Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|087110
Gene name
Locationscaffold_05b:471603..475757
Strand-
Gene length (bp)4154
Transcript length (bp)3726
Coding sequence length (bp)3726
Protein length (aa) 1242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00782 DSPc Dual specificity phosphatase, catalytic domain 1.4E-21 1103 1200

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38148|PPS1_YEAST Dual specificity protein phosphatase PPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPS1 PE=3 SV=1 1013 1239 1.0E-29
sp|P28562|DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens GN=DUSP1 PE=1 SV=3 1015 1200 2.0E-14
sp|Q2KJ36|DUS6_BOVIN Dual specificity protein phosphatase 6 OS=Bos taurus GN=DUSP6 PE=2 SV=1 1020 1204 4.0E-14
sp|Q16828|DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens GN=DUSP6 PE=1 SV=2 1020 1204 5.0E-14
sp|Q90W58|DUS1B_XENLA Dual specificity protein phosphatase 1-B OS=Xenopus laevis GN=dusp1-b PE=2 SV=1 1015 1200 5.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38148|PPS1_YEAST Dual specificity protein phosphatase PPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPS1 PE=3 SV=1 1013 1239 1.0E-29
sp|P28562|DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens GN=DUSP1 PE=1 SV=3 1015 1200 2.0E-14
sp|Q2KJ36|DUS6_BOVIN Dual specificity protein phosphatase 6 OS=Bos taurus GN=DUSP6 PE=2 SV=1 1020 1204 4.0E-14
sp|Q16828|DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens GN=DUSP6 PE=1 SV=2 1020 1204 5.0E-14
sp|Q90W58|DUS1B_XENLA Dual specificity protein phosphatase 1-B OS=Xenopus laevis GN=dusp1-b PE=2 SV=1 1015 1200 5.0E-14
sp|Q64346|DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus GN=Dusp6 PE=1 SV=1 1020 1204 6.0E-14
sp|Q9DBB1|DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus GN=Dusp6 PE=1 SV=1 1020 1204 7.0E-14
sp|Q91790|DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis GN=dusp1-a PE=1 SV=1 1015 1200 9.0E-14
sp|P28563|DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus GN=Dusp1 PE=1 SV=1 1015 1200 2.0E-13
sp|Q64623|DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus GN=Dusp1 PE=1 SV=1 1015 1200 2.0E-13
sp|Q63340|DUS7_RAT Dual specificity protein phosphatase 7 (Fragment) OS=Rattus norvegicus GN=Dusp7 PE=2 SV=1 1020 1204 5.0E-13
sp|O09112|DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus GN=Dusp8 PE=2 SV=1 1023 1203 6.0E-13
sp|Q13202|DUS8_HUMAN Dual specificity protein phosphatase 8 OS=Homo sapiens GN=DUSP8 PE=1 SV=2 1023 1203 9.0E-13
sp|Q9PW71|DUS4_CHICK Dual specificity protein phosphatase 4 OS=Gallus gallus GN=DUSP4 PE=2 SV=1 1015 1200 1.0E-12
sp|Q9BY84|DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens GN=DUSP16 PE=1 SV=1 1022 1219 1.0E-12
sp|Q05922|DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus GN=Dusp2 PE=1 SV=2 1013 1203 2.0E-12
sp|Q99956|DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens GN=DUSP9 PE=1 SV=1 1020 1203 2.0E-12
sp|Q91Z46|DUS7_MOUSE Dual specificity protein phosphatase 7 OS=Mus musculus GN=Dusp7 PE=2 SV=4 1020 1204 3.0E-12
sp|Q16829|DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens GN=DUSP7 PE=1 SV=4 1020 1204 3.0E-12
sp|O54838|DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus GN=Dusp5 PE=2 SV=1 1015 1200 3.0E-12
sp|Q8BFV3|DUS4_MOUSE Dual specificity protein phosphatase 4 OS=Mus musculus GN=Dusp4 PE=2 SV=1 1015 1200 4.0E-12
sp|Q62767|DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus GN=Dusp4 PE=2 SV=1 1015 1200 4.0E-12
sp|Q16690|DUS5_HUMAN Dual specificity protein phosphatase 5 OS=Homo sapiens GN=DUSP5 PE=1 SV=2 1015 1200 4.0E-12
sp|Q13115|DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens GN=DUSP4 PE=1 SV=1 1015 1200 4.0E-12
sp|Q556Y8|DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum GN=DDB_G0273199 PE=3 SV=1 1021 1200 8.0E-12
sp|Q5RD73|DUS3_PONAB Dual specificity protein phosphatase 3 OS=Pongo abelii GN=DUSP3 PE=2 SV=1 1012 1206 1.0E-11
sp|P51452|DUS3_HUMAN Dual specificity protein phosphatase 3 OS=Homo sapiens GN=DUSP3 PE=1 SV=1 1012 1206 1.0E-11
sp|Q05923|DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens GN=DUSP2 PE=1 SV=1 1015 1203 2.0E-11
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 1020 1203 2.0E-11
sp|Q6B8I0|DS13A_MOUSE Dual specificity protein phosphatase 13 isoform A OS=Mus musculus GN=Dusp13 PE=2 SV=1 1025 1203 9.0E-11
sp|Q9D7X3|DUS3_MOUSE Dual specificity protein phosphatase 3 OS=Mus musculus GN=Dusp3 PE=1 SV=1 1012 1206 2.0E-10
sp|Q10038|VHP1_CAEEL Tyrosine-protein phosphatase vhp-1 OS=Caenorhabditis elegans GN=vhp-1 PE=1 SV=2 1067 1206 4.0E-10
sp|P38590|MSG5_YEAST Tyrosine-protein phosphatase MSG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSG5 PE=1 SV=2 1126 1211 4.0E-10
sp|Q6B8I1|DS13A_HUMAN Dual specificity protein phosphatase 13 isoform A OS=Homo sapiens GN=DUSP13 PE=1 SV=1 1025 1197 5.0E-10
sp|P0C596|DUPD1_PIG Dual specificity phosphatase DUPD1 OS=Sus scrofa GN=DUPD1 PE=3 SV=1 1001 1213 7.0E-10
sp|Q9ZR37|DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana GN=DSPTP1 PE=1 SV=1 1018 1181 2.0E-09
sp|Q60969|STYX_MOUSE Serine/threonine/tyrosine-interacting protein OS=Mus musculus GN=Styx PE=1 SV=2 1025 1205 2.0E-09
sp|Q8BTR5|DUS28_MOUSE Dual specificity phosphatase 28 OS=Mus musculus GN=Dusp28 PE=1 SV=1 1023 1203 2.0E-09
sp|Q4G0W2|DUS28_HUMAN Dual specificity phosphatase 28 OS=Homo sapiens GN=DUSP28 PE=2 SV=1 1024 1181 3.0E-09
sp|Q8WUJ0|STYX_HUMAN Serine/threonine/tyrosine-interacting protein OS=Homo sapiens GN=STYX PE=1 SV=1 1025 1205 4.0E-09
sp|Q54T76|DUSP4_DICDI Probable dual specificity protein phosphatase DDB_G0281963 OS=Dictyostelium discoideum GN=DDB_G0281963 PE=3 SV=1 1131 1207 5.0E-09
sp|Q6IVY4|SSH_XENLA Protein phosphatase Slingshot homolog OS=Xenopus laevis GN=ssh PE=1 SV=2 1022 1200 6.0E-09
sp|P0C591|DUPD1_BOVIN Dual specificity phosphatase DUPD1 OS=Bos taurus GN=DUPD1 PE=2 SV=1 1001 1218 8.0E-09
sp|P0C598|DUPD1_ANOCA Dual specificity phosphatase DUPD1 OS=Anolis carolinensis GN=DUPD1 PE=3 SV=1 1001 1207 1.0E-08
sp|Q5U593|STYXB_XENLA Serine/threonine/tyrosine-interacting protein B OS=Xenopus laevis GN=styx-b PE=2 SV=1 1018 1205 1.0E-08
sp|Q75QN6|DPHS1_ARATH Dual specificity protein phosphatase PHS1 OS=Arabidopsis thaliana GN=PHS1 PE=1 SV=1 1022 1196 1.0E-08
sp|P40479|SDP1_YEAST Dual-specificity protein phosphatase SDP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDP1 PE=1 SV=1 1133 1203 1.0E-08
sp|Q6NN85|SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster GN=ssh PE=1 SV=2 1022 1220 1.0E-08
sp|Q9M8K7|DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana GN=DSPTP1B PE=1 SV=1 1029 1188 2.0E-08
sp|P0C597|DUPD1_CHICK Dual specificity phosphatase DUPD1 OS=Gallus gallus GN=DUPD1 PE=2 SV=1 1001 1207 2.0E-08
sp|Q0IID7|DUS10_BOVIN Dual specificity protein phosphatase 10 OS=Bos taurus GN=DUSP10 PE=2 SV=1 1138 1200 2.0E-08
sp|O13453|PMP1_SCHPO Tyrosine-protein phosphatase pmp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmp1 PE=3 SV=1 1136 1206 2.0E-08
sp|Q9VVW5|DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster GN=Mkp3 PE=1 SV=2 1022 1203 2.0E-08
sp|Q9BV47|DUS26_HUMAN Dual specificity protein phosphatase 26 OS=Homo sapiens GN=DUSP26 PE=1 SV=1 1025 1203 3.0E-08
sp|P0C594|DUPD1_PANTR Dual specificity phosphatase DUPD1 OS=Pan troglodytes GN=DUPD1 PE=3 SV=1 1001 1196 3.0E-08
sp|Q9Y6W6|DUS10_HUMAN Dual specificity protein phosphatase 10 OS=Homo sapiens GN=DUSP10 PE=1 SV=1 1138 1200 3.0E-08
sp|Q9ESS0|DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus GN=Dusp10 PE=2 SV=2 1138 1200 3.0E-08
sp|Q9D700|DUS26_MOUSE Dual specificity protein phosphatase 26 OS=Mus musculus GN=Dusp26 PE=2 SV=2 1025 1203 3.0E-08
sp|Q5R6H6|DUS26_PONAB Dual specificity protein phosphatase 26 OS=Pongo abelii GN=DUSP26 PE=2 SV=1 1025 1203 4.0E-08
sp|Q9H596|DUS21_HUMAN Dual specificity protein phosphatase 21 OS=Homo sapiens GN=DUSP21 PE=1 SV=1 1126 1210 4.0E-08
sp|Q4V7N3|STYXA_XENLA Serine/threonine/tyrosine-interacting protein A OS=Xenopus laevis GN=styx-a PE=2 SV=1 1018 1205 5.0E-08
sp|Q6AXW7|DUS18_RAT Dual specificity protein phosphatase 18 OS=Rattus norvegicus GN=Dusp18 PE=2 SV=1 1114 1203 5.0E-08
sp|Q8WYL5|SSH1_HUMAN Protein phosphatase Slingshot homolog 1 OS=Homo sapiens GN=SSH1 PE=1 SV=2 1022 1218 5.0E-08
sp|Q4RQD3|DUPD1_TETNG Dual specificity phosphatase DUPD1 OS=Tetraodon nigroviridis GN=dupd1 PE=3 SV=2 1009 1207 6.0E-08
sp|Q9D9D8|DUS21_MOUSE Dual specificity phosphatase 21 OS=Mus musculus GN=Dusp21 PE=1 SV=1 1126 1203 6.0E-08
sp|Q5FVI9|DUS26_RAT Dual specificity protein phosphatase 26 OS=Rattus norvegicus GN=Dusp26 PE=2 SV=1 1025 1203 7.0E-08
sp|Q76I79|SSH1_MOUSE Protein phosphatase Slingshot homolog 1 OS=Mus musculus GN=Ssh1 PE=1 SV=1 1022 1218 7.0E-08
sp|Q17QJ3|DUS26_BOVIN Dual specificity protein phosphatase 26 OS=Bos taurus GN=DUSP26 PE=2 SV=1 1025 1203 7.0E-08
sp|Q9JLY7|DUS14_MOUSE Dual specificity protein phosphatase 14 OS=Mus musculus GN=Dusp14 PE=2 SV=2 1133 1203 9.0E-08
sp|O55737|123R_IIV6 Putative tyrosine phosphatase 123R OS=Invertebrate iridescent virus 6 GN=IIV6-123R PE=3 SV=1 1122 1200 9.0E-08
sp|Q5RDP3|STYX_PONAB Serine/threonine/tyrosine-interacting protein OS=Pongo abelii GN=STYX PE=2 SV=1 1020 1205 1.0E-07
sp|Q8BK84|DUPD1_MOUSE Dual specificity phosphatase DUPD1 OS=Mus musculus GN=Dupd1 PE=2 SV=1 1001 1207 2.0E-07
sp|P0C595|DUPD1_RAT Dual specificity phosphatase DUPD1 OS=Rattus norvegicus GN=Dupd1 PE=2 SV=1 1001 1207 2.0E-07
sp|P0C599|DUPD1_TAKRU Dual specificity phosphatase DUPD1 OS=Takifugu rubripes GN=dupd1 PE=3 SV=1 1009 1207 2.0E-07
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 1132 1205 3.0E-07
sp|Q17QM8|DUS14_BOVIN Dual specificity protein phosphatase 14 OS=Bos taurus GN=DUSP14 PE=2 SV=1 1126 1203 4.0E-07
sp|O95147|DUS14_HUMAN Dual specificity protein phosphatase 14 OS=Homo sapiens GN=DUSP14 PE=1 SV=1 1126 1203 4.0E-07
sp|Q55BI8|DUSP3_DICDI Probable dual specificity protein phosphatase DDB_G0271350 OS=Dictyostelium discoideum GN=DDB_G0271350 PE=3 SV=1 1116 1219 5.0E-07
sp|Q76I76|SSH2_HUMAN Protein phosphatase Slingshot homolog 2 OS=Homo sapiens GN=SSH2 PE=1 SV=1 1131 1196 8.0E-07
sp|Q5SW75|SSH2_MOUSE Protein phosphatase Slingshot homolog 2 OS=Mus musculus GN=Ssh2 PE=1 SV=2 1131 1196 8.0E-07
sp|Q8K330|SSH3_MOUSE Protein phosphatase Slingshot homolog 3 OS=Mus musculus GN=Ssh3 PE=1 SV=1 1023 1207 9.0E-07
sp|Q5XIS1|SSH3_RAT Protein phosphatase Slingshot homolog 3 OS=Rattus norvegicus GN=Ssh3 PE=1 SV=1 1023 1207 2.0E-06
sp|Q8VE01|DUS18_MOUSE Dual specificity protein phosphatase 18 OS=Mus musculus GN=Dusp18 PE=1 SV=1 1114 1203 5.0E-06
sp|Q5UR74|PTPH_MIMIV Putative tyrosine-protein phosphatase R622 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R622 PE=3 SV=1 1123 1202 5.0E-06
sp|P0C5A2|DUPD1_CALMI Dual specificity phosphatase DUPD1 OS=Callorhinchus milii GN=dupd1 PE=3 SV=1 1142 1210 6.0E-06
sp|Q5BIP9|DUS18_BOVIN Dual specificity protein phosphatase 18 OS=Bos taurus GN=DUSP18 PE=2 SV=1 1126 1203 7.0E-06
sp|Q8NEJ0|DUS18_HUMAN Dual specificity protein phosphatase 18 OS=Homo sapiens GN=DUSP18 PE=1 SV=1 1126 1203 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016311 dephosphorylation Yes
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016787 hydrolase activity No
GO:0044237 cellular metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0006793 phosphorus metabolic process No
GO:0004721 phosphoprotein phosphatase activity No
GO:0003824 catalytic activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016791 phosphatase activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|087110
MNGAHGVSYSSDFLSRLPQPTPPVRLLPAQDFAQLHLSHILSHPQDHVLFPFLHGLEGDNDAQNGFFASAPNAHE
THVFTDTHHPKVKIPKYRGLIWVVCEEDLEAGADLVTLRILRRKNLSSTTITSSPDGSMYSSGSESFEEDDDEDY
EIEDEYSQGGHSDVRVGVVGSDENAMQLSAGDTLPIITEDIKEKTLSPDLDNQPHMHPVNHRSIHTATSIPLASS
VSSTDTSASSTASSSFDTSTSSSTSPDSDLTSFSSCSVDPDTVPGLDSKAQTQSAADLKPRVTDPAAPPLLTGTF
RPKELLRRIKRDGGHCDWEFTPAKVPEGISLRNFGIQVPIYATISDIVVYSPKGASPAAITLAQRFTQAIQAKRK
ERIQALGLPDEDGSNGLLHYNVFVLDAAEERMRKELAHLMMRICVEPVSGGLFGTRNNSHGAHTDGSDGHTVESG
AVESREREETAVGEMDMVVDGPSQERRQQEEGLTIPFPNTVDFAQREKEEMRDLTKASEIVSLFPALPPSPEGSS
GWNTPDDGSSVQQRPRSLSSASSRHPYRSTRPPHLQFLPQVQPHILHNNFTFSPPDINIDISSTASFYDPHVGQI
FLGNSGDVPLAPERLQSGSVEDDPFDYKDTNNPQKGFGYDICIECHDLATFPSAAHLRAAEEHLSMVDLLWLEKC
ERQWQERFDQGENVDEEDIPTRPPPHANAVIHLTLPSSPASTQATLSSFMPVVRFLEKWLRPIQSPPCIDRPSPP
MPHSPGNGSARRWSSMASFMPSFVPFTSSSPPKTASPPSSAPSRNRSFTSPIPSVLKPKPRSRPTRPLKVLMYSS
DGYTESSVPALCLLMAIKGLSLPEAYLELQVAKRRSFFVYHNDLGLLRRMEARLREERERSGLLASANASNTGAN
ASPRSWGEGMGSGGHRRPAAKSVSFATPPSLPGFKKVGNTVTPPLQQQALEEDVCMTVEPQPVNMSASVGSLPSD
GSCGGESISMGVAKSRPRASTSPWLPSLFSGDHQTWFNDPRFDGSFPSRVLPFLYLGNLNHAANAYMLHALGITH
VVSVGECALVPPGVSGGPGISYLGPNLYHRPNSSQYTSKGPGMHGSLWIEEREGRIKVLDIKGVCDDGIDTLEPQ
LEPICEWIDKARQEGGQVLVHCRVGVSRSATVTIAYVMKHLNLPLVDAYLIVRSRRLSVLIQPNMRLLYNLCGWE
IKLAKDRAGRDERKLKRELSRMLSWPYLAKEVHALNEKYLH*
Coding >Agabi119p4|087110
ATGAACGGCGCCCACGGCGTCTCATATTCCTCCGACTTTCTCAGTCGTCTCCCCCAGCCCACCCCCCCTGTTCGT
CTACTCCCCGCCCAGGACTTTGCACAGCTTCATCTCTCCCATATTCTGTCGCATCCGCAGGATCATGTCCTTTTC
CCTTTTCTGCATGGTCTAGAGGGCGACAATGACGCTCAGAATGGCTTTTTCGCCTCTGCACCTAATGCGCACGAG
ACCCATGTATTCACCGATACCCACCATCCAAAAGTAAAGATTCCCAAGTACAGAGGCCTCATCTGGGTCGTTTGT
GAAGAGGATCTCGAGGCAGGCGCTGACTTGGTCACGCTTCGGATACTTCGCCGGAAGAATCTTTCTTCTACGACT
ATCACCTCGTCTCCCGACGGCTCTATGTATTCCTCTGGGTCCGAGTCTTTCGAAGAGGACGACGACGAAGATTAT
GAGATTGAAGACGAATATTCCCAAGGCGGTCACTCGGACGTGCGTGTCGGCGTCGTAGGCTCTGATGAGAACGCT
ATGCAACTCTCCGCGGGCGACACTCTTCCAATCATCACCGAAGACATCAAAGAAAAGACCCTTTCCCCAGATCTT
GACAATCAACCACACATGCATCCCGTAAATCACCGGTCTATCCATACCGCGACTTCTATTCCCCTAGCTTCTTCT
GTTTCGAGCACTGATACCAGTGCCTCAAGTACCGCTAGTTCTTCCTTTGACACCTCTACCTCTTCTTCAACATCG
CCAGATTCGGATTTAACGTCCTTCTCCTCCTGCTCTGTAGACCCTGACACTGTACCGGGTCTGGACTCCAAAGCT
CAAACGCAATCCGCCGCCGATCTCAAACCTAGGGTGACGGATCCAGCAGCTCCGCCATTGTTGACTGGCACATTT
CGACCAAAAGAACTTTTGCGGCGCATAAAGCGAGACGGCGGCCATTGCGATTGGGAATTCACACCAGCCAAAGTT
CCAGAAGGTATATCTTTGAGAAATTTTGGTATCCAAGTTCCCATCTATGCCACCATTTCCGATATCGTCGTCTAT
TCCCCGAAAGGAGCATCACCGGCAGCTATTACACTTGCCCAGCGTTTCACACAGGCTATTCAAGCCAAACGTAAA
GAGCGTATCCAAGCTCTTGGCTTGCCGGATGAGGATGGATCAAATGGTTTACTGCATTATAACGTGTTTGTTTTG
GATGCGGCCGAAGAGCGGATGAGGAAGGAACTGGCTCATCTGATGATGCGCATATGCGTGGAGCCTGTCTCTGGT
GGGCTTTTTGGTACCCGCAATAATAGTCACGGGGCGCATACTGATGGTTCTGATGGTCATACTGTCGAGTCAGGG
GCAGTCGAGTCGAGAGAGCGCGAGGAAACAGCTGTTGGGGAAATGGATATGGTTGTTGATGGTCCATCGCAGGAG
CGGCGGCAGCAGGAAGAAGGTCTAACGATACCATTCCCCAATACGGTTGATTTTGCCCAACGTGAAAAGGAAGAA
ATGCGGGATTTGACAAAGGCATCCGAGATTGTCAGCCTTTTCCCGGCTTTACCTCCTAGTCCTGAAGGATCATCT
GGTTGGAATACTCCAGACGATGGTTCATCCGTTCAGCAGAGACCCAGATCGCTTTCTTCTGCATCGTCTCGTCAT
CCATATCGTTCGACACGTCCTCCTCATCTTCAATTCTTACCGCAAGTACAACCTCATATCCTACACAATAATTTT
ACGTTTTCACCACCCGATATCAATATCGACATTTCATCCACTGCCTCTTTCTATGACCCTCATGTTGGTCAAATA
TTTCTGGGAAATTCTGGCGACGTACCATTGGCCCCTGAAAGGCTCCAGTCGGGAAGTGTCGAAGATGACCCTTTT
GATTATAAAGATACGAACAATCCTCAAAAAGGGTTTGGTTATGATATTTGTATCGAATGTCATGATCTAGCGACT
TTTCCCAGTGCTGCGCACCTTCGGGCTGCTGAGGAACATCTGTCAATGGTGGATCTTCTATGGCTCGAGAAATGT
GAGCGCCAGTGGCAAGAACGGTTTGATCAGGGAGAGAATGTTGACGAAGAGGATATACCAACGCGACCTCCTCCA
CATGCAAATGCTGTGATCCATCTTACTTTACCAAGCTCTCCCGCAAGTACGCAAGCTACGTTGAGCTCTTTTATG
CCCGTCGTCCGTTTCCTGGAGAAATGGCTCCGGCCAATCCAGTCGCCACCATGTATAGACCGCCCTTCGCCACCG
ATGCCCCACTCTCCCGGTAATGGGTCTGCTAGGCGTTGGTCATCTATGGCCTCCTTCATGCCCTCGTTCGTACCA
TTCACCTCCTCATCTCCACCCAAGACGGCGTCTCCGCCTTCTAGTGCACCATCTCGTAATCGATCGTTCACGTCG
CCTATTCCCTCTGTATTGAAACCGAAACCTCGATCTCGGCCAACTCGACCGCTTAAAGTTTTAATGTACTCTTCG
GATGGATACACCGAATCCTCAGTGCCGGCTCTGTGTCTTCTTATGGCTATTAAAGGGTTAAGTTTACCCGAGGCA
TATTTGGAACTTCAAGTTGCTAAGCGACGAAGTTTCTTTGTATATCATAATGATCTCGGACTTTTACGGAGGATG
GAAGCTAGATTGAGAGAGGAGAGGGAAAGGAGTGGGTTGTTGGCTTCGGCGAATGCATCTAATACTGGTGCGAAT
GCCTCTCCGCGAAGTTGGGGTGAGGGGATGGGAAGTGGTGGGCATCGGCGACCTGCGGCTAAAAGTGTGTCGTTT
GCGACGCCACCGAGTTTACCTGGATTCAAGAAGGTGGGGAATACGGTTACTCCGCCGTTGCAGCAGCAGGCGCTT
GAAGAAGATGTTTGTATGACGGTGGAGCCTCAGCCTGTGAATATGTCGGCTTCGGTGGGGAGTTTGCCGTCGGAT
GGTAGTTGTGGTGGAGAGTCTATTAGTATGGGAGTCGCAAAGAGCCGGCCGAGAGCGAGTACGAGTCCGTGGTTG
CCGAGTTTGTTTAGTGGTGATCATCAGACTTGGTTTAATGATCCTAGGTTTGATGGGAGCTTTCCGAGTCGAGTT
TTACCGTTTTTGTATTTGGGAAACTTGAATCATGCGGCGAATGCGTATATGTTGCATGCGCTGGGTATTACTCAT
GTCGTGTCTGTGGGTGAATGTGCGCTTGTGCCACCTGGAGTGTCTGGAGGACCTGGGATAAGCTATTTGGGACCT
AATCTCTATCATCGACCGAATAGTTCTCAGTATACGTCGAAAGGACCGGGTATGCATGGGTCGTTGTGGATTGAG
GAGAGGGAGGGGAGGATTAAGGTGTTGGATATTAAAGGAGTTTGTGATGATGGGATTGATACTTTGGAACCGCAG
TTGGAGCCGATTTGTGAATGGATTGATAAAGCTAGACAGGAAGGGGGACAAGTTCTTGTGCATTGTCGGGTTGGA
GTGTCGAGGAGTGCGACTGTCACAATTGCGTATGTAATGAAACATTTGAATTTACCGTTGGTGGATGCGTATTTG
ATTGTGCGGTCGAGACGGCTTTCGGTTTTGATTCAGCCGAATATGAGGTTGTTGTATAATTTGTGTGGGTGGGAG
ATCAAGTTGGCGAAGGATAGGGCGGGGAGGGATGAGAGAAAGTTGAAGAGGGAGTTGTCGAGGATGTTGAGTTGG
CCGTATCTTGCAAAAGAGGTGCATGCGCTTAATGAAAAATATTTGCATTGA
Transcript >Agabi119p4|087110
ATGAACGGCGCCCACGGCGTCTCATATTCCTCCGACTTTCTCAGTCGTCTCCCCCAGCCCACCCCCCCTGTTCGT
CTACTCCCCGCCCAGGACTTTGCACAGCTTCATCTCTCCCATATTCTGTCGCATCCGCAGGATCATGTCCTTTTC
CCTTTTCTGCATGGTCTAGAGGGCGACAATGACGCTCAGAATGGCTTTTTCGCCTCTGCACCTAATGCGCACGAG
ACCCATGTATTCACCGATACCCACCATCCAAAAGTAAAGATTCCCAAGTACAGAGGCCTCATCTGGGTCGTTTGT
GAAGAGGATCTCGAGGCAGGCGCTGACTTGGTCACGCTTCGGATACTTCGCCGGAAGAATCTTTCTTCTACGACT
ATCACCTCGTCTCCCGACGGCTCTATGTATTCCTCTGGGTCCGAGTCTTTCGAAGAGGACGACGACGAAGATTAT
GAGATTGAAGACGAATATTCCCAAGGCGGTCACTCGGACGTGCGTGTCGGCGTCGTAGGCTCTGATGAGAACGCT
ATGCAACTCTCCGCGGGCGACACTCTTCCAATCATCACCGAAGACATCAAAGAAAAGACCCTTTCCCCAGATCTT
GACAATCAACCACACATGCATCCCGTAAATCACCGGTCTATCCATACCGCGACTTCTATTCCCCTAGCTTCTTCT
GTTTCGAGCACTGATACCAGTGCCTCAAGTACCGCTAGTTCTTCCTTTGACACCTCTACCTCTTCTTCAACATCG
CCAGATTCGGATTTAACGTCCTTCTCCTCCTGCTCTGTAGACCCTGACACTGTACCGGGTCTGGACTCCAAAGCT
CAAACGCAATCCGCCGCCGATCTCAAACCTAGGGTGACGGATCCAGCAGCTCCGCCATTGTTGACTGGCACATTT
CGACCAAAAGAACTTTTGCGGCGCATAAAGCGAGACGGCGGCCATTGCGATTGGGAATTCACACCAGCCAAAGTT
CCAGAAGGTATATCTTTGAGAAATTTTGGTATCCAAGTTCCCATCTATGCCACCATTTCCGATATCGTCGTCTAT
TCCCCGAAAGGAGCATCACCGGCAGCTATTACACTTGCCCAGCGTTTCACACAGGCTATTCAAGCCAAACGTAAA
GAGCGTATCCAAGCTCTTGGCTTGCCGGATGAGGATGGATCAAATGGTTTACTGCATTATAACGTGTTTGTTTTG
GATGCGGCCGAAGAGCGGATGAGGAAGGAACTGGCTCATCTGATGATGCGCATATGCGTGGAGCCTGTCTCTGGT
GGGCTTTTTGGTACCCGCAATAATAGTCACGGGGCGCATACTGATGGTTCTGATGGTCATACTGTCGAGTCAGGG
GCAGTCGAGTCGAGAGAGCGCGAGGAAACAGCTGTTGGGGAAATGGATATGGTTGTTGATGGTCCATCGCAGGAG
CGGCGGCAGCAGGAAGAAGGTCTAACGATACCATTCCCCAATACGGTTGATTTTGCCCAACGTGAAAAGGAAGAA
ATGCGGGATTTGACAAAGGCATCCGAGATTGTCAGCCTTTTCCCGGCTTTACCTCCTAGTCCTGAAGGATCATCT
GGTTGGAATACTCCAGACGATGGTTCATCCGTTCAGCAGAGACCCAGATCGCTTTCTTCTGCATCGTCTCGTCAT
CCATATCGTTCGACACGTCCTCCTCATCTTCAATTCTTACCGCAAGTACAACCTCATATCCTACACAATAATTTT
ACGTTTTCACCACCCGATATCAATATCGACATTTCATCCACTGCCTCTTTCTATGACCCTCATGTTGGTCAAATA
TTTCTGGGAAATTCTGGCGACGTACCATTGGCCCCTGAAAGGCTCCAGTCGGGAAGTGTCGAAGATGACCCTTTT
GATTATAAAGATACGAACAATCCTCAAAAAGGGTTTGGTTATGATATTTGTATCGAATGTCATGATCTAGCGACT
TTTCCCAGTGCTGCGCACCTTCGGGCTGCTGAGGAACATCTGTCAATGGTGGATCTTCTATGGCTCGAGAAATGT
GAGCGCCAGTGGCAAGAACGGTTTGATCAGGGAGAGAATGTTGACGAAGAGGATATACCAACGCGACCTCCTCCA
CATGCAAATGCTGTGATCCATCTTACTTTACCAAGCTCTCCCGCAAGTACGCAAGCTACGTTGAGCTCTTTTATG
CCCGTCGTCCGTTTCCTGGAGAAATGGCTCCGGCCAATCCAGTCGCCACCATGTATAGACCGCCCTTCGCCACCG
ATGCCCCACTCTCCCGGTAATGGGTCTGCTAGGCGTTGGTCATCTATGGCCTCCTTCATGCCCTCGTTCGTACCA
TTCACCTCCTCATCTCCACCCAAGACGGCGTCTCCGCCTTCTAGTGCACCATCTCGTAATCGATCGTTCACGTCG
CCTATTCCCTCTGTATTGAAACCGAAACCTCGATCTCGGCCAACTCGACCGCTTAAAGTTTTAATGTACTCTTCG
GATGGATACACCGAATCCTCAGTGCCGGCTCTGTGTCTTCTTATGGCTATTAAAGGGTTAAGTTTACCCGAGGCA
TATTTGGAACTTCAAGTTGCTAAGCGACGAAGTTTCTTTGTATATCATAATGATCTCGGACTTTTACGGAGGATG
GAAGCTAGATTGAGAGAGGAGAGGGAAAGGAGTGGGTTGTTGGCTTCGGCGAATGCATCTAATACTGGTGCGAAT
GCCTCTCCGCGAAGTTGGGGTGAGGGGATGGGAAGTGGTGGGCATCGGCGACCTGCGGCTAAAAGTGTGTCGTTT
GCGACGCCACCGAGTTTACCTGGATTCAAGAAGGTGGGGAATACGGTTACTCCGCCGTTGCAGCAGCAGGCGCTT
GAAGAAGATGTTTGTATGACGGTGGAGCCTCAGCCTGTGAATATGTCGGCTTCGGTGGGGAGTTTGCCGTCGGAT
GGTAGTTGTGGTGGAGAGTCTATTAGTATGGGAGTCGCAAAGAGCCGGCCGAGAGCGAGTACGAGTCCGTGGTTG
CCGAGTTTGTTTAGTGGTGATCATCAGACTTGGTTTAATGATCCTAGGTTTGATGGGAGCTTTCCGAGTCGAGTT
TTACCGTTTTTGTATTTGGGAAACTTGAATCATGCGGCGAATGCGTATATGTTGCATGCGCTGGGTATTACTCAT
GTCGTGTCTGTGGGTGAATGTGCGCTTGTGCCACCTGGAGTGTCTGGAGGACCTGGGATAAGCTATTTGGGACCT
AATCTCTATCATCGACCGAATAGTTCTCAGTATACGTCGAAAGGACCGGGTATGCATGGGTCGTTGTGGATTGAG
GAGAGGGAGGGGAGGATTAAGGTGTTGGATATTAAAGGAGTTTGTGATGATGGGATTGATACTTTGGAACCGCAG
TTGGAGCCGATTTGTGAATGGATTGATAAAGCTAGACAGGAAGGGGGACAAGTTCTTGTGCATTGTCGGGTTGGA
GTGTCGAGGAGTGCGACTGTCACAATTGCGTATGTAATGAAACATTTGAATTTACCGTTGGTGGATGCGTATTTG
ATTGTGCGGTCGAGACGGCTTTCGGTTTTGATTCAGCCGAATATGAGGTTGTTGTATAATTTGTGTGGGTGGGAG
ATCAAGTTGGCGAAGGATAGGGCGGGGAGGGATGAGAGAAAGTTGAAGAGGGAGTTGTCGAGGATGTTGAGTTGG
CCGTATCTTGCAAAAGAGGTGCATGCGCTTAATGAAAAATATTTGCATTGA
Gene >Agabi119p4|087110
ATGAACGGCGCCCACGGCGTCTCATATTCCTCCGACTTTCTCAGTCGTCTCCCCCAGCCCACCCCCCCTGTTCGT
CTACTCCCCGCCCAGGACTTTGCACAGCTTCATCTCTCCCATATTCTGTCGCATCCGCAGGATCATGTCCTTTTC
CCTTTTCTGCATGGTCTAGAGGGCGACAATGACGCTCAGAATGGCTTTTTCGCCTCTGCACCTAATGCGCACGAG
ACCCATGTATTCACCGATACCCACCATCCAAAAGTAAAGATTCCCAAGTACAGAGGCCTCATCTGGGTCGTTTGT
GAAGAGGATCTCGAGGCAGGCGCTGACTTGGTCACGCTTCGGATACTTCGCCGGAAGAATCTTTCTTCTACGACT
ATCACCTCGTCTCCCGACGGCTCTATGTATTCCTCTGGGTCCGAGTCTTTCGAAGAGGACGACGACGAAGATTAT
GAGATTGAAGACGAATATTCCCAAGGCGGTCACTCGGACGTGCGTGTCGGCGTCGTAGGCTCTGATGAGAACGCT
ATGCAACTCTCCGCGGGCGACACTCTTCCAATCATCACCGAAGACATCAAAGAAAAGACCCTTTCCCCAGATCTT
GACAATCAACCACACATGCATCCCGTAAATCACCGGTCTATCCATACCGCGACTTCTATTCCCCTAGCTTCTTCT
GTTTCGAGCACTGATACCAGTGCCTCAAGTACCGCTAGTTCTTCCTTTGACACCTCTACCTCTTCTTCAACATCG
CCAGATTCGGATTTAACGTCCTTCTCCTCCTGCTCTGTAGACCCTGACACTGTACCGGGGTGAGTATTGAATGTT
TTGCAAATCTCTCATCAAATCTGTCGACGTGGGGCTCTTTCGATGCAACATTGCAGGGTTATGTTTATTCCTCTC
GTGCTTGCGCCTTCTTGTGGTCGAGGCTTTGGCGCGTAGTGATGCTGGGCAATCACGTCTACGCTTCTTCATTGA
TGACGAGTCCAAAGCTGTCGACGAAGTTTCTTTAGTCTTTTCATAAACTGCAACTGAAAATGAAATGAATTAACG
CTTTGTCTCGATTAGTCTGGACTCCAAAGCTCAAACGCAATCCGCCGCCGATCTCAAACCTAGGGTGACGGATCC
AGCAGCTCCGCCATTGTTGACTGGCACATTTCGACCAAAAGAACTTTTGCGGCGCATAAAGCGAGACGGCGGCCA
TTGCGATTGGGAATTCACACCAGCCAAAGTTCCAGAAGGTATATCTTTGAGAAATTTTGGTATCCAAGTTGTACG
TAAATGCATCCCATTCTATGGATATCCAGAATCACTCATGCAACTGTTGTCATCCCTATTTGTAGCCCATCTATG
CCACCATTTCCGATATCGTCGTCTATTCCCCGAAAGGAGCATCACCGGCAGCTATTACACTTGCCCAGCGTTTCA
CACAGGCTATTCAAGCCAAACGTAAAGAGCGTATCCAAGCTCTTGGCTTGCCGGATGAGGATGGATCAAATGGTT
TACTGCATTATAACGTGTTTGTTTTGGATGCGGCCGAAGAGCGGATGAGGAAGGAACTGGCTCATCTGATGATGC
GCATATGCGTGGAGCCTGTCTCTGGTGGGCTTTTTGGTACCCGCAATAATAGTCACGGGGCGCATACTGATGGTT
CTGATGGTCATACTGTCGAGTCAGGGGCAGTCGAGTCGAGAGAGCGCGAGGAAACAGCTGTTGGGGAAATGGATA
TGGTTGTTGATGGTCCATCGCAGGAGCGGCGGCAGCAGGAAGAAGGTCTAACGATACCATTCCCCAATACGGTTG
ATTTTGCCCAACGTGAAAAGGAAGAAATGCGGGATTTGACAAAGGCATCCGAGATTGTCAGCCTTTTCCCGGCTT
TACCTCCTAGTCCTGAAGGATCATCTGGTTGGAATACTCCAGACGATGGTTCATCCGTTCAGCAGAGACCCAGAT
CGCTTTCTTCTGCATCGTCTCGTCATCCATATCGTTCGACACGTCCTCCTCATCTTCAATTCTTACCGCAAGTAC
AACCTCATATCCTACACAATAATTTTACGTTTTCACCACCCGATATCAATATCGACATTTCATCCACTGCCTCTT
TCTATGACCCTCATGTTGGTCAAATATTTCTGGGAAATTCTGGCGACGTACCATTGGCCCCTGAAAGGCTCCAGT
CGGGAAGTGTCGAAGATGACCCTTTTGATTATAAAGATACGAACAATCCTCAAAAAGGGTTTGGTTATGATATTT
GTATCGAATGTCATGATCTAGCGACTTTTCCCAGTGCTGCGCACCTTCGGGCTGCTGAGGAACATCTGTCAATGG
TGGATCTTCTATGGCTCGAGAAATGTGAGCGCCAGTGGCAAGAACGGTTTGATCAGGGAGAGAATGTTGACGAAG
AGGATATACCAACGCGACCTCCTCCACATGCAAATGCTGTGATCCATCTTACTTTACCAAGCTCTCCCGCAAGTA
CGCAAGCTACGTTGAGCTCTTTTATGCCCGTCGTCCGTTTCCTGGAGAAATGGCTCCGGCCAATCCAGTCGCCAC
CATGTATAGACCGCCCTTCGCCACCGATGCCCCACTCTCCCGGTAATGGGTCTGCTAGGCGTTGGTCATCTATGG
CCTCCTTCATGCCCTCGTTCGTACCATTCACCTCCTCATCTCCACCCAAGACGGCGTCTCCGCCTTCTAGTGCAC
CATCTCGTAATCGATCGTTCACGTCGCCTATTCCCTCTGTATTGAAACCGAAACCTCGATCTCGGCCAACTCGAC
CGCTTAAAGTTTTAATGTACTCTTCGGATGGATACACCGAATCCTCAGTGCCGGCTCTGTGTCTTCTTATGGCTA
TTAAAGGGTTAAGTTTACCCGAGGCATATTTGGAACTTCAAGTTGCTAAGCGACGAAGTTTCTTTGTATATCATA
ATGATCTCGGACTTTTACGGAGGATGGAAGCTAGATTGAGAGAGGAGAGGGAAAGGAGTGGGTTGTTGGCTTCGG
CGAATGCATCTAATACTGGTGCGAATGCCTCTCCGCGAAGTTGGGGTGAGGGGATGGGAAGTGGTGGGCATCGGC
GACCTGCGGCTAAAAGTGTGTCGTTTGCGACGCCACCGAGTTTACCTGGATTCAAGAAGGTGGGGAATACGGTTA
CTCCGCCGTTGCAGCAGCAGGCGCTTGAAGAAGATGTTTGTATGACGGTGGAGCCTCAGCCTGTGAATATGTCGG
CTTCGGTGGGGAGTTTGCCGTCGGATGGTAGTTGTGGTGGAGAGTCTATTAGTATGGGAGTCGCAAAGAGCCGGC
CGAGAGCGAGTACGAGTCCGTGGTTGCCGAGTTTGTTTAGTGGTGATCATCAGACTTGGTTTAATGATCCTAGGT
TTGATGGGAGCTTTCCGAGTCGAGTTTTACCGTTTTTGTATTTGGGAAACTTGTAAGTCGTCATGGTTTATTATC
CTTGGTGATGATTAATTTTTGTTTAGGAATCATGCGGCGAATGCGTATATGTTGCATGCGCTGGGTATTACTCAT
GTCGTGTCTGTGGGTGAATGTGCGCTTGTGCCACCTGGAGTGTCTGGAGGACCTGGGATAAGCTATTTGGGACCT
AATCTCTATCATCGACCGAATAGTTCTCAGTATACGTCGAAAGGACCGGGTATGCATGGGTCGTTGTGGATTGAG
GAGAGGGAGGGGAGGATTAAGGTGTTGGATATTAAAGGAGTTTGTGATGATGGGATTGATACTTTGGAACCGCAG
TTGGAGCCGATTTGTGAATGGATTGATAAAGCTAGACAGGAAGGGGGACAAGTTCTTGTGCATTGTCGGGTTGGA
GTGTCGAGGAGTGCGACTGTCACAGTGAGTAGTACATCGGCTTTTATCAGTTTCATCGATTTTGACCTGTTTGAT
AGATTGCGTATGTAATGAAACATTTGAATTTACCGTTGGTGGATGCGTATTTGATTGTGCGGTCGAGACGGCTTT
CGGTTTTGATTCAGCCGAATATGAGGTTGTTGTATAATTTGTGTGGGTGGGAGATCAAGTTGGCGAAGGATAGGG
CGGGGAGGGATGAGAGAAAGTTGAAGAGGGAGTTGTCGAGGATGTTGAGTTGGCCGTATCTTGCAAAAGAGGTGC
ATGCGCTTAATGAAAAATATTTGCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail