Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|086460
Gene name
Locationscaffold_05b:376102..377863
Strand-
Gene length (bp)1761
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02076 STE3 Pheromone A receptor 1.5E-109 44 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56502|BAR3_SCHCM Pheromone B alpha 3 receptor OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=BAR3 PE=3 SV=2 35 386 1.0E-101
sp|Q92275|BAR1_SCHCO Pheromone B alpha 1 receptor OS=Schizophyllum commune GN=BAR1 PE=3 SV=2 36 408 1.0E-97
sp|Q05659|BAR2_SCHCO Pheromone B alpha 2 receptor OS=Schizophyllum commune GN=BAR2 PE=2 SV=4 35 418 8.0E-93
sp|P31302|PRA1_USTMA Pheromone receptor 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRA1 PE=3 SV=1 43 333 7.0E-57
sp|Q99063|PRA1_USTHO Pheromone receptor 1 OS=Ustilago hordei GN=PRA1 PE=3 SV=1 43 333 4.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56502|BAR3_SCHCM Pheromone B alpha 3 receptor OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=BAR3 PE=3 SV=2 35 386 1.0E-101
sp|Q92275|BAR1_SCHCO Pheromone B alpha 1 receptor OS=Schizophyllum commune GN=BAR1 PE=3 SV=2 36 408 1.0E-97
sp|Q05659|BAR2_SCHCO Pheromone B alpha 2 receptor OS=Schizophyllum commune GN=BAR2 PE=2 SV=4 35 418 8.0E-93
sp|P31302|PRA1_USTMA Pheromone receptor 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRA1 PE=3 SV=1 43 333 7.0E-57
sp|Q99063|PRA1_USTHO Pheromone receptor 1 OS=Ustilago hordei GN=PRA1 PE=3 SV=1 43 333 4.0E-54
sp|P78741|BBR1_SCHCO Pheromone B beta 1 receptor OS=Schizophyllum commune GN=BBR1 PE=3 SV=2 41 377 6.0E-47
sp|P31303|PRA2_USTMD Pheromone receptor 2 OS=Ustilago maydis GN=PRA2 PE=3 SV=1 59 332 6.0E-33
sp|P06783|STE3_YEAST Pheromone a factor receptor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE3 PE=1 SV=1 44 337 1.0E-16
sp|P31397|MAP3_SCHPO Pheromone M-factor receptor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=map3 PE=2 SV=1 100 272 4.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0004932 mating-type factor pheromone receptor activity Yes
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0016021 integral component of membrane Yes
GO:0004888 transmembrane signaling receptor activity No
GO:0007165 signal transduction No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0004930 G protein-coupled receptor activity No
GO:0001653 peptide receptor activity No
GO:0008528 G protein-coupled peptide receptor activity No
GO:0065007 biological regulation No
GO:0031224 intrinsic component of membrane No
GO:0009987 cellular process No
GO:0050794 regulation of cellular process No
GO:0038023 signaling receptor activity No
GO:0016503 pheromone receptor activity No
GO:0050789 regulation of biological process No
GO:0060089 molecular transducer activity No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 2 19 17
2 34 56 22
3 69 88 19
4 103 125 22
5 145 167 22
6 187 209 22
7 239 261 22
8 304 323 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|086460
MLAVIFFGPVLLVLAHYARTTTDASERSKMGYPASYPNWVFSLFALIGFIIVSIPFPWHLEAWNTGTCLYMAWTA
IACLNQFINSVVWSKDAINYAPIWCDISSRIMVGTAVAIPAASLCINRRLYRIASVRRVMITKAEKRQQVMVDLA
IGLGLPILEMVLQICASGHRFNIFEEVGCYPYTYNTWVALLLVSAPPIVIGLVSAVYGVLSIRALYRTRAQSRAI
LSVYSNLNTGRYLRLMALSGLEIICTVPLGIYATYLNLQNGALHPWISWADTHYGYSRVDQIPSILWRANSIEES
SLELTRWICVVCAVLFFAFFGFADEARSRYRSAATTIGKHLGISTITSSSTVYDSQMPKDGTGSIPGPSEKRGRK
NSSDFSLSNQDQSVDDLPQEGAPATNEKKGHNLAYVFGKKKFNDEVFKPTFCYDDLVLPDIGGTLVNNESCEISP
VPTSGSSSASSITVPHLPEAPSDASDTDSPTLDPPFVSTEPRRNSHDMV*
Coding >Agabi119p4|086460
ATGCTGGCCGTCATCTTTTTTGGCCCGGTACTCCTCGTCCTCGCGCACTACGCACGCACCACCACCGACGCAAGC
GAGCGGTCAAAAATGGGCTACCCTGCTAGCTATCCTAACTGGGTTTTTTCCCTTTTTGCTTTGATCGGCTTCATC
ATCGTCTCTATCCCTTTCCCGTGGCATTTGGAAGCTTGGAATACTGGGACATGCCTCTACATGGCTTGGACTGCC
ATTGCGTGCTTGAATCAGTTCATCAACTCGGTGGTATGGAGTAAAGACGCCATCAACTATGCCCCCATCTGGTGC
GATATCTCTTCTAGGATCATGGTCGGAACCGCAGTTGCAATCCCAGCTGCTTCACTTTGCATCAATCGTCGTCTT
TATCGCATCGCTTCAGTGAGAAGAGTAATGATCACCAAGGCTGAGAAACGCCAACAGGTCATGGTTGACCTAGCT
ATCGGCCTCGGTCTTCCTATTCTCGAAATGGTTCTTCAGATCTGTGCTTCAGGCCATCGCTTCAACATCTTCGAA
GAAGTCGGCTGCTATCCTTATACCTATAATACTTGGGTTGCTCTCTTACTCGTATCGGCTCCCCCCATTGTCATC
GGTCTCGTTTCTGCTGTGTACGGTGTCCTCAGTATCCGGGCGCTATATCGCACACGTGCGCAGTCACGAGCAATT
CTCTCAGTCTATTCCAATCTCAATACCGGCCGATACTTGCGTCTCATGGCCCTCAGTGGCCTTGAAATCATTTGC
ACGGTTCCGCTCGGCATCTACGCTACATACCTCAATCTGCAGAATGGTGCTTTGCACCCTTGGATCAGCTGGGCA
GACACCCATTATGGATATTCCCGAGTGGATCAAATCCCTTCGATACTTTGGCGTGCGAATTCTATCGAGGAGAGC
TCACTTGAATTAACTCGATGGATATGTGTTGTTTGTGCGGTACTCTTCTTTGCTTTCTTCGGCTTTGCCGATGAG
GCCAGGTCAAGATACCGTTCTGCTGCTACCACGATTGGCAAACATCTTGGTATCTCAACTATCACCTCTTCCAGT
ACTGTCTACGATTCACAAATGCCGAAGGATGGTACTGGATCCATCCCAGGACCAAGCGAGAAACGCGGCCGCAAA
AACTCTTCTGATTTCTCGTTATCGAATCAAGATCAAAGCGTTGATGATCTTCCCCAAGAGGGCGCTCCTGCTACA
AATGAAAAGAAAGGCCACAACCTCGCTTATGTATTTGGCAAGAAAAAGTTCAACGATGAGGTCTTCAAGCCTACA
TTCTGCTACGACGATCTCGTTCTTCCTGATATCGGTGGCACCTTGGTGAATAACGAGTCGTGTGAGATTTCGCCT
GTGCCCACTTCAGGATCGTCTTCAGCATCGAGTATAACGGTCCCTCATCTTCCCGAAGCTCCCTCCGATGCGAGT
GATACGGATTCGCCCACATTGGACCCCCCATTCGTTTCCACAGAACCTCGCCGGAATTCTCATGATATGGTTTAA
Transcript >Agabi119p4|086460
ATGCTGGCCGTCATCTTTTTTGGCCCGGTACTCCTCGTCCTCGCGCACTACGCACGCACCACCACCGACGCAAGC
GAGCGGTCAAAAATGGGCTACCCTGCTAGCTATCCTAACTGGGTTTTTTCCCTTTTTGCTTTGATCGGCTTCATC
ATCGTCTCTATCCCTTTCCCGTGGCATTTGGAAGCTTGGAATACTGGGACATGCCTCTACATGGCTTGGACTGCC
ATTGCGTGCTTGAATCAGTTCATCAACTCGGTGGTATGGAGTAAAGACGCCATCAACTATGCCCCCATCTGGTGC
GATATCTCTTCTAGGATCATGGTCGGAACCGCAGTTGCAATCCCAGCTGCTTCACTTTGCATCAATCGTCGTCTT
TATCGCATCGCTTCAGTGAGAAGAGTAATGATCACCAAGGCTGAGAAACGCCAACAGGTCATGGTTGACCTAGCT
ATCGGCCTCGGTCTTCCTATTCTCGAAATGGTTCTTCAGATCTGTGCTTCAGGCCATCGCTTCAACATCTTCGAA
GAAGTCGGCTGCTATCCTTATACCTATAATACTTGGGTTGCTCTCTTACTCGTATCGGCTCCCCCCATTGTCATC
GGTCTCGTTTCTGCTGTGTACGGTGTCCTCAGTATCCGGGCGCTATATCGCACACGTGCGCAGTCACGAGCAATT
CTCTCAGTCTATTCCAATCTCAATACCGGCCGATACTTGCGTCTCATGGCCCTCAGTGGCCTTGAAATCATTTGC
ACGGTTCCGCTCGGCATCTACGCTACATACCTCAATCTGCAGAATGGTGCTTTGCACCCTTGGATCAGCTGGGCA
GACACCCATTATGGATATTCCCGAGTGGATCAAATCCCTTCGATACTTTGGCGTGCGAATTCTATCGAGGAGAGC
TCACTTGAATTAACTCGATGGATATGTGTTGTTTGTGCGGTACTCTTCTTTGCTTTCTTCGGCTTTGCCGATGAG
GCCAGGTCAAGATACCGTTCTGCTGCTACCACGATTGGCAAACATCTTGGTATCTCAACTATCACCTCTTCCAGT
ACTGTCTACGATTCACAAATGCCGAAGGATGGTACTGGATCCATCCCAGGACCAAGCGAGAAACGCGGCCGCAAA
AACTCTTCTGATTTCTCGTTATCGAATCAAGATCAAAGCGTTGATGATCTTCCCCAAGAGGGCGCTCCTGCTACA
AATGAAAAGAAAGGCCACAACCTCGCTTATGTATTTGGCAAGAAAAAGTTCAACGATGAGGTCTTCAAGCCTACA
TTCTGCTACGACGATCTCGTTCTTCCTGATATCGGTGGCACCTTGGTGAATAACGAGTCGTGTGAGATTTCGCCT
GTGCCCACTTCAGGATCGTCTTCAGCATCGAGTATAACGGTCCCTCATCTTCCCGAAGCTCCCTCCGATGCGAGT
GATACGGATTCGCCCACATTGGACCCCCCATTCGTTTCCACAGAACCTCGCCGGAATTCTCATGATATGGTTTAA
Gene >Agabi119p4|086460
ATGCTGGCCGTCATCTTTTTTGGCCCGGTCGGTTCCCCTTATCCCCCTCTGCAATCAACAGAGTCCTCTCCCCGC
CCAGGTACTCCTCGTCCTCGCGCACTACGCACGCACCACCACCGACGCAAGCGAGCGGTCAAAAATGGGCTACCC
TGCTAGCTATCCTAACTGGGTTTTTTCCCTTTTTGCTTTGATCGGCTTCATCATCGTCTCTATCCCTTTCCCGTG
GCATTTGGAAGGTGAGCACTTGAGCTGTAGCATTTCTTCAACCCCAAGAGGCTCAATCTACTTTCAGCTTGGAAT
ACTGGGACATGCCTCTACATGGCTTGGACTGCCATTGCGTGCTTGAATCAGTTCATCAACTCGGTGGTATGGAGT
AAAGACGCCATCAACTATGCCCCCATCTGGTGCGATATCTGTAAGTTCACCACAAATTTCATATTGGAACAGGTT
TGACAGGTCATGAAGCTTCTAGGATCATGGTCGGAACCGCAGTTGCAATCCCAGCTGCTTCACTTTGCATCAATC
GTCGTCTTTATCGCATCGCTTCAGTGAGAAGAGTAATGATCACCAAGGCTGAGAAACGCCAACAGGTCATGGTTG
ACCTAGCTATCGGCCTCGGTCTTCCTATTCTCGAAATGGTTCTTCGTAAGTCATCATCGCAAGATATCACTGAGT
GGGTCATCTGATAGGTCTGCAGAGATCTGTGCTTCAGGCCATCGCTTCAACATCTTCGAAGAAGTCGGCTGCTAT
CCTTATACCTATAATACTTGGGTTGCTCTCTTACTCGTATCGGCTCCCCCCATTGTCATCGGTCTCGTTTCTGCT
GTGTACGGTGTCCTCAGTATCCGGGCGCTATATCGCACACGTGCGCAGTCACGAGCAATTCTCTCAGTCTATTCC
AATCTCAATACCGGCCGATACTTGCGTCTCATGGCCCTCAGTGGCCTTGAAATCATTTGCACGGTTCCGCTCGGC
ATCTACGCTACATACCTCAATCTGCAGAATGGTGCTTTGCACCCTTGGATCAGCTGGGCAGACACCCATTATGGA
TATTCCCGAGTGGATCAAATCCCTTCGATACTTTGGCGTGCGAATTCTATCGAGGAGAGCTCACTTGAATTAACT
CGATGGATATGTGTTGTTTGTGCGGTACTCTTCTTTGCTTTCTTCGGCTTTGCCGATGAGGCCAGGTCAAGATAC
CGTTCTGCTGCTACCACGATTGGCAAACATCTTGGTATCTCAACTATCACCTCTTCCAGTACTGTCTACGATTCA
CAGTACGTTCTCCCTGCTTTCTTCTTTTCCGTCATACTTAATCTCCTTACTAGAATGCCGAAGGATGGTACTGGA
TCCATCCCAGGACCAAGCGAGAAACGCGGCCGCAAAAACTCTTCTGATTTCTCGTTATCGAATCAAGATCAAAGC
GTTGATGATCTTCCCCAAGAGGGCGCTCCTGCTACAAATGAAAAGAAAGGCCACAACCTCGCTTATGTATTTGGC
AAGAAAAAGTTCAACGATGAGGTCTTCAAGCCTACATTCTGCTACGACGATCTCGTTCTTCCTGATATCGGTGGC
ACCTTGGTGAATAACGAGTCGTGTGAGATTTCGCCTGTGCCCACTTCAGGATCGTCTTCAGCATCGAGTATAACG
GTCCCTCATCTTCCCGAAGCTCCCTCCGATGCGAGTGATACGGATTCGCCCACATTGGACCCCCCATTCGTTTCC
ACAGAACCTCGCCGGAATTCTCATGATATGGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail