Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|088980
Gene name
Locationscaffold_06:206591..209112
Strand-
Gene length (bp)2521
Transcript length (bp)1965
Coding sequence length (bp)1965
Protein length (aa) 655

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07250 Glyoxal_oxid_N Glyoxal oxidase N-terminus 5.7E-30 71 289
PF09118 GO-like_E_set Galactose oxidase-like, Early set domain 1.3E-24 454 563

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 80 581 3.0E-39
sp|I1S2N3|GAOA_GIBZE Galactose oxidase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GAOA PE=3 SV=1 318 563 3.0E-09
sp|P0CS93|GAOA_GIBZA Galactose oxidase OS=Gibberella zeae GN=GAOA PE=1 SV=1 318 563 6.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 630 652 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|088980
MMPFFLYASFLAVSFAYDIPTQPLRKGLDGQFELIGNTLISAQQMFLGTTDKVYIVDKVENNPSRVKSHPAWAEE
YTLSSNTHRAMDAITNTFCAGGNVLGNGTWLNVGGNQAVTYGGVQAETQTGGGPYDDPDGRKSVRMLDPCDNGHC
DWTLSSFQADQRWYPTLETLEDGTMIIIGGCRWGGYVNDAQQNNPTYEFFPTRGKPVISPHLTRTLPTNLYPLTW
LLPSGRLLLQSNWETILLDYKNGTETLLDAMPDAVRTYPASAGTVMLPLTPANNWTATILFCGGSNISTWQWTDP
AFVIVGQRASQSCVKITPDVSPNYEQDDPLPEGRSMANFILLPDGTVFCTNGARTGTAGYGYNPWAVGMSYADDP
HFTPLAYNASAAPGTRWSSQGFSSTKIPRMYHSSALLLPDGAVMIAGSNPNADYSVADLKYPTEYRMEFFYPAYY
THRRPQPRGIPSQLSYGGSSFTIAFTLDDLGGEITNIAKTKAVLIRPGFSTHSMNMGQRYVELESTYSTSDDNSA
GFLRVSQVPPNPSIIAPGPALFFVVVNNIPSIGVQVMIGSGQLGTQKVLPVEPLPAPSLNNPKQNDNATLKGVGN
GGKTNGAPGRLRGPPADAWITIFVAKHWDFYIILYITLYLLDYTICTIAGAAND*
Coding >Agabi119p4|088980
ATGATGCCATTCTTTCTCTACGCGTCTTTCCTTGCTGTTTCATTCGCGTATGATATCCCCACTCAACCTCTGAGA
AAAGGCCTCGATGGCCAGTTCGAACTCATCGGAAATACTCTCATCAGCGCACAGCAGATGTTTCTGGGTACCACG
GACAAGGTGTATATCGTCGATAAAGTGGAAAATAATCCGAGCCGTGTAAAAAGTCATCCCGCCTGGGCGGAAGAA
TATACTCTGAGTTCCAACACACACAGAGCCATGGACGCCATCACGAACACATTCTGCGCTGGCGGGAATGTGTTG
GGGAATGGAACATGGTTAAATGTGGGCGGTAATCAAGCGGTCACGTATGGCGGTGTGCAGGCTGAGACTCAAACT
GGCGGCGGGCCGTATGATGATCCTGACGGTCGTAAATCTGTTAGAATGCTCGACCCATGTGACAATGGCCATTGT
GATTGGACGCTTTCCTCCTTTCAGGCAGATCAAAGATGGTACCCGACACTAGAGACCTTGGAAGATGGGACTATG
ATCATAATCGGAGGATGTCGTTGGGGCGGCTATGTCAATGATGCACAACAAAACAATCCTACATATGAGTTCTTC
CCTACAAGAGGTAAACCAGTCATATCTCCTCATCTCACACGTACACTTCCTACAAATTTATATCCACTAACCTGG
CTACTTCCTTCTGGACGCCTGCTTTTACAATCTAATTGGGAGACTATTCTATTGGACTACAAAAATGGGACAGAG
ACTCTTCTGGATGCTATGCCTGACGCTGTTCGAACCTATCCTGCCAGTGCTGGCACTGTTATGCTTCCTCTGACA
CCGGCGAATAACTGGACTGCTACTATACTGTTCTGCGGAGGCTCTAATATTTCTACTTGGCAATGGACTGATCCG
GCGTTCGTTATTGTTGGACAACGGGCTTCCCAATCTTGTGTCAAAATTACCCCTGATGTGTCTCCGAACTACGAG
CAAGATGATCCACTGCCTGAGGGACGGTCTATGGCGAATTTTATCCTCCTACCGGACGGTACTGTCTTTTGCACC
AACGGAGCGCGTACTGGAACTGCCGGTTACGGGTATAATCCTTGGGCGGTTGGCATGTCTTATGCGGATGATCCT
CACTTTACACCGTTGGCCTATAATGCGAGTGCTGCTCCAGGAACCAGATGGTCGAGTCAAGGTTTCTCATCGACG
AAAATACCTCGGATGTATCATTCCTCCGCATTACTCTTACCCGACGGCGCGGTTATGATAGCGGGATCGAATCCA
AATGCAGATTATAGCGTTGCTGATCTCAAGTACCCAACGGAATATAGAATGGAGTTCTTTTATCCTGCGTATTAT
ACTCATCGGCGTCCACAACCTCGGGGAATTCCTAGTCAACTTTCTTATGGCGGGTCTTCGTTTACTATTGCTTTT
ACTCTGGACGATCTCGGAGGTGAAATTACCAACATTGCAAAGACAAAGGCGGTTCTCATTCGGCCAGGGTTCTCC
ACGCACTCAATGAACATGGGTCAACGTTACGTCGAACTTGAAAGCACCTACAGTACTTCCGACGACAACAGCGCC
GGCTTTCTACGGGTTTCACAAGTCCCACCAAATCCATCCATCATAGCACCAGGTCCAGCACTCTTCTTCGTCGTC
GTAAACAACATACCATCTATTGGGGTTCAAGTCATGATCGGCTCTGGACAGCTTGGTACTCAAAAAGTCTTACCT
GTTGAACCTTTACCTGCGCCTTCGTTGAATAACCCTAAACAAAATGACAATGCCACTTTGAAAGGAGTGGGGAAT
GGAGGAAAAACTAATGGAGCGCCGGGACGTCTGAGAGGACCTCCCGCGGACGCTTGGATCACTATTTTTGTTGCG
AAACATTGGGATTTCTATATAATATTGTATATTACACTATACTTGCTAGACTATACTATTTGTACGATTGCGGGT
GCAGCAAATGATTAG
Transcript >Agabi119p4|088980
ATGATGCCATTCTTTCTCTACGCGTCTTTCCTTGCTGTTTCATTCGCGTATGATATCCCCACTCAACCTCTGAGA
AAAGGCCTCGATGGCCAGTTCGAACTCATCGGAAATACTCTCATCAGCGCACAGCAGATGTTTCTGGGTACCACG
GACAAGGTGTATATCGTCGATAAAGTGGAAAATAATCCGAGCCGTGTAAAAAGTCATCCCGCCTGGGCGGAAGAA
TATACTCTGAGTTCCAACACACACAGAGCCATGGACGCCATCACGAACACATTCTGCGCTGGCGGGAATGTGTTG
GGGAATGGAACATGGTTAAATGTGGGCGGTAATCAAGCGGTCACGTATGGCGGTGTGCAGGCTGAGACTCAAACT
GGCGGCGGGCCGTATGATGATCCTGACGGTCGTAAATCTGTTAGAATGCTCGACCCATGTGACAATGGCCATTGT
GATTGGACGCTTTCCTCCTTTCAGGCAGATCAAAGATGGTACCCGACACTAGAGACCTTGGAAGATGGGACTATG
ATCATAATCGGAGGATGTCGTTGGGGCGGCTATGTCAATGATGCACAACAAAACAATCCTACATATGAGTTCTTC
CCTACAAGAGGTAAACCAGTCATATCTCCTCATCTCACACGTACACTTCCTACAAATTTATATCCACTAACCTGG
CTACTTCCTTCTGGACGCCTGCTTTTACAATCTAATTGGGAGACTATTCTATTGGACTACAAAAATGGGACAGAG
ACTCTTCTGGATGCTATGCCTGACGCTGTTCGAACCTATCCTGCCAGTGCTGGCACTGTTATGCTTCCTCTGACA
CCGGCGAATAACTGGACTGCTACTATACTGTTCTGCGGAGGCTCTAATATTTCTACTTGGCAATGGACTGATCCG
GCGTTCGTTATTGTTGGACAACGGGCTTCCCAATCTTGTGTCAAAATTACCCCTGATGTGTCTCCGAACTACGAG
CAAGATGATCCACTGCCTGAGGGACGGTCTATGGCGAATTTTATCCTCCTACCGGACGGTACTGTCTTTTGCACC
AACGGAGCGCGTACTGGAACTGCCGGTTACGGGTATAATCCTTGGGCGGTTGGCATGTCTTATGCGGATGATCCT
CACTTTACACCGTTGGCCTATAATGCGAGTGCTGCTCCAGGAACCAGATGGTCGAGTCAAGGTTTCTCATCGACG
AAAATACCTCGGATGTATCATTCCTCCGCATTACTCTTACCCGACGGCGCGGTTATGATAGCGGGATCGAATCCA
AATGCAGATTATAGCGTTGCTGATCTCAAGTACCCAACGGAATATAGAATGGAGTTCTTTTATCCTGCGTATTAT
ACTCATCGGCGTCCACAACCTCGGGGAATTCCTAGTCAACTTTCTTATGGCGGGTCTTCGTTTACTATTGCTTTT
ACTCTGGACGATCTCGGAGGTGAAATTACCAACATTGCAAAGACAAAGGCGGTTCTCATTCGGCCAGGGTTCTCC
ACGCACTCAATGAACATGGGTCAACGTTACGTCGAACTTGAAAGCACCTACAGTACTTCCGACGACAACAGCGCC
GGCTTTCTACGGGTTTCACAAGTCCCACCAAATCCATCCATCATAGCACCAGGTCCAGCACTCTTCTTCGTCGTC
GTAAACAACATACCATCTATTGGGGTTCAAGTCATGATCGGCTCTGGACAGCTTGGTACTCAAAAAGTCTTACCT
GTTGAACCTTTACCTGCGCCTTCGTTGAATAACCCTAAACAAAATGACAATGCCACTTTGAAAGGAGTGGGGAAT
GGAGGAAAAACTAATGGAGCGCCGGGACGTCTGAGAGGACCTCCCGCGGACGCTTGGATCACTATTTTTGTTGCG
AAACATTGGGATTTCTATATAATATTGTATATTACACTATACTTGCTAGACTATACTATTTGTACGATTGCGGGT
GCAGCAAATGATTAG
Gene >Agabi119p4|088980
ATGATGCCATTCTTTCTCTACGCGTCTTTCCTTGCTGTTTCATTCGCGTATGATATCCCCACTCAACCTCTGAGA
AAAGGCCTCGATGGCCAGTTCGAACTCATCGGAAATACTCTCATCAGCGCACAGCAGGTAAGTTTTAATACGACA
ATATCACCCTATCGCCTCACATACTTTATGCAAGATGTTTCTGGGTACCACGGACAAGGTGTATATCGTCGATAA
AGTGGAAAATAATCCGAGCCGTGTAAAAAGTCATCCCGCCTGGGCGGAAGGTGAGGTTCCTTACGTATGTCTTGT
GAAGAGATGCTGATAGAAAAATAGAATATACTCTGAGTTCCAACACACACAGAGCCATGGACGCCATCACGAACA
CATTCTGCGCTGTGAGTAGCGTAGCCATTGATTCACTCAGTTGAAGCTCACCAGAAGATGAAGGGCGGGAATGTG
TTGGGGAATGGAACATGGTTAAATGTGGGCGGTAATCAAGCGGTCACGTATGGCGGTGTGCAGGCTGAGACTCAA
ACTGGCGGCGGGCCGTATGATGATCCTGACGGTCGTAAATCGTGAGTTCTCAGATATCATATACAACTTACTCTA
ACTCAAAAACTATGCATAGTGTTAGGTATGCTATGTGAGCGCGCAATCGTTCGTATTGCCTCACTGTTTTCTCCT
AGAATGCTCGACCCATGTGACAATGGCCATTGTGATTGGACGCTTTCCTCCTTTCAGGCAGATCAAAGATGGTAC
CCGACACTGTAAGTTCGCGAAGCCCGAGATCCTATTTATTTCTGACCCGTATTCAGAGAGACCTTGGAAGATGGG
ACTATGATCATAGTAAGTTTTACGCTCGAGTCCTCGATGTTCTAAGGTGAACCCCTTTAGATCGGAGGATGTCGT
TGGGGCGGCTATGTCAATGATGCACAACAAAACAATCCTACATATGAGTTCTTCCCTACAAGAGGTAAACCAGTC
ATATCTCCTCATCTCACACGTACACTTCCTACAAATTTATATCCACTAACCTGGCTACTTCCTTCTGGACGCCTG
CTTTTACAATCTAATTGGGAGACTATTCTATTGGACTACAAAAATGGGACAGAGACTCTTCTGGATGCTATGCCT
GACGCTGTTCGAACCTATCCTGCCAGTGCTGGCACTGTTATGCTTCCTCTGACACCGGCGAATAACTGGACTGCT
ACTATACTGTTCTGCGGAGGCTCTAATATTTCTACTTGGCAATGGACTGATCCGGCGTTCGTTATTGTTGGACAA
CGGGCTTCCCAATCTTGTGTCAAAATTACCCCTGATGTGTCTCCGAACTACGAGCAAGATGATCCACTGCCTGAG
GGACGGTCTATGGCGAATTTTATCCTCCTACCGGACGGTACTGTCTTTTGCACCAACGGAGCGCGTACTGGTGGG
TACTCGTTGACTGTCCTCTGCCAAGAGTTTCCTGAGGTGACTTCGAAGGAACTGCCGGTTACGGGTATAATCCTT
GGGCGGTTGGCATGTCTTATGCGGATGATCCTCACTTTACACCGTTGGCCTATAATGCGAGTGCTGCTCCAGGAA
CCAGATGGTCGAGTCAAGGTTTCTCATCGACGAAAATACCTCGGATGTATCATTCCTCCGCATTACTCTTACCCG
ACGGTGAGTTTGTTGAATATATGCTATCGGAACGAAAGCTTACACCGTTCTAGGCGCGGTTATGATAGCGGGATC
GAATCCAAATGCAGATTATAGCGTTGCTGATCTCAAGTACCCAACGGAATATAGAATGGAGTTCTTTTATCCTGC
GTATTATACTCATCGGCGTCCACAACCTCGGGGAATTCCTAGTCAACTTTCTTATGGCGGGTCTTCGTTTACTAT
TGCTTTTACTCTGGACGATCTCGGAGGTGAAATTACCAACATTGCAAAGACAAAGGCGGTTCTCATTCGGCCAGG
GTTCTCCACGCACTCAATGGTGAGAGAGCAATCCTCACTTACTTTATTGATTTGACATGTTTTCTTCTAGAACAT
GGGTCAACGTTACGTCGAACTTGAAAGCACCTACAGTACTTCCGACGACAACAGCGCCGGCTTTCTACGGGTTTC
ACAAGTCCCACCAAATCCATCCATCATAGCACCAGGTCCAGCACTCTTCTTCGTCGTCGTAAACAACATACCATC
TATTGGGGTTCAAGTCATGATCGGCTCTGGACAGCTTGGTACTCAAAAAGTCTTACCTGTTGAACCTTTACCTGC
GCCTTCGTTGAATAACCCTAAACAAAATGACAATGCCACTTTGAAAGGAGTGGGGAATGGAGGAAAAACTAATGG
AGCGCCGGGACGTCTGAGAGGACCTCCCGCGGACGCTTGGATCACTATTTTTGTAAGTGTGTTGGTTGGTTCTTT
TGGGTTGACGTATTTCGGATTGTAGGTTGCGAAACATTGGGATTTCTATATAATATTGTATATTACACTATACTT
GCTAGACTATACTATTTGTACGATTGCGGGTGCAGCAAATGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail