGATTCACTTGGGAAGAAATTCATAAAGATGCATATATGTGGGAATTCGGT
GATTCAGGATCGATTCTGGTTATCGTGAATGATGAAGGACCAACGGATCGTGTGCTTTATAGTACGGATGAGGGA
TTGAATTGGAGAGAATATAGGTTCTCAGATGAGAAGATTAGGGTTGATTCGATTGTGACTGTTCCAGAGGATACG
AGTAGGAGGTTTATCTTATTTGGGAGTAGGTTGAGGGCACCGGGATCGGTCGCGGTGCATCTCGATTTCTCGGCG
TTGACAAAGAAAAGATGTGTTTATAACCCTGATAAGCCGAATGATGACGATTTTGAGTTGTGGAGTCCTAGTATT
GAGAGAGAAGAGATTTGTCTATTTGGCCGTCAGACACTGTATCATCGTCGTGCGAGGGAAGCCAATTGTATAGTT
GGGGATAAAGCCAAGGTGCCAGAGAAGCTTATACAAAATTGTCCTTGCTCAGCAGTAGATTTCGAATGTGAATTC
AACCATCTTCGTAACGCTGAAGGAGACTGTGTCCTCGTTCCTGGAACACAACCCCTACCTGATGATTTAGCAGAA
TGTGAGAGTGGGTCGGAGTATTGGTATGAGAGGACTGCGTACAGGATTATACCGTATTCAAGTTGCGAGAGCGAT
TACCGGCTTGATAGGGGTGCAAGACATGTGTGCCCGGGGTTCAAGTCCAAAGGGCCACTATTCTGGTTTTTCGTA
CTTCTACTACCTTTCGCATTCACTGCACTAGTGGGTTACTACTATTATCGTCGTGGTGGTCATGTCAGAGGGAAT
ATCCGACTTCCAGGAGATCTATCGAGCTCCTCGGATGGCAAATTCCAAAGAGCATTGGATACTGCTGCGTCGGTG
CCATGGTTCCTTATTGGACTTGCCCACATCGCGATTCAATGGGTCACTTCACGGGTGGATGTTAGTAACTTGAGA
TCGAGAAGAGGTTATAGAAACGTTCCTATCGATGAAGATGCACAGATTTTGCGGTTTGAAGATGAGGAGTAA
Gene >Agabi119p4|089110
ATGAGGTGCTATTATGCATTATGGCTGGCTCTAATGGCCTTCGTTGGCTTCGCCACCGGCCAGTCCGACCCCACA
CATCAGATCACCCACTTTGACAATCCGCCAGCTCGCTTATTTTTTTTCGACGATACTAATGTGCGTATTCATTGA
AAAGGCTAGAATTTCTTTGTACTCATGGTGGTATAGTCAGTGATATATCATGATTCATTCGAGGGAAACGTTCAC
GTCTCGGAAGATGAGGGCAAAACATGGGAGTTGGCTGATATACCTCAAGGCCAAGTAGACAGAGTCGTCGAACAC
CCGTTTAATAACCGCATTGTGCGCTTTCATCTTATTGATACACGAGTTCAGTTGCTAAATATTGCACCAGGCATT
CATCTTGACTGCTGGCACTACACATTACCGCACCGAAGACAAGGGCCGGACATGGCGGTCTTTCAAAACTCCAAT
AGCTCCAGCGCGCGTTCAGCAGCCACTCTCCTTTCATTCTGACCCGGATAAAAACGGCTATATTTTGTTCCAAGG
AGGCATTTGTGACCGTATGGGTTGGAGTGCCGTTTGCCACGATGAGGTGCACACGACCGTTTACGCTGTCTTGCG
CGGCACTGAACTCTCTTCATAGACCTTCTATACCACCGATGCATTCAGCAGTGATGTCAAGAAATTGCTTTCGGA
CACTTCACGTTGCCAATTCGCCCATAGCAGCAAAGACTTCAAGCATGACGCTCATCCAGACCTCGTCTACTGCGT
GGCCTACGATACTCCCGCCTCTGCCGGCGGCAGAACCTTGGAATCCAGTCGACTCTACTCCAGTACCGATTTCTT
TGCCAGCGATAAAAACATCGAGGATTTGGGTCTTAAAAGGAATTCAAGGGGTGTTGTCGCTCTCGCCATCGTATC
CAAATATGCTATTGTGGCCATGAAAGATGTTTCAGAGGCATCTGATGGCGAAATGCTACTCTATGTGACAATCGA
CACTAAAACATGGGCGAAAGCACAGTTCCCTCATGCCTCTTCTGCTCGGTTACGCGAAAATGCGTATACTATCGT
GGAGAGCACGACTCATTCACTTGGTGTCGATGTCTTACTGCATGATAGCGGTGCTATTGGCACTCTATTTCTCAG
CAACTCGAACGGGACTTTCTTCGTTGAAAGTTTGAAGGATACAAATAGGAATGAGATAGGGTTTGTGGATTATGA
GAAGGTTTACGGTGTTGATGGTGTTGGAATTGCGAATATCGTGGATAATGTCAAAGATGTCGAATCGAGGATGGC
GGACAAGCTTCTGAAAAGTCGCATCACCTATAACGACGGTCGTACTTGGTCTCCTATCAAACCGCCCACCCAAGA
TTACGAAGGCAAGCCAATTGATTGCGACCCCAGCGATGGCGAACGCTGCTCACTCCATTTATACTCTGTTACGAC
TCCTCATAATTATGGCCGCATTTTCTCATCCCCTGCTCCTGGTATCGTTATGGGCGTCGGTTCAATCGGACAGCA
TTTGAAGCCGTATACGGATTGCGATACTTTCCTCAGTATCGACGCTGGAATAACATGGCAAATGGTTCGGAGAGA
CGCTCATAAATATGAATTTGGTGATCAAGGCAGTATTTTGGTTGTGGTGAACGACGAAGAAGTGACGGACGAGAT
TCGCTACTCACTTGATCTCGGGAAAACTTGGTGGGTCACTTTCTGCTCTTCTGATTCGTTGCTTGATTTCACACG
TGCATGTCTAGGAAAACATATAATCTTGGGCAAAAGTTTATTGCTCAGGCATTGGTCACACTACCAGATTCAACG
TCGCAAAAGTTTTTGCTTCTAGGTTCGATACCTAAGGGAGAACGGACGAAAGAAAGTGGACGAATAGTGGTGATT
TATCTCGATTTTCAACCTACTCGGGGACGTAAATGCGAGGATGATGATTTTGAGAAATGGTATGCTAGGAAAGAT
GATTCAGAGTGTATCATGGGACACAAAGTATGTCATTTCCTCCTCGAGATTTCTGTTACCTCGACAACCAACTGA
TTCTTTGAAATGTATAGCAATGGTATACTAGACGTAAGCCTGATGCTCAGTGTTACGTTGGGAAGAAGTATATGG
ACCCTGTGGAACACGACGAGAATTGTCCTTGCTCGGATGACGATTACGAATGGTGCGAATAAGAACATAGTATTA
GTTGGAGTGTTCCCTTACTAATGCTTTATGTAGTGATTACAACTTTATCCTTCAGGACAGTAAATGCGTTGCTGC
TGGTCCTGAACCCATTCCGGCTGGTGTATGTGAAGGATCGAGAAGGACATTCCTGGGTTCCTCTGGGTATCGCAA
GATTCCCGGCAACACTTGCTCAGGAGGGATGAAGAAGGATGAGAAAGTCGAGAAGGATTGCTCGAAAGGTATGTC
GCGTTCTCCTTTTGAATCAGGCAATTATGTTTAAGTGAGAGTGTTCCGAAAGCTGAACCCCCGAGGGTCAAGCCA
TACACCAGATCGTACGTGAAATTGATAGCTGAAAGTTCTTATTTTATATTCATCCATTTGCCTAGCATGACTTCA
AATCGCAAATTGTTCAGCACGCCTATTTCAAGGAGTCTACTGTGAGTAAATAGATAGAGGATGGTTGTTAGATTT
ATTCATGATTGACTTTTGGCAGGCTATTCTCGTTCGTCTACATGACAATACTGTTTGGCAATCAAGCAGTGAAGG
CTATGAATGGCATCAACTCTTCCCAGATAAACATCTACTCGCATTCTATCATCACAAATACGCACCAGATCGCGC
ATATATAATAACTGACACCAAGGAATTCTTCTTTACAACCAACTTCGGTCAAGATTGGCATACAGGTCACGCACC
CACTCCGCCGAATACATTTAATGCTCAGGTCATTCGATTCCATCCAACCAATTCTGATAGTATAATCTGGGTTGG
TAATCTTGATTGTGGGGAGTTTACTAGTCCGACTTGCCGAGCTGAAGCGAAATATTCATTGAATAATGGAAGGAC
TTGGGAACGCGTTGATGACTATGTGAAGAATTGTGCTTGGGCTAGGGATACCTTTTTGGAAGCGGATCCTACGGA
AATTATCTGTGAATCGTATAAGGATAAGCAGGGAAGTCAAAGGAATATGGGCGGACCTGGGAGTCACTTGCAGTT
GGTTGCTGGAGCAGGGTATTATAAGAGGAAGAAGGCTTTGTTTACAAACGTGGTTGGGTTTGCGAAGTTTTCCGA
GTTTTTGGTTGTTGCTGAGGTATGTGGCACCATCAATTTTCCGTTCGTTATGAACTAACTCTTTCTAGTTACACC
CTGAGAGACGCGTTCTAGAGCTACAAGTGTCGCTCGATGGAAATCATTTCGCGAGTGGTCAATTCCCGCCGACTA
TGCATCCCAGTGGACACGTACGCATTTTTCCTTCAACTTCCTTGCGATTCATCCGCTGACCTCTTCTTTCCTAAA
GGCGTATACGGTTCTAGAATCGAACACTCATTCACTCTTCCTACATATGACAATGTCCGAACCACCAGAAGCTCC
TTTTTGGGGTAACATCTTGAAATCCAACTCGAATGGAACTTATTTCGGATTATCAGCAGAGTATGTTAACCGGAA
TCAAGATGGTTATGTGGATTTTGAAAAACTTATTGGATTGGATGGGGTTGCTCTTGTCAATGTTGTTGCTGATCC
CGGTCAGGCGACAGTCACTGGAAGGAAGAATTTGCAATCGAGGATTACTCATAATGATGGTAAATACCCCTCTTG
CTTGGTGCGTGCTACAGGGGAGATGGATTGATCGTATTTATAGGTGCGACTTGGAAACCTTTGACCCCTCCTGCA
CGAGATTCCTTGGGTCAGAAGTATGAATGTGATACTACGGTGCGTCTGATACTCGTATTACTCCAGCTACTATCA
TTGACTTATCATCAGAAGTGCGCGCTACATATCCATGGATACACCGAACGCAGAGATCCGCGAGCCACATACAGC
AGTCCTGGCGTAGTCGGCCTCCTGCTAGCAGTCGGAAACGTCGGCGAAACACTCAAACCTTACGTCGATAGTAAC
ACCTTTCTGAGTCGAGATGCGGGATTCACTTGGGAAGAAATTCATAAAGATGCATATATGTGGGAATTCGGTGAT
TCAGGATCGATTCTGGTTATCGTGAATGATGAAGGACCAACGGATCGTGTGCTTTATAGTACGGATGAGGGATTG
AATTGGAGAGAATATAGGTTCTCAGATGAGAAGATTAGGGTTGATTCGATTGTGACTGTTCCAGAGGATACGAGT
AGGAGGTTTATCTTATTTGGGAGTAGGTTGAGGGCACCGGGATCGGTCGCGGTGCATCTCGATTTCTCGGCGTTG
ACAAAGAAAAGATGTACGTGTCTTTTTCTTCTTTTCTTGTCGGTGATCATAGCTGATCTGGGATTCAAGGTGTTT
ATAACCCTGATAAGCCGAATGATGACGATTTTGAGTTGTGGAGTCCTAGTATTGAGAGAGAAGAGATTTGTCTAT
TTGGCCGTCAGGTGAGATTGACTGTTTTCATTTATAATGTTGGAAATTGAAGTTTTTGAAGACACTGTATCATCG
TCGTGCGAGGGAAGCCAATTGTATAGTTGGGGATAAAGCCAAGGTGCCAGAGAAGCTTATACAAAATTGTCCTTG
CTCAGCAGTAGATTTCGAATGGTAAGTCCCCTTCAAATTTTACTTGTGCCCTTTGTCGAAACGACTTATTCCAAT
AGTGAATTCAACCATCTTCGTAACGCTGAAGGAGACTGTGTCCTCGTTCCTGGAACACAACCCCTACCTGATGAT
TTAGCAGAATGTGAGAGTGGGTCGGAGTATTGGTATGAGAGGACTGCGTACAGGATTATACCGTATTCAAGTTGC
GAGAGCGATTACCGGCTTGATAGGGGTGCAAGACATGTGTGCCCGGGGTTCAAGTCCAAAGGGCCACTATTCTGG
TTTTTCGTACTTCTACTACCTTTCGCATTCACTGCACTAGTGGGTTACTACTATTATCGTCGTGGTGGTCATGTC
AGAGGGTGCGTTTTTCTCTTTACTGGTTTTATTTTCGTCGAAAAGTGATTGATGTCGTTCGCATTAGGAATATCC
GACTTCCAGGAGATCTATCGAGCTCCTCGGATGGCAAATTCCAAAGAGCATTGGATACTGCTGCGTCGGTGCCAT
GGTTCCTTATTGGACTTGCCCACATCGCGATTCAATGGGTCACTTCACGGGTGGATGTTAGTAACTTGAGATCGA
GAAGAGGTTATAGAAACGTTCCTATCGATGAAGATGCACAGATTTTGCGGTTTGAAGATGAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail