Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|086360
Gene name
Locationscaffold_05b:351522..353510
Strand+
Gene length (bp)1988
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 9.8E-36 10 393

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VH78|ALG12_DROME Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Drosophila melanogaster GN=CG8412 PE=2 SV=1 5 467 3.0E-67
sp|A8MR93|ALG12_ARATH Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Arabidopsis thaliana GN=ALG12 PE=1 SV=1 16 468 2.0E-64
sp|P53730|ALG12_YEAST Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG12 PE=1 SV=1 3 488 2.0E-63
sp|Q8VDB2|ALG12_MOUSE Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Mus musculus GN=Alg12 PE=2 SV=2 16 475 4.0E-63
sp|Q23361|ALG12_CAEEL Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Caenorhabditis elegans GN=ZC513.5 PE=1 SV=2 19 456 4.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VH78|ALG12_DROME Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Drosophila melanogaster GN=CG8412 PE=2 SV=1 5 467 3.0E-67
sp|A8MR93|ALG12_ARATH Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Arabidopsis thaliana GN=ALG12 PE=1 SV=1 16 468 2.0E-64
sp|P53730|ALG12_YEAST Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG12 PE=1 SV=1 3 488 2.0E-63
sp|Q8VDB2|ALG12_MOUSE Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Mus musculus GN=Alg12 PE=2 SV=2 16 475 4.0E-63
sp|Q23361|ALG12_CAEEL Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Caenorhabditis elegans GN=ZC513.5 PE=1 SV=2 19 456 4.0E-63
sp|Q9BV10|ALG12_HUMAN Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Homo sapiens GN=ALG12 PE=1 SV=1 11 470 1.0E-57
sp|Q9USD4|ALG12_SCHPO Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg12 PE=3 SV=2 16 471 1.0E-50
sp|Q1LZA0|PIGB_BOVIN GPI mannosyltransferase 3 OS=Bos taurus GN=PIGB PE=2 SV=1 95 372 1.0E-06
sp|Q7SXZ1|PIGB_DANRE GPI mannosyltransferase 3 OS=Danio rerio GN=pigb PE=2 SV=1 174 346 5.0E-06
sp|Q9JJQ0|PIGB_MOUSE GPI mannosyltransferase 3 OS=Mus musculus GN=Pigb PE=2 SV=2 99 349 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22
2 94 111 17
3 139 161 22
4 182 204 22
5 214 236 22
6 288 310 22
7 320 342 22
8 349 371 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|086360
MISLLDVGFFALSWAYVLLAPYTKVEESFNIQAVHDFLSYGLLPDDLSHFDHFTFSGAVPRTFLGSAVLASTANP
FMIIAAYLNLISSKADLQLIVRLVLATCNAISLVVIRKAVSNRFGSGTASCFTLLTCSQFHLLFWMGRTLPNMFA
MPLINLAFAYASMYNSSRYSIRLSEKSWKLAFWCLAFSTVVLRVELVLLWVPFLLQALVQGRISFYTIISTNLLA
GTTAAVASFIFDSFFWQKDVLPELTSFIFNVAQGQSSNWGVSPFLDYFKIHLRKLLMTGLPLAFVGLLTDSRIIP
ILFPFIIYTALISNLGHKEWRFIIYTVPAFNVAAASGLRYLFTRRKTTIFGPISFIFALGFLAANFGLTGLLVHI
SMHNYPGGEAIAAFHQLVPATTLPPPHVHICNLAAQSGTTLFQHLNSPPYHSALYLWPNSVPPTTPWIYNKTENL
TLTELSRSPHFTHIISEQPPTSPEIAGHWNLMKAIPAFDRVVLDKELLTHKRWELPRRLFDLIRIVEKDQLWIYE
RK*
Coding >Agabi119p4|086360
ATGATCTCTCTCCTCGATGTCGGTTTCTTCGCGCTTAGCTGGGCCTATGTATTACTAGCACCGTACACAAAAGTC
GAAGAAAGTTTCAATATACAAGCCGTTCATGACTTCCTGTCATACGGCCTGTTGCCCGATGATTTGAGCCATTTT
GACCATTTCACTTTCTCAGGCGCTGTTCCCCGAACGTTCCTTGGAAGTGCTGTGCTTGCTTCTACTGCAAACCCA
TTCATGATTATAGCCGCATACCTCAATTTGATCTCTTCAAAGGCTGACCTCCAACTCATCGTTCGACTTGTTCTT
GCGACATGCAACGCTATCTCATTGGTTGTCATCCGGAAGGCAGTGTCAAATCGTTTCGGGTCAGGGACTGCTTCA
TGCTTCACTTTGCTCACATGTAGCCAGTTCCACCTCCTTTTTTGGATGGGTAGAACGCTGCCAAATATGTTTGCC
ATGCCGTTGATCAACCTGGCTTTCGCTTATGCCTCAATGTACAACAGCAGCCGCTATTCGATCCGGCTTTCCGAG
AAATCTTGGAAACTAGCTTTTTGGTGTCTAGCTTTTTCGACTGTCGTACTCCGCGTGGAGTTGGTTCTTCTCTGG
GTGCCTTTCTTACTTCAGGCATTAGTCCAGGGCCGTATTTCATTTTATACCATTATCTCGACGAATCTCCTAGCT
GGCACCACAGCTGCAGTGGCATCATTTATCTTTGATTCCTTCTTTTGGCAAAAGGATGTTCTGCCTGAATTAACA
TCATTCATTTTCAACGTCGCCCAAGGTCAAAGCTCCAACTGGGGGGTTTCCCCCTTCTTGGACTACTTTAAGATT
CATCTCCGTAAATTGCTCATGACCGGTCTTCCTTTGGCATTTGTGGGCTTACTTACAGATTCACGAATCATCCCG
ATTCTCTTTCCCTTCATCATTTATACTGCACTCATCAGCAACTTGGGTCACAAGGAATGGCGGTTCATAATTTAC
ACGGTACCCGCCTTCAATGTCGCCGCCGCTTCCGGTTTAAGATACCTGTTCACGAGGCGCAAAACGACCATATTT
GGCCCAATCTCGTTTATATTTGCCCTGGGCTTTCTGGCGGCGAACTTCGGATTGACCGGTCTTCTCGTCCATATA
TCCATGCACAATTATCCAGGCGGTGAGGCTATTGCTGCATTCCATCAACTTGTGCCTGCCACCACGTTGCCTCCA
CCCCACGTACACATCTGTAACCTCGCTGCGCAGTCGGGGACTACTCTTTTCCAACACCTCAATTCTCCGCCCTAC
CATTCGGCCCTATATCTGTGGCCTAATAGTGTGCCTCCCACGACTCCCTGGATTTATAACAAAACTGAGAATCTC
ACACTGACCGAACTCTCTCGGTCGCCTCATTTCACTCACATTATCTCTGAACAGCCTCCCACCAGCCCAGAAATC
GCCGGTCATTGGAATTTAATGAAGGCTATACCAGCCTTTGATCGCGTTGTGTTAGACAAAGAATTGCTGACCCAT
AAACGTTGGGAGTTGCCCAGAAGACTCTTTGATTTGATCAGAATTGTTGAAAAGGACCAGTTGTGGATATATGAA
CGCAAATAA
Transcript >Agabi119p4|086360
ATGATCTCTCTCCTCGATGTCGGTTTCTTCGCGCTTAGCTGGGCCTATGTATTACTAGCACCGTACACAAAAGTC
GAAGAAAGTTTCAATATACAAGCCGTTCATGACTTCCTGTCATACGGCCTGTTGCCCGATGATTTGAGCCATTTT
GACCATTTCACTTTCTCAGGCGCTGTTCCCCGAACGTTCCTTGGAAGTGCTGTGCTTGCTTCTACTGCAAACCCA
TTCATGATTATAGCCGCATACCTCAATTTGATCTCTTCAAAGGCTGACCTCCAACTCATCGTTCGACTTGTTCTT
GCGACATGCAACGCTATCTCATTGGTTGTCATCCGGAAGGCAGTGTCAAATCGTTTCGGGTCAGGGACTGCTTCA
TGCTTCACTTTGCTCACATGTAGCCAGTTCCACCTCCTTTTTTGGATGGGTAGAACGCTGCCAAATATGTTTGCC
ATGCCGTTGATCAACCTGGCTTTCGCTTATGCCTCAATGTACAACAGCAGCCGCTATTCGATCCGGCTTTCCGAG
AAATCTTGGAAACTAGCTTTTTGGTGTCTAGCTTTTTCGACTGTCGTACTCCGCGTGGAGTTGGTTCTTCTCTGG
GTGCCTTTCTTACTTCAGGCATTAGTCCAGGGCCGTATTTCATTTTATACCATTATCTCGACGAATCTCCTAGCT
GGCACCACAGCTGCAGTGGCATCATTTATCTTTGATTCCTTCTTTTGGCAAAAGGATGTTCTGCCTGAATTAACA
TCATTCATTTTCAACGTCGCCCAAGGTCAAAGCTCCAACTGGGGGGTTTCCCCCTTCTTGGACTACTTTAAGATT
CATCTCCGTAAATTGCTCATGACCGGTCTTCCTTTGGCATTTGTGGGCTTACTTACAGATTCACGAATCATCCCG
ATTCTCTTTCCCTTCATCATTTATACTGCACTCATCAGCAACTTGGGTCACAAGGAATGGCGGTTCATAATTTAC
ACGGTACCCGCCTTCAATGTCGCCGCCGCTTCCGGTTTAAGATACCTGTTCACGAGGCGCAAAACGACCATATTT
GGCCCAATCTCGTTTATATTTGCCCTGGGCTTTCTGGCGGCGAACTTCGGATTGACCGGTCTTCTCGTCCATATA
TCCATGCACAATTATCCAGGCGGTGAGGCTATTGCTGCATTCCATCAACTTGTGCCTGCCACCACGTTGCCTCCA
CCCCACGTACACATCTGTAACCTCGCTGCGCAGTCGGGGACTACTCTTTTCCAACACCTCAATTCTCCGCCCTAC
CATTCGGCCCTATATCTGTGGCCTAATAGTGTGCCTCCCACGACTCCCTGGATTTATAACAAAACTGAGAATCTC
ACACTGACCGAACTCTCTCGGTCGCCTCATTTCACTCACATTATCTCTGAACAGCCTCCCACCAGCCCAGAAATC
GCCGGTCATTGGAATTTAATGAAGGCTATACCAGCCTTTGATCGCGTTGTGTTAGACAAAGAATTGCTGACCCAT
AAACGTTGGGAGTTGCCCAGAAGACTCTTTGATTTGATCAGAATTGTTGAAAAGGACCAGTTGTGGATATATGAA
CGCAAATAA
Gene >Agabi119p4|086360
ATGATCTCTCTCCTCGATGTCGGTTTCTTCGCGCTTAGCTGGGCCTATGTATTACTAGCACCGTACACAAAAGTC
GAAGAAAGTTTCAATATACAAGCCGTTCATGACTTCCTGTCATACGGCCTGTTGCCCGATGATTTGAGCCATGTG
AGCCCAACGCCACGCATTAAACTTGAACAATGCTCATCTGCGAGCAGTTTGACCATTTCACTTTCTCAGGCGCTG
TTCCCCGAACGTTCCTTGGAAGTGCTGTGCTTGCTTCTACTGCAAACCCATTCATGATTATAGCCGCATACCTCA
ATTTGATCTCTTCAAAGGCTGACCTCCAACTCATCGGTTCGATTTTTGTTATTCTTGTATCAGTCACTTTTCCTG
AGCAGGTTTTACAGTTCGACTTGTTCTTGCGACATGCAACGCTATCTCATTGGTTGTCATCCGGAAGGCAGTGTC
AAATCGTTTCGGGTCAGGGACTGCTTCATGCTTCACTTTGCTCACATGTAGCCAGTTCCACCTCCTTTTTTGGAT
GGGTAGAACGCTGCCAAATATGTTTGCCATGCCGTTGAGTATGTTTCTATTCATTCTTTCCTTAGAATGCTTTTT
CATTCTAACGTAATCTTTGTATATGGCATTGCGCAGTCAACCTGGCTTTCGCTTATGCCTCAATGTACAACAGCA
GCCGCTATTCGATCCGGCTTTCCGAGAAATCTTGGAAACTAGCTTTTTGGTGTCTAGCTTTTTCGACTGTCGTAC
TCCGCGTGGAGTTGGTTCTTCTCTGGGTGCCTTTCTTACTTCAGGCATTAGTCCAGGGCCGTATTTCATTTTATA
CCATTATCTCGACGAATCTCCTAGCTGGCACCACAGCTGCAGGTAAGCCCGCGAAAGTCCACTGACGTATCGATG
ACTGAGCAATTGCATCTAGTGGCATCATTTATCTTTGATTCCTTCTTTTGGCAAAAGGATGTTCTGCCTGAATTA
ACATCATTCATTTTCAACGTCGCCCAAGGTCAAAGCTCCAACTGGGGGGTGAGTCCTTGAATATTGCATAATTCG
GACTCGACCTGCTGACCTTTGCACGAAACAGGTTTCCCCCTTCTTGGACTACTTTAAGATTCATCTCCGTAAATT
GCTCATGACCGGTCTTCCTTTGGCATTTGTGGGCTTACTTACAGATTCACGAATCATCCCGATTCTCTTTCCCTT
CATCATTTATACTGCACTCATCAGCAACTTGGGTCACAAGGAATGGCGGTTCATAATTTACACGGTACCCGCCTT
CAATGTCGCCGCCGCTTCCGGTTTAAGATACCTGTACGTTACTGGTTCCTAATTTCCGAATGATGCTCCTGAATA
AACCGACCTTCCTCCCCAGGTTCACGAGGCGCAAAACGACCATATTTGGCCCAATCTCGTTTATATTTGCCCTGG
GCTTTCTGGCGGCGAACTTCGGATTGACCGGTCTTCTCGTCCATATATCCATGCACAATTATCCAGGCGGTGAGG
CTATTGCTGCATTCCATCAACTTGTGCCTGCCACCACGTTGCGTAAGTTGATTTTCGTATCATTAATTCCCCATT
CTCATTCTATCACAATAATTATAGCTCCACCCCACGTACACATCTGTAACCTCGCTGCGCAGTCGGGGACTACTC
TTTTCCAACACCTCAATTCTCCGCCCTACCATTCGGCCCTATATCTGTGGCCTAATAGTGTGCCTCCCACGACTC
CCTGGATTTATAACAAAACTGAGAATCTCACACTGACCGAACTCTCTCGGTCGCCTCATTTCACTCACATTATCT
CTGAACAGCCTCCCACCAGCCCAGAAATCGCCGGTCATTGGAATTTAATGAAGGCTATACCAGCCTTTGATCGCG
TTGTGTTAGACAAAGAATTGCTGACCCATAAACGTTGGGAGTTGCCCAGAAGACTCTTTGATTTGATCAGAATTG
TTGAAAAGGACCAGTTGTGGATATATGAACGCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail