Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|086350
Gene name
Locationscaffold_05b:347315..351420
Strand-
Gene length (bp)4105
Transcript length (bp)3216
Coding sequence length (bp)3216
Protein length (aa) 1072

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 5.7E-36 797 1008
PF00005 ABC_tran ABC transporter 2.7E-27 403 554
PF19055 ABC2_membrane_7 ABC-2 type transporter 4.3E-06 584 639
PF19055 ABC2_membrane_7 ABC-2 type transporter 1.3E-06 784 1006
PF07974 EGF_2 EGF-like domain 1.4E-05 71 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 21 1071 0.0E+00
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 10 1071 0.0E+00
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 397 1008 2.0E-91
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 398 1008 1.0E-90
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 398 1008 1.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 21 1071 0.0E+00
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 10 1071 0.0E+00
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 397 1008 2.0E-91
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 398 1008 1.0E-90
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 398 1008 1.0E-90
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 398 1008 1.0E-89
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 398 1008 1.0E-86
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 401 1063 8.0E-77
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 388 1024 3.0E-63
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 77 665 4.0E-62
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 393 1064 4.0E-58
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 399 636 1.0E-56
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 386 637 2.0E-56
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 390 637 2.0E-56
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 399 636 7.0E-56
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 399 638 3.0E-55
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 399 641 1.0E-54
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 400 637 1.0E-54
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 358 641 2.0E-54
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 399 641 1.0E-53
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 393 647 2.0E-53
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 371 641 3.0E-53
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 390 641 3.0E-53
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 398 638 3.0E-53
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 402 698 4.0E-53
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 395 636 1.0E-52
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 402 659 2.0E-52
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 373 638 6.0E-52
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 399 653 7.0E-52
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 399 653 7.0E-52
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 399 717 2.0E-51
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 389 641 4.0E-51
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 398 638 6.0E-51
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 398 638 1.0E-50
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 383 638 7.0E-50
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 398 693 3.0E-49
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 398 660 1.0E-48
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 375 1013 2.0E-48
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 398 638 2.0E-48
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 398 657 4.0E-48
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 384 638 9.0E-48
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 394 641 9.0E-47
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 392 656 9.0E-47
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 400 643 1.0E-46
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 399 669 2.0E-46
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 370 697 3.0E-46
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 372 653 5.0E-46
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 399 673 9.0E-46
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 399 636 2.0E-45
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 386 673 2.0E-45
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 399 740 3.0E-45
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 369 638 1.0E-44
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 399 638 6.0E-44
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 399 663 9.0E-44
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 401 651 1.0E-43
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 399 636 2.0E-43
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 399 636 1.0E-42
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 372 646 1.0E-42
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 401 652 2.0E-42
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 401 653 2.0E-42
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 373 646 4.0E-42
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 399 638 6.0E-42
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 397 638 3.0E-41
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 401 638 4.0E-41
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 399 638 1.0E-40
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 399 916 1.0E-40
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 383 646 1.0E-40
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 399 639 2.0E-40
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 394 635 2.0E-40
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 373 646 2.0E-40
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 353 679 3.0E-40
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 353 954 4.0E-40
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 401 659 5.0E-40
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 366 674 2.0E-39
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 384 670 2.0E-39
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 397 639 3.0E-39
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 401 639 3.0E-39
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 401 674 5.0E-39
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 384 674 5.0E-39
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 384 639 8.0E-39
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 384 639 9.0E-39
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 384 674 9.0E-39
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 399 638 1.0E-38
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 401 639 1.0E-38
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 384 647 1.0E-38
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 373 639 2.0E-38
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 383 661 3.0E-38
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 401 893 3.0E-38
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 389 674 3.0E-38
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 377 643 6.0E-38
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 383 639 6.0E-38
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 401 646 8.0E-38
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 344 674 8.0E-38
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 397 674 9.0E-38
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 384 643 1.0E-37
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 401 645 1.0E-37
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 399 637 1.0E-37
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 401 648 2.0E-37
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 383 660 3.0E-37
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 398 638 3.0E-37
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 401 639 4.0E-37
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 401 692 4.0E-37
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 401 639 5.0E-37
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 384 646 7.0E-37
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 400 639 1.0E-36
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 320 639 1.0E-36
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 397 638 1.0E-36
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 358 645 1.0E-36
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 401 643 1.0E-36
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 394 642 1.0E-36
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 364 642 1.0E-36
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 401 637 1.0E-36
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 384 646 2.0E-36
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 399 638 2.0E-36
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 381 637 3.0E-36
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 384 643 3.0E-36
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 398 638 3.0E-36
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 398 636 4.0E-36
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 398 638 5.0E-36
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 384 670 7.0E-36
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 383 639 7.0E-36
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 368 645 8.0E-36
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 392 637 9.0E-36
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 398 638 1.0E-35
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 398 639 1.0E-35
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 399 638 2.0E-35
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 384 646 2.0E-35
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 398 1014 3.0E-35
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 384 639 3.0E-35
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 392 637 4.0E-35
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 401 667 5.0E-35
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 383 639 7.0E-35
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 366 643 1.0E-34
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 397 638 1.0E-34
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 399 638 7.0E-34
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 729 1008 9.0E-34
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 389 1030 1.0E-33
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 370 638 2.0E-33
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 392 637 3.0E-33
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 793 1071 7.0E-33
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 388 1067 3.0E-32
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 401 635 4.0E-32
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 400 646 8.0E-31
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 401 635 1.0E-30
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 397 650 2.0E-30
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 400 649 3.0E-29
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 389 620 6.0E-29
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 400 646 2.0E-28
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 400 649 4.0E-28
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 372 638 4.0E-28
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 391 659 4.0E-28
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 401 645 2.0E-27
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 391 649 2.0E-27
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 401 652 3.0E-27
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 400 646 3.0E-27
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 400 646 4.0E-27
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 400 646 5.0E-27
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 401 636 6.0E-27
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 401 649 1.0E-26
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 400 646 2.0E-26
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 401 649 3.0E-26
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 401 571 3.0E-26
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 390 644 5.0E-26
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 401 639 8.0E-26
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 401 659 8.0E-26
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 401 649 9.0E-26
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 400 639 9.0E-26
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 401 646 2.0E-25
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 400 646 5.0E-25
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 396 586 5.0E-25
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 401 571 9.0E-25
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 400 671 1.0E-24
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 387 651 1.0E-24
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 400 649 2.0E-24
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 401 649 2.0E-24
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 400 646 2.0E-24
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 401 649 3.0E-24
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 400 651 3.0E-24
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 401 870 4.0E-24
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 782 1016 1.0E-23
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 656 1008 1.0E-23
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 401 649 1.0E-23
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 400 646 1.0E-23
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 401 649 1.0E-23
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 399 639 1.0E-23
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 401 639 2.0E-23
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 401 930 2.0E-23
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 387 603 2.0E-23
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 366 649 4.0E-23
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 401 870 4.0E-23
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 400 649 5.0E-23
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 400 646 5.0E-23
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 401 1009 5.0E-23
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 792 1007 6.0E-23
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 401 647 7.0E-23
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 401 651 8.0E-23
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 399 718 9.0E-23
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 782 1063 1.0E-22
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 401 662 1.0E-22
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 401 646 1.0E-22
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 400 649 2.0E-22
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 401 639 3.0E-22
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 396 586 3.0E-22
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 737 1063 4.0E-22
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 399 636 5.0E-22
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 401 639 6.0E-22
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 401 609 9.0E-22
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 780 1013 1.0E-21
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 399 640 3.0E-21
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 368 616 3.0E-21
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 401 646 4.0E-21
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 401 653 6.0E-21
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 401 649 6.0E-21
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 401 643 6.0E-21
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 401 645 6.0E-21
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 801 1008 7.0E-21
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 386 698 9.0E-21
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 792 1063 1.0E-20
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 797 1071 1.0E-20
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 401 639 1.0E-20
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 359 639 1.0E-20
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 401 645 1.0E-20
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 400 649 1.0E-20
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 401 645 1.0E-20
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 792 1007 2.0E-20
sp|Q882S0|PHNC2_PSESM Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=phnC2 PE=3 SV=1 386 609 2.0E-20
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 393 605 2.0E-20
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 797 1057 3.0E-20
sp|O69063|HTXD_PSEST Hypophosphite import ATP-binding protein HtxD OS=Pseudomonas stutzeri GN=htxD PE=3 SV=1 386 628 3.0E-20
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 392 609 3.0E-20
sp|Q48HL2|PHNC2_PSE14 Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=phnC2 PE=3 SV=1 386 618 4.0E-20
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 392 609 4.0E-20
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 401 870 5.0E-20
sp|Q9CIQ6|PHNC_LACLA Phosphonates import ATP-binding protein PhnC OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=phnC PE=3 SV=1 394 609 8.0E-20
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 386 611 1.0E-19
sp|Q1LQB5|PHNC1_CUPMC Phosphonates import ATP-binding protein PhnC 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=phnC1 PE=3 SV=2 391 609 1.0E-19
sp|Q0ASQ1|PHNC_MARMM Phosphonates import ATP-binding protein PhnC OS=Maricaulis maris (strain MCS10) GN=phnC PE=3 SV=1 386 609 1.0E-19
sp|Q0K1N8|PHNC2_CUPNH Phosphonates import ATP-binding protein PhnC 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phnC2 PE=3 SV=1 391 609 1.0E-19
sp|Q0TUN8|ECFA3_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA3 PE=1 SV=1 379 609 2.0E-19
sp|Q4ZU82|PHNC2_PSEU2 Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=phnC2 PE=3 SV=1 386 609 2.0E-19
sp|Q46TK4|PHNC_CUPPJ Phosphonates import ATP-binding protein PhnC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=phnC PE=3 SV=1 397 609 2.0E-19
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 394 609 2.0E-19
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 796 1066 3.0E-19
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 401 662 3.0E-19
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 386 614 3.0E-19
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 368 614 3.0E-19
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 392 612 3.0E-19
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 400 609 4.0E-19
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 387 616 4.0E-19
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 796 1010 5.0E-19
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 366 611 5.0E-19
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 400 609 5.0E-19
sp|Q8YUV1|PHNC1_NOSS1 Phosphonates import ATP-binding protein PhnC 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=phnC1 PE=3 SV=1 390 609 5.0E-19
sp|Q6N9W0|METN1_RHOPA Methionine import ATP-binding protein MetN 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metN1 PE=3 SV=1 402 637 5.0E-19
sp|Q134N9|METN_RHOPS Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisB5) GN=metN PE=3 SV=2 402 609 7.0E-19
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 379 609 7.0E-19
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 377 636 8.0E-19
sp|Q8XHV3|ECFA2_CLOPE Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain 13 / Type A) GN=ecfA2 PE=3 SV=1 398 651 8.0E-19
sp|Q0TMS8|ECFA2_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA2 PE=3 SV=1 398 651 8.0E-19
sp|O06980|YVCR_BACSU Uncharacterized ABC transporter ATP-binding protein YvcR OS=Bacillus subtilis (strain 168) GN=yvcR PE=3 SV=1 408 584 8.0E-19
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 334 639 1.0E-18
sp|Q18KE1|PHNC1_HALWD Phosphonates import ATP-binding protein PhnC 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=phnC1 PE=3 SV=1 396 609 1.0E-18
sp|Q1IKM7|LOLD_KORVE Lipoprotein-releasing system ATP-binding protein LolD OS=Koribacter versatilis (strain Ellin345) GN=lolD PE=3 SV=2 398 584 1.0E-18
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 377 636 1.0E-18
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 801 1009 2.0E-18
sp|Q7M8M4|PHNC_WOLSU Phosphonates import ATP-binding protein PhnC OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=phnC PE=3 SV=1 397 616 2.0E-18
sp|Q83MC5|METN_SHIFL Methionine import ATP-binding protein MetN OS=Shigella flexneri GN=metN PE=3 SV=1 394 629 2.0E-18
sp|Q0T810|METN_SHIF8 Methionine import ATP-binding protein MetN OS=Shigella flexneri serotype 5b (strain 8401) GN=metN PE=3 SV=1 394 629 2.0E-18
sp|Q48PU6|METN1_PSE14 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN1 PE=3 SV=1 409 641 2.0E-18
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 371 611 2.0E-18
sp|P30750|METN_ECOLI Methionine import ATP-binding protein MetN OS=Escherichia coli (strain K12) GN=metN PE=1 SV=4 394 629 2.0E-18
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 386 616 2.0E-18
sp|Q32JQ8|METN_SHIDS Methionine import ATP-binding protein MetN OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metN PE=3 SV=1 394 629 2.0E-18
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 387 584 2.0E-18
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 401 639 3.0E-18
sp|Q1LQF6|METN_CUPMC Methionine import ATP-binding protein MetN OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=metN PE=3 SV=1 397 609 3.0E-18
sp|Q21BU8|METN_RHOPB Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisB18) GN=metN PE=3 SV=1 402 609 3.0E-18
sp|Q2SXD1|LOLD_BURTA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lolD PE=3 SV=1 401 605 3.0E-18
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 386 619 3.0E-18
sp|P42423|YXDL_BACSU ABC transporter ATP-binding protein YxdL OS=Bacillus subtilis (strain 168) GN=yxdL PE=2 SV=2 402 588 3.0E-18
sp|Q9MUN1|CYSA_MESVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Mesostigma viride GN=cysA PE=3 SV=1 386 689 3.0E-18
sp|Q0TLD2|METN_ECOL5 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metN PE=3 SV=1 394 629 3.0E-18
sp|Q3Z5F8|METN_SHISS Methionine import ATP-binding protein MetN OS=Shigella sonnei (strain Ss046) GN=metN PE=3 SV=1 394 629 3.0E-18
sp|Q1RFY9|METN_ECOUT Methionine import ATP-binding protein MetN OS=Escherichia coli (strain UTI89 / UPEC) GN=metN PE=3 SV=1 394 629 3.0E-18
sp|P63355|METN_ECOL6 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metN PE=3 SV=1 394 629 3.0E-18
sp|P63356|METN_ECO57 Methionine import ATP-binding protein MetN OS=Escherichia coli O157:H7 GN=metN PE=3 SV=1 394 629 3.0E-18
sp|Q3ATR5|MACB_CHLCH Macrolide export ATP-binding/permease protein MacB OS=Chlorobium chlorochromatii (strain CaD3) GN=macB PE=3 SV=1 393 606 3.0E-18
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 801 1008 4.0E-18
sp|Q13VD7|METN1_BURXL Methionine import ATP-binding protein MetN 1 OS=Burkholderia xenovorans (strain LB400) GN=metN1 PE=3 SV=1 397 609 4.0E-18
sp|Q8REG7|PHNC_FUSNN Phosphonates import ATP-binding protein PhnC OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=phnC PE=3 SV=1 397 616 4.0E-18
sp|Q98DT6|SSUB1_RHILO Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhizobium loti (strain MAFF303099) GN=ssuB1 PE=3 SV=1 389 605 4.0E-18
sp|Q73L25|LOLD_TREDE Lipoprotein-releasing system ATP-binding protein LolD OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lolD PE=3 SV=1 389 605 4.0E-18
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 394 609 4.0E-18
sp|Q4KKK8|METN1_PSEF5 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN1 PE=3 SV=1 409 609 4.0E-18
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 386 617 5.0E-18
sp|Q6MMY0|LOLD_BDEBA Lipoprotein-releasing system ATP-binding protein LolD OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lolD PE=3 SV=1 393 584 5.0E-18
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 402 599 5.0E-18
sp|Q8T6J0|ABCA7_DICDI ABC transporter A family member 7 OS=Dictyostelium discoideum GN=abcA7 PE=3 SV=1 402 618 5.0E-18
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 397 620 5.0E-18
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 399 609 5.0E-18
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 399 609 5.0E-18
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 399 609 5.0E-18
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 399 609 5.0E-18
sp|Q11SW8|LOLD_CYTH3 Lipoprotein-releasing system ATP-binding protein LolD OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lolD PE=3 SV=2 395 606 5.0E-18
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 812 1008 6.0E-18
sp|Q63SP4|LOLD_BURPS Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia pseudomallei (strain K96243) GN=lolD PE=3 SV=2 401 605 6.0E-18
sp|Q62J04|LOLD_BURMA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia mallei (strain ATCC 23344) GN=lolD PE=3 SV=2 401 605 6.0E-18
sp|Q0KDG3|METN_CUPNH Methionine import ATP-binding protein MetN OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=metN PE=3 SV=1 386 609 6.0E-18
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 790 1063 8.0E-18
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 397 637 8.0E-18
sp|Q02QM1|PHNC1_PSEAB Phosphonates import ATP-binding protein PhnC 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=phnC1 PE=3 SV=1 404 618 8.0E-18
sp|Q032D0|PHNC_LACLS Phosphonates import ATP-binding protein PhnC OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=phnC PE=3 SV=1 394 609 8.0E-18
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 386 719 9.0E-18
sp|Q3ISC1|PHNC1_NATPD Phosphonates import ATP-binding protein PhnC 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC1 PE=3 SV=1 387 606 9.0E-18
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 390 609 9.0E-18
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 368 633 9.0E-18
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 795 1067 1.0E-17
sp|Q4ZZR8|METN1_PSEU2 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metN1 PE=3 SV=1 409 609 1.0E-17
sp|Q6XYT0|PSTB_SPIKU Phosphate import ATP-binding protein PstB OS=Spiroplasma kunkelii GN=pstB PE=3 SV=1 380 635 1.0E-17
sp|Q9HT70|METN2_PSEAE Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN2 PE=3 SV=1 408 609 1.0E-17
sp|Q02DK6|METN2_PSEAB Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN2 PE=3 SV=1 408 609 1.0E-17
sp|A0PXX8|ECFA2_CLONN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium novyi (strain NT) GN=ecfA2 PE=3 SV=1 385 609 1.0E-17
sp|Q8KFE9|MACB_CHLTE Macrolide export ATP-binding/permease protein MacB OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=macB PE=3 SV=1 393 606 1.0E-17
sp|Q5PID0|METN1_SALPA Methionine import ATP-binding protein MetN 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN1 PE=3 SV=1 394 629 1.0E-17
sp|Q890R3|ECFA2_CLOTE Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium tetani (strain Massachusetts / E88) GN=ecfA2 PE=3 SV=1 398 645 1.0E-17
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 386 605 1.0E-17
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 401 584 1.0E-17
sp|Q8EB59|HMUV_SHEON Hemin import ATP-binding protein HmuV OS=Shewanella oneidensis (strain MR-1) GN=hmuV PE=3 SV=1 392 609 1.0E-17
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 386 605 1.0E-17
sp|Q7N8M2|METN_PHOLL Methionine import ATP-binding protein MetN OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metN PE=3 SV=1 394 629 1.0E-17
sp|Q13LC4|PHNC_BURXL Phosphonates import ATP-binding protein PhnC OS=Burkholderia xenovorans (strain LB400) GN=phnC PE=3 SV=1 399 609 1.0E-17
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 798 1008 2.0E-17
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 731 1007 2.0E-17
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 387 637 2.0E-17
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 386 605 2.0E-17
sp|Q325U1|METN_SHIBS Methionine import ATP-binding protein MetN OS=Shigella boydii serotype 4 (strain Sb227) GN=metN PE=3 SV=1 394 629 2.0E-17
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 386 609 2.0E-17
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 386 605 2.0E-17
sp|Q895C4|METN_CLOTE Methionine import ATP-binding protein MetN OS=Clostridium tetani (strain Massachusetts / E88) GN=metN PE=3 SV=1 396 605 2.0E-17
sp|Q3KK97|METN1_PSEPF Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=metN1 PE=3 SV=1 398 609 2.0E-17
sp|A3DJK5|ECFA2_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA2 PE=3 SV=1 385 626 2.0E-17
sp|Q9HYL7|PHNC2_PSEAE Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phnC2 PE=3 SV=1 404 618 2.0E-17
sp|Q667L9|METN2_YERPS Methionine import ATP-binding protein MetN 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN2 PE=3 SV=1 394 629 2.0E-17
sp|P57383|LOLD_BUCAI Lipoprotein-releasing system ATP-binding protein LolD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lolD PE=3 SV=1 393 586 2.0E-17
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 402 603 2.0E-17
sp|Q2W7J9|PSTB2_MAGSA Phosphate import ATP-binding protein PstB 2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pstB2 PE=3 SV=1 391 629 2.0E-17
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 386 605 2.0E-17
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 791 1071 3.0E-17
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 400 609 3.0E-17
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 383 611 3.0E-17
sp|Q18CJ0|ECFA1_PEPD6 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Peptoclostridium difficile (strain 630) GN=ecfA1 PE=3 SV=1 402 637 3.0E-17
sp|P15361|P29_MYCHR Probable ABC transporter ATP-binding protein p29 OS=Mycoplasma hyorhinis PE=3 SV=1 398 600 3.0E-17
sp|Q87UN4|METN2_PSESM Methionine import ATP-binding protein MetN 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN2 PE=3 SV=1 409 609 3.0E-17
sp|Q89ER4|SSUB_BRADU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ssuB PE=3 SV=1 387 610 3.0E-17
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 386 619 3.0E-17
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 379 744 3.0E-17
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 368 612 3.0E-17
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 386 719 3.0E-17
sp|Q5XBY7|PSTB1_STRP6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pstB1 PE=3 SV=2 387 580 3.0E-17
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 386 605 3.0E-17
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 386 719 3.0E-17
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 797 1071 4.0E-17
sp|Q1GKZ0|PHNC2_RUEST Phosphonates import ATP-binding protein PhnC 2 OS=Ruegeria sp. (strain TM1040) GN=phnC2 PE=3 SV=1 387 620 4.0E-17
sp|Q8Z990|METN1_SALTI Methionine import ATP-binding protein MetN 1 OS=Salmonella typhi GN=metN1 PE=3 SV=1 394 629 4.0E-17
sp|Q8ZRM9|METN1_SALTY Methionine import ATP-binding protein MetN 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN1 PE=3 SV=1 394 629 4.0E-17
sp|P75370|P29_MYCPN Probable ABC transporter ATP-binding protein p29 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=p29 PE=3 SV=1 387 600 4.0E-17
sp|P0CZ37|PSTB1_STRPQ Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pstB1 PE=3 SV=1 387 590 4.0E-17
sp|P63377|PSTB1_STRP8 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pstB1 PE=3 SV=1 387 590 4.0E-17
sp|P0CZ36|PSTB1_STRP3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pstB1 PE=3 SV=1 387 590 4.0E-17
sp|P63375|PSTB1_STRP1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M1 GN=pstB1 PE=3 SV=1 387 590 4.0E-17
sp|Q48TC3|PSTB1_STRPM Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pstB1 PE=3 SV=1 387 590 4.0E-17
sp|Q1J6D2|PSTB1_STRPF Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=pstB1 PE=3 SV=1 387 590 4.0E-17
sp|Q1JGL3|PSTB1_STRPD Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=pstB1 PE=3 SV=1 387 590 4.0E-17
sp|Q70YG7|HMUV_VIBA7 Hemin import ATP-binding protein HmuV OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=hmuV PE=1 SV=2 390 606 4.0E-17
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 386 617 4.0E-17
sp|Q02R79|POTA_PSEAB Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=potA PE=3 SV=1 384 642 4.0E-17
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 386 603 4.0E-17
sp|Q9HY19|POTA2_PSEAE Spermidine/putrescine import ATP-binding protein PotA 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA2 PE=3 SV=1 384 642 4.0E-17
sp|Q5WKL3|METN1_BACSK Methionine import ATP-binding protein MetN 1 OS=Bacillus clausii (strain KSM-K16) GN=metN1 PE=3 SV=1 393 629 4.0E-17
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 392 609 5.0E-17
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 345 613 5.0E-17
sp|Q2JB14|PHNC_FRASC Phosphonates import ATP-binding protein PhnC OS=Frankia sp. (strain CcI3) GN=phnC PE=3 SV=1 385 606 5.0E-17
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 397 609 5.0E-17
sp|Q57T09|METN1_SALCH Methionine import ATP-binding protein MetN 1 OS=Salmonella choleraesuis (strain SC-B67) GN=metN1 PE=3 SV=2 394 629 5.0E-17
sp|Q7N3S7|HMUV_PHOLL Hemin import ATP-binding protein HmuV OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hmuV PE=3 SV=1 386 609 5.0E-17
sp|Q1JLH7|PSTB1_STRPC Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=pstB1 PE=3 SV=1 387 590 5.0E-17
sp|Q1JBJ5|PSTB1_STRPB Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=pstB1 PE=3 SV=1 387 590 5.0E-17
sp|Q8XNY7|Y195_CLOPE Putative ABC transporter ATP-binding protein CPE0195 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0195 PE=3 SV=1 379 609 5.0E-17
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 393 637 5.0E-17
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 798 1065 6.0E-17
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 393 635 6.0E-17
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 398 614 6.0E-17
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 387 611 7.0E-17
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 387 611 7.0E-17
sp|Q12XW6|PSTB_METBU Phosphate import ATP-binding protein PstB OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pstB PE=3 SV=1 378 620 7.0E-17
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 387 614 7.0E-17
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 386 629 7.0E-17
sp|Q64Z80|LOLD_BACFR Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides fragilis (strain YCH46) GN=lolD PE=3 SV=1 387 584 7.0E-17
sp|Q04F14|METN1_OENOB Methionine import ATP-binding protein MetN 1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=metN1 PE=3 SV=1 402 609 7.0E-17
sp|Q7A7E3|METN1_STAAN Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain N315) GN=metN1 PE=3 SV=1 402 609 8.0E-17
sp|Q99WE1|METN1_STAAM Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metN1 PE=3 SV=1 402 609 8.0E-17
sp|Q7NWX3|CYSA2_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA2 PE=3 SV=1 379 637 8.0E-17
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 402 669 8.0E-17
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 387 620 9.0E-17
sp|Q9V1Q4|Y373_PYRAB Putative ABC transporter ATP-binding protein PYRAB03730 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB03730 PE=3 SV=1 388 658 9.0E-17
sp|Q5LI72|LOLD_BACFN Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lolD PE=3 SV=1 387 584 9.0E-17
sp|Q62H59|PHNC_BURMA Phosphonates import ATP-binding protein PhnC OS=Burkholderia mallei (strain ATCC 23344) GN=phnC PE=3 SV=1 399 609 9.0E-17
sp|Q9AB70|PHNC_CAUCR Phosphonates import ATP-binding protein PhnC OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=phnC PE=3 SV=1 387 614 9.0E-17
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 798 1008 1.0E-16
sp|Q9HNI8|PHNC_HALSA Phosphonates import ATP-binding protein PhnC OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=phnC PE=3 SV=1 385 678 1.0E-16
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 390 605 1.0E-16
sp|Q8U8D6|SSUB1_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB1 PE=3 SV=1 370 605 1.0E-16
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 345 613 1.0E-16
sp|Q63R24|PHNC_BURPS Phosphonates import ATP-binding protein PhnC OS=Burkholderia pseudomallei (strain K96243) GN=phnC PE=3 SV=2 399 609 1.0E-16
sp|Q3JNY2|PHNC_BURP1 Phosphonates import ATP-binding protein PhnC OS=Burkholderia pseudomallei (strain 1710b) GN=phnC PE=3 SV=1 399 609 1.0E-16
sp|Q13X01|LOLD_BURXL Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia xenovorans (strain LB400) GN=lolD PE=3 SV=1 368 586 1.0E-16
sp|Q8DU24|PSTB1_STRMU Phosphate import ATP-binding protein PstB 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pstB1 PE=3 SV=1 387 590 1.0E-16
sp|Q88WA5|METN1_LACPL Methionine import ATP-binding protein MetN 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN1 PE=3 SV=1 402 629 1.0E-16
sp|Q07LR5|METN_RHOP5 Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisA53) GN=metN PE=3 SV=1 402 609 1.0E-16
sp|Q2L219|LOLD_BORA1 Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella avium (strain 197N) GN=lolD PE=3 SV=1 401 606 1.0E-16
sp|Q6KIS8|PSTB_MYCMO Phosphate import ATP-binding protein PstB OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=pstB PE=3 SV=1 394 606 1.0E-16
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 392 584 1.0E-16
sp|Q3IL62|LOLD_PSEHT Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=lolD PE=3 SV=1 401 607 1.0E-16
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 402 613 1.0E-16
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 371 611 1.0E-16
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 372 614 1.0E-16
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 372 614 1.0E-16
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 372 614 1.0E-16
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 372 614 1.0E-16
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 372 614 1.0E-16
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 372 614 1.0E-16
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 372 614 1.0E-16
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 372 614 1.0E-16
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 386 609 2.0E-16
sp|Q2NRN5|METN_SODGM Methionine import ATP-binding protein MetN OS=Sodalis glossinidius (strain morsitans) GN=metN PE=3 SV=1 393 647 2.0E-16
sp|Q85A69|CYSA_ANTFO Sulfate/thiosulfate import ATP-binding protein CysA OS=Anthoceros formosae GN=cysA PE=2 SV=1 392 621 2.0E-16
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 385 656 2.0E-16
sp|P10091|CYSA_MARPO Sulfate/thiosulfate import ATP-binding protein CysA OS=Marchantia polymorpha GN=cysA PE=3 SV=1 386 621 2.0E-16
sp|Q1CFH7|METN2_YERPN Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metN2 PE=3 SV=1 394 629 2.0E-16
sp|Q8ZH38|METN1_YERPE Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis GN=metN1 PE=3 SV=1 394 629 2.0E-16
sp|Q1CAK4|METN1_YERPA Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metN1 PE=3 SV=1 394 629 2.0E-16
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 397 609 2.0E-16
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 399 606 2.0E-16
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 399 606 2.0E-16
sp|Q83CV2|LOLD_COXBU Lipoprotein-releasing system ATP-binding protein LolD OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lolD PE=3 SV=1 401 605 2.0E-16
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 382 618 2.0E-16
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 387 606 2.0E-16
sp|Q6N999|LOLD1_RHOPA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lolD1 PE=3 SV=1 393 605 2.0E-16
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 386 609 2.0E-16
sp|Q5HIL5|METN1_STAAC Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain COL) GN=metN1 PE=3 SV=1 402 609 2.0E-16
sp|Q2G0V2|METN1_STAA8 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN1 PE=3 SV=1 402 609 2.0E-16
sp|Q2FJI0|METN1_STAA3 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain USA300) GN=metN1 PE=3 SV=1 402 609 2.0E-16
sp|Q1IGZ0|METN2_PSEE4 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas entomophila (strain L48) GN=metN2 PE=3 SV=1 393 637 2.0E-16
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 398 609 2.0E-16
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 378 614 2.0E-16
sp|P49938|FHUC_BACSU Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Bacillus subtilis (strain 168) GN=fhuC PE=3 SV=1 391 609 2.0E-16
sp|Q2ISN3|PHNC2_RHOP2 Phosphonates import ATP-binding protein PhnC 2 OS=Rhodopseudomonas palustris (strain HaA2) GN=phnC2 PE=3 SV=1 387 609 2.0E-16
sp|Q8A1M1|LOLD_BACTN Lipoprotein-releasing system ATP-binding protein LolD OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lolD PE=3 SV=1 389 584 2.0E-16
sp|Q72D46|PSTB_DESVH Phosphate import ATP-binding protein PstB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pstB PE=3 SV=1 386 620 2.0E-16
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 396 602 2.0E-16
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 392 609 2.0E-16
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 400 609 2.0E-16
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 795 1008 3.0E-16
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 798 1039 3.0E-16
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 386 609 3.0E-16
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 389 640 3.0E-16
sp|Q2S3A3|LOLD_SALRD Lipoprotein-releasing system ATP-binding protein LolD OS=Salinibacter ruber (strain DSM 13855 / M31) GN=lolD PE=3 SV=1 400 586 3.0E-16
sp|Q6A6X6|METN_PROAC Methionine import ATP-binding protein MetN OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=metN PE=3 SV=1 384 609 3.0E-16
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 389 585 3.0E-16
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 402 609 3.0E-16
sp|Q2GE91|LOLD_NEOSM Lipoprotein-releasing system ATP-binding protein LolD OS=Neorickettsia sennetsu (strain Miyayama) GN=lolD PE=3 SV=1 386 586 3.0E-16
sp|Q1WSB9|ECFA2_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA2 PE=3 SV=1 393 606 3.0E-16
sp|Q6RCE0|PHNC_PSEST Phosphonates import ATP-binding protein PhnC OS=Pseudomonas stutzeri GN=phnC PE=3 SV=1 409 609 3.0E-16
sp|Q18C09|METN_PEPD6 Methionine import ATP-binding protein MetN OS=Peptoclostridium difficile (strain 630) GN=metN PE=3 SV=1 397 585 3.0E-16
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 378 617 3.0E-16
sp|Q8ZQE4|MACB_SALTY Macrolide export ATP-binding/permease protein MacB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=macB PE=3 SV=1 393 608 3.0E-16
sp|Q8ZR89|METN2_SALTY Methionine import ATP-binding protein MetN 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN2 PE=3 SV=1 402 669 3.0E-16
sp|Q57R58|MACB_SALCH Macrolide export ATP-binding/permease protein MacB OS=Salmonella choleraesuis (strain SC-B67) GN=macB PE=3 SV=1 393 608 3.0E-16
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 357 612 3.0E-16
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 371 616 3.0E-16
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 365 614 3.0E-16
sp|Q8Z824|MACB_SALTI Macrolide export ATP-binding/permease protein MacB OS=Salmonella typhi GN=macB PE=3 SV=1 393 608 3.0E-16
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 402 669 3.0E-16
sp|Q5PGK9|MACB_SALPA Macrolide export ATP-binding/permease protein MacB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=macB PE=3 SV=1 393 608 3.0E-16
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 398 613 4.0E-16
sp|Q3B276|LOLD2_CHLL7 Lipoprotein-releasing system ATP-binding protein LolD 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lolD2 PE=3 SV=1 399 584 4.0E-16
sp|Q83LR7|MACB_SHIFL Macrolide export ATP-binding/permease protein MacB OS=Shigella flexneri GN=macB PE=3 SV=1 393 606 4.0E-16
sp|Q73P71|PHNC_TREDE Phosphonates import ATP-binding protein PhnC OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=phnC PE=3 SV=1 393 610 4.0E-16
sp|Q9A502|METN_CAUCR Methionine import ATP-binding protein MetN OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metN PE=3 SV=1 393 604 4.0E-16
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 400 602 4.0E-16
sp|Q8NY21|METN1_STAAW Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MW2) GN=metN1 PE=3 SV=1 402 609 4.0E-16
sp|Q6GC27|METN1_STAAS Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MSSA476) GN=metN1 PE=3 SV=1 402 609 4.0E-16
sp|Q12L15|PSTB_SHEDO Phosphate import ATP-binding protein PstB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pstB PE=3 SV=1 385 635 5.0E-16
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 371 611 5.0E-16
sp|Q8TYV9|Y182_METKA Putative ABC transporter ATP-binding protein MK0182 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0182 PE=3 SV=1 405 609 5.0E-16
sp|O66646|LOLD_AQUAE Lipoprotein-releasing system ATP-binding protein LolD OS=Aquifex aeolicus (strain VF5) GN=lolD PE=1 SV=1 401 585 5.0E-16
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 371 616 5.0E-16
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 371 616 5.0E-16
sp|Q74AT2|LOLD_GEOSL Lipoprotein-releasing system ATP-binding protein LolD OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=lolD PE=3 SV=1 393 587 5.0E-16
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 387 614 5.0E-16
sp|Q748K0|Y3001_GEOSL Putative ABC transporter ATP-binding protein GSU3001 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU3001 PE=3 SV=1 393 609 5.0E-16
sp|Q5HC57|LOLD_EHRRW Lipoprotein-releasing system ATP-binding protein LolD OS=Ehrlichia ruminantium (strain Welgevonden) GN=lolD PE=3 SV=1 389 605 5.0E-16
sp|Q5FFC0|LOLD_EHRRG Lipoprotein-releasing system ATP-binding protein LolD OS=Ehrlichia ruminantium (strain Gardel) GN=lolD PE=3 SV=2 389 605 5.0E-16
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 371 614 5.0E-16
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 788 1071 6.0E-16
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 381 618 6.0E-16
sp|Q8CUY0|PHNC2_OCEIH Phosphonates import ATP-binding protein PhnC 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=phnC2 PE=3 SV=1 397 609 6.0E-16
sp|Q63GR8|METN2_BACCZ Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ZK / E33L) GN=metN2 PE=3 SV=1 389 609 6.0E-16
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 392 609 6.0E-16
sp|Q6GJL2|METN1_STAAR Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MRSA252) GN=metN1 PE=3 SV=1 402 609 6.0E-16
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 390 609 6.0E-16
sp|Q8EPK1|METN1_OCEIH Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2 402 609 7.0E-16
sp|A3CVD3|ECFA_METMJ Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ecfA PE=3 SV=1 397 626 7.0E-16
sp|Q4JTG9|METN_CORJK Methionine import ATP-binding protein MetN OS=Corynebacterium jeikeium (strain K411) GN=metN PE=3 SV=1 402 646 7.0E-16
sp|Q254K9|METN_CHLFF Methionine import ATP-binding protein MetN OS=Chlamydophila felis (strain Fe/C-56) GN=metN PE=3 SV=1 392 585 7.0E-16
sp|Q1RE44|MACB_ECOUT Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli (strain UTI89 / UPEC) GN=macB PE=3 SV=1 393 606 7.0E-16
sp|A1A9B7|MACB1_ECOK1 Macrolide export ATP-binding/permease protein MacB 1 OS=Escherichia coli O1:K1 / APEC GN=macB1 PE=3 SV=1 393 606 7.0E-16
sp|Q2NHW1|PSTB_METST Phosphate import ATP-binding protein PstB OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pstB PE=3 SV=1 398 584 7.0E-16
sp|Q6D1C4|METN3_PECAS Methionine import ATP-binding protein MetN 3 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN3 PE=3 SV=1 400 629 7.0E-16
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 386 606 8.0E-16
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 370 616 8.0E-16
sp|Q39IE7|METN1_BURL3 Methionine import ATP-binding protein MetN 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN1 PE=3 SV=1 404 609 8.0E-16
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 371 611 8.0E-16
sp|Q0TJH0|MACB_ECOL5 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=macB PE=3 SV=1 393 606 8.0E-16
sp|O32188|YUSV_BACSU Probable siderophore transport system ATP-binding protein YusV OS=Bacillus subtilis (strain 168) GN=yusV PE=1 SV=1 392 608 8.0E-16
sp|Q834B3|PSTB2_ENTFA Phosphate import ATP-binding protein PstB 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pstB2 PE=3 SV=1 370 584 8.0E-16
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 390 609 8.0E-16
sp|Q180A5|PSTB_PEPD6 Phosphate import ATP-binding protein PstB OS=Peptoclostridium difficile (strain 630) GN=pstB PE=3 SV=1 397 584 8.0E-16
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 398 616 8.0E-16
sp|Q73EL7|METN2_BACC1 Methionine import ATP-binding protein MetN 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN2 PE=3 SV=1 389 609 8.0E-16
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 402 624 8.0E-16
sp|Q4W575|FBPC_NEIMB Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbpC PE=3 SV=1 386 608 8.0E-16
sp|Q9JVH1|FBPC_NEIMA Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbpC PE=3 SV=1 386 608 8.0E-16
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 399 611 8.0E-16
sp|Q2LVM2|LOLD_SYNAS Lipoprotein-releasing system ATP-binding protein LolD OS=Syntrophus aciditrophicus (strain SB) GN=lolD PE=3 SV=1 397 584 8.0E-16
sp|P54954|YXEO_BACSU Probable amino-acid import ATP-binding protein YxeO OS=Bacillus subtilis (strain 168) GN=yxeO PE=1 SV=1 392 609 8.0E-16
sp|Q47YG8|LOLD_COLP3 Lipoprotein-releasing system ATP-binding protein LolD OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lolD PE=3 SV=1 393 584 8.0E-16
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 382 616 9.0E-16
sp|Q5FA19|FBPC_NEIG1 Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbpC PE=1 SV=1 386 608 9.0E-16
sp|Q1RK34|LOLD_RICBR Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia bellii (strain RML369-C) GN=lolD PE=3 SV=1 401 608 9.0E-16
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 397 609 9.0E-16
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 397 609 9.0E-16
sp|P75831|MACB_ECOLI Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli (strain K12) GN=macB PE=1 SV=1 393 606 9.0E-16
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 369 613 9.0E-16
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 398 616 9.0E-16
sp|Q8RD43|RBSA_CALS4 Ribose import ATP-binding protein RbsA OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rbsA PE=3 SV=1 387 614 9.0E-16
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 386 609 9.0E-16
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 357 613 1.0E-15
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 381 613 1.0E-15
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 357 613 1.0E-15
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 372 616 1.0E-15
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 385 611 1.0E-15
sp|Q1QCN2|LOLD_PSYCK Lipoprotein-releasing system ATP-binding protein LolD OS=Psychrobacter cryohalolentis (strain K5) GN=lolD PE=3 SV=1 401 603 1.0E-15
sp|Q32DZ9|MACB_SHIDS Macrolide export ATP-binding/permease protein MacB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=macB PE=3 SV=1 393 606 1.0E-15
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 374 609 1.0E-15
sp|Q7MU65|LOLD_PORGI Lipoprotein-releasing system ATP-binding protein LolD OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lolD PE=3 SV=1 392 587 1.0E-15
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 392 620 1.0E-15
sp|A1BE50|MACB_CHLPD Macrolide export ATP-binding/permease protein MacB OS=Chlorobium phaeobacteroides (strain DSM 266) GN=macB PE=3 SV=1 393 606 1.0E-15
sp|Q7NTU0|LOLD_CHRVO Lipoprotein-releasing system ATP-binding protein LolD OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lolD PE=3 SV=1 395 584 1.0E-15
sp|Q2P7S3|METN_XANOM Methionine import ATP-binding protein MetN OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metN PE=3 SV=1 393 609 1.0E-15
sp|Q5HV18|METN_CAMJR Methionine import ATP-binding protein MetN OS=Campylobacter jejuni (strain RM1221) GN=metN PE=3 SV=1 397 644 1.0E-15
sp|Q0PAB6|METN_CAMJE Methionine import ATP-binding protein MetN OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=metN PE=3 SV=1 397 644 1.0E-15
sp|Q46Y69|METN_CUPPJ Methionine import ATP-binding protein MetN OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=metN PE=3 SV=1 397 609 1.0E-15
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 390 609 1.0E-15
sp|Q5WET8|PSTB1_BACSK Phosphate import ATP-binding protein PstB 1 OS=Bacillus clausii (strain KSM-K16) GN=pstB1 PE=3 SV=1 379 620 1.0E-15
sp|A0K739|SSUB1_BURCH Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia cenocepacia (strain HI2424) GN=ssuB1 PE=3 SV=1 386 605 1.0E-15
sp|Q1BWL4|SSUB1_BURCA Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=ssuB1 PE=3 SV=1 386 605 1.0E-15
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 387 635 1.0E-15
sp|Q8FRX8|METN_COREF Methionine import ATP-binding protein MetN OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metN PE=3 SV=1 381 612 1.0E-15
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 386 603 1.0E-15
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 399 611 1.0E-15
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 393 606 1.0E-15
sp|Q5F6V6|MACB_NEIG1 Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=macB PE=3 SV=1 401 616 1.0E-15
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 392 620 1.0E-15
sp|Q20Y31|PHNC2_RHOPB Phosphonates import ATP-binding protein PhnC 2 OS=Rhodopseudomonas palustris (strain BisB18) GN=phnC2 PE=3 SV=1 387 667 1.0E-15
sp|Q21XJ9|SSUB_RHOFT Aliphatic sulfonates import ATP-binding protein SsuB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ssuB PE=3 SV=1 387 605 1.0E-15
sp|Q9EYM2|LOLD_ACIAD Lipoprotein-releasing system ATP-binding protein LolD OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lolD PE=3 SV=1 401 584 1.0E-15
sp|Q8D653|CYSA_VIBVU Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio vulnificus (strain CMCP6) GN=cysA PE=3 SV=1 386 609 1.0E-15
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 371 616 1.0E-15
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 371 616 1.0E-15
sp|Q1R0Z6|PHNC_CHRSD Phosphonates import ATP-binding protein PhnC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=phnC PE=3 SV=1 393 609 1.0E-15
sp|Q5MK06|MACB_NEIGO Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae GN=macB PE=1 SV=1 401 616 1.0E-15
sp|Q03ZL5|ECFA2_LEUMM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ecfA2 PE=1 SV=1 386 635 1.0E-15
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 402 669 2.0E-15
sp|Q222W0|PHNC1_RHOFT Phosphonates import ATP-binding protein PhnC 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=phnC1 PE=3 SV=1 397 609 2.0E-15
sp|Q97JB8|Y1368_CLOAB Putative ABC transporter ATP-binding protein CA_C1368 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1368 PE=3 SV=1 394 609 2.0E-15
sp|Q8R9I2|PSTB2_CALS4 Phosphate import ATP-binding protein PstB 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB2 PE=3 SV=1 397 584 2.0E-15
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 365 616 2.0E-15
sp|A0K5N5|METN1_BURCH Methionine import ATP-binding protein MetN 1 OS=Burkholderia cenocepacia (strain HI2424) GN=metN1 PE=3 SV=2 402 609 2.0E-15
sp|Q1BY14|METN1_BURCA Methionine import ATP-binding protein MetN 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN1 PE=3 SV=2 402 609 2.0E-15
sp|O34510|YFMF_BACSU Fe(3+)-citrate import ATP-binding protein YfmF OS=Bacillus subtilis (strain 168) GN=yfmF PE=3 SV=1 392 609 2.0E-15
sp|Q8NQH4|PHNC_CORGL Phosphonates import ATP-binding protein PhnC OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=phnC PE=3 SV=1 392 616 2.0E-15
sp|Q9KFL0|PHNC2_BACHD Phosphonates import ATP-binding protein PhnC 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=phnC2 PE=3 SV=2 387 617 2.0E-15
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 398 605 2.0E-15
sp|Q0SFY5|METN1_RHOJR Methionine import ATP-binding protein MetN 1 OS=Rhodococcus jostii (strain RHA1) GN=metN1 PE=3 SV=1 394 609 2.0E-15
sp|Q63H29|METN1_BACCZ Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ZK / E33L) GN=metN1 PE=3 SV=1 397 666 2.0E-15
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 398 613 2.0E-15
sp|Q5H503|METN_XANOR Methionine import ATP-binding protein MetN OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=metN PE=3 SV=2 393 609 2.0E-15
sp|Q5UW69|PHNC2_HALMA Phosphonates import ATP-binding protein PhnC 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=phnC2 PE=3 SV=1 393 609 2.0E-15
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 399 611 2.0E-15
sp|Q8PVG9|Y1996_METMA Putative ABC transporter ATP-binding protein MM_1996 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1996 PE=3 SV=1 400 626 2.0E-15
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 402 609 2.0E-15
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 384 621 2.0E-15
sp|Q8XED0|MACB_ECO57 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O157:H7 GN=macB PE=3 SV=1 393 606 2.0E-15
sp|Q084V3|PSTB_SHEFN Phosphate import ATP-binding protein PstB OS=Shewanella frigidimarina (strain NCIMB 400) GN=pstB PE=3 SV=1 385 635 2.0E-15
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 798 1009 4.0E-15
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 381 603 5.0E-15
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 798 1007 8.0E-15
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 381 613 9.0E-15
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 791 1071 1.0E-14
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 381 613 1.0E-14
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 793 1071 2.0E-14
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 790 1008 2.0E-14
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 801 1008 3.0E-14
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 801 1008 3.0E-14
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 381 613 4.0E-14
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 793 1071 6.0E-14
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 772 1060 6.0E-14
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 790 1008 6.0E-14
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 402 618 1.0E-13
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 710 1008 2.0E-13
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 369 613 5.0E-13
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 797 1008 2.0E-12
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 791 1071 4.0E-12
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 703 1008 5.0E-12
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 729 1070 6.0E-12
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 735 1009 9.0E-12
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 811 989 1.0E-11
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 811 989 2.0E-11
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 821 991 2.0E-11
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 451 664 2.0E-11
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 716 1007 5.0E-11
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 402 584 8.0E-11
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 703 1013 1.0E-10
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 381 558 1.0E-10
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 703 1009 2.0E-10
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 704 1008 2.0E-10
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 811 991 2.0E-10
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 793 994 3.0E-10
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 811 993 3.0E-10
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 780 1065 4.0E-10
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 811 991 7.0E-10
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 726 1021 7.0E-10
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 751 1070 8.0E-10
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 516 627 9.0E-10
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 782 1040 1.0E-09
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 811 989 1.0E-09
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 794 1023 2.0E-09
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 787 1009 3.0E-09
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 742 994 4.0E-09
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 792 1066 4.0E-09
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 741 1013 6.0E-09
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 811 989 7.0E-09
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 753 1051 1.0E-08
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 850 1055 1.0E-08
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 794 1003 2.0E-08
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 811 989 2.0E-08
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 734 1013 2.0E-08
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 792 1067 4.0E-08
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 401 639 4.0E-08
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 846 1064 5.0E-08
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 747 1057 5.0E-08
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 740 994 6.0E-08
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 716 994 6.0E-08
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 735 1003 8.0E-08
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 827 1058 9.0E-08
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 739 1065 1.0E-07
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 778 991 1.0E-07
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 735 1009 1.0E-07
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 709 994 1.0E-07
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 364 613 1.0E-07
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 846 1064 2.0E-07
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 756 1009 2.0E-07
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 811 991 2.0E-07
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 798 1013 2.0E-07
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 364 613 2.0E-07
sp|Q8PVG9|Y1996_METMA Putative ABC transporter ATP-binding protein MM_1996 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1996 PE=3 SV=1 399 609 2.0E-07
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 805 991 3.0E-07
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 797 1007 4.0E-07
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 827 1058 4.0E-07
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 403 632 4.0E-07
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 794 1009 5.0E-07
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 787 994 6.0E-07
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 839 1064 6.0E-07
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 801 1007 7.0E-07
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 850 1068 7.0E-07
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 703 1009 8.0E-07
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 772 1048 1.0E-06
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 849 1008 1.0E-06
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 849 1058 1.0E-06
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 797 1013 1.0E-06
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 754 1003 2.0E-06
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 801 1007 2.0E-06
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 809 1008 2.0E-06
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 811 993 2.0E-06
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 735 1018 2.0E-06
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 735 1018 2.0E-06
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 747 993 2.0E-06
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 798 1003 3.0E-06
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 841 1058 3.0E-06
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 798 1070 4.0E-06
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 849 1008 4.0E-06
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 805 989 5.0E-06
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 861 1057 5.0E-06
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 735 994 5.0E-06
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 798 994 5.0E-06
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 742 994 6.0E-06
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 705 1008 6.0E-06
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 575 652 6.0E-06
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 805 991 7.0E-06
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 805 991 8.0E-06
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 794 994 8.0E-06
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 850 1065 8.0E-06
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 747 993 9.0E-06
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 811 989 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0140359 ABC-type transporter activity Yes
GO:0005524 ATP binding Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0000166 nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0140657 ATP-dependent activity No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0017076 purine nucleotide binding No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 333 355 22
2 817 839 22
3 849 871 22
4 900 922 22
5 927 949 22
6 956 978 22
7 1045 1067 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|086350
MSFLTPNALRTMPWSLLLLVLSSTWVTAQRNQSVLDRQLDNGTSLPTALSLDYALAPGRCPPCFNCLLPAFTCGQ
YGQCNKFNGQCECPPGWSGIDCLTPQCDSLADRDHRRPRREGESCQCKDGWGGVNCNVCQNDNACAGFPIPEVSS
LLDGDNGGNMTCYKGGETVFSNHQMCNVTNRKILDMLPDRPPQVTFSCDRQDSTCSFQFWTAEVESFYCALEGCT
SETQPGYDTNTTIYACDKIKCSCVTGRFLCGESGSIDIGDFLKEEIRGPAQFSCKTGNGCKFEEPAMNDLIDSVF
GDSYITLQCEGGECLHYSQVPGYVRPPKPRNNLWLALSSSGAIVIVLLSSAVLWYAGRVGKGGDFGKIRLPEAET
AKLMSDHVPTSLYFSGISYSLGDRTIIDNISGNVKSGQVMAIMGASGAGKSTFLDILARKNKRGVVTGSMLVNGR
EVKDSEFKKVAGFVDQEDTLMSTLTVYETVLYSALLRLPRDMSFEAKKFRTLETMNELGILDIKDSRIGDSGTRS
ISGGEKRRVSIACELVTSPSILFLDEPTSGLDSFNAFNVVECLVSLARDYNRTVVFTIHQPRSNIVALFDQLVVL
GAGKLVYSGVYSKCPEYFTSIGYPCPTGFNIADYLIDLTMQASMERKDNGNSRSSVLASSSATSPAGDEEQGLPV
APHSAALSVRSNISANGIPEDTDESVVSSTGDYLRKKTSQIVNAVSSFASHRGPDASITPKLASLVQSYVDSTIA
ADIKAEGEEIARQASLATTRDSASGQLPDVAEETSLLRGRKRASWGTQFRILSGRAFKNLYRDPALLAAHYLSAI
GLAVLCGLFYHNITNDIAGFQNRLGLFFFTLALFGFSCLSSLGLFANERILFMRERSNGYYSTFTYFSSKILFDI
LPLRLVPPLMFGGIVYGLVGLVPTVAGFWKFLLALVLFNLTTASVVLLLSIVFDSISVASLVGTLVMLFNLMFTG
LLINRDTVPVAFRWLHTISFFHAAFESLAVNELRYLQLKEVKYGVELDVPAATILSTFGLRAQSYWWPNISLLGI
FFAVFTIGSFMYLHFFVKERR*
Coding >Agabi119p4|086350
ATGTCGTTTCTGACGCCAAACGCGTTGAGGACCATGCCTTGGTCCTTGCTTCTACTCGTACTATCGTCGACTTGG
GTTACTGCGCAGCGGAATCAATCCGTCCTTGATCGCCAGCTGGACAATGGGACTTCGCTTCCGACCGCGTTGTCA
CTGGATTATGCGCTTGCGCCTGGAAGATGCCCACCTTGTTTCAATTGCCTGCTTCCGGCATTTACTTGTGGCCAA
TATGGACAGTGCAACAAATTTAATGGCCAGTGTGAATGCCCTCCCGGCTGGTCCGGCATCGATTGTCTTACTCCT
CAGTGCGATTCCCTTGCGGATCGTGACCACCGAAGACCCAGAAGAGAAGGAGAATCATGCCAGTGCAAGGATGGC
TGGGGAGGCGTCAATTGCAATGTGTGTCAGAACGACAATGCTTGCGCCGGCTTTCCCATTCCTGAAGTTTCATCG
CTTCTTGACGGTGACAACGGCGGAAACATGACTTGTTATAAGGGTGGAGAAACGGTTTTCAGTAATCATCAAATG
TGCAATGTGACCAACAGAAAAATCCTCGATATGCTTCCAGACCGTCCGCCACAAGTGACATTTAGCTGTGATCGT
CAAGATTCAACTTGTTCCTTCCAGTTCTGGACTGCAGAGGTCGAATCCTTCTATTGTGCGTTGGAGGGATGCACC
TCGGAAACACAGCCAGGTTACGACACAAATACAACAATATATGCATGTGATAAAATCAAATGTAGCTGCGTTACC
GGTCGTTTCTTATGTGGCGAGTCTGGTAGTATTGATATCGGCGATTTCTTGAAGGAAGAAATACGGGGACCGGCT
CAGTTCAGCTGCAAGACTGGCAACGGCTGCAAGTTTGAAGAGCCAGCTATGAATGATCTCATCGACAGTGTATTT
GGTGATAGCTACATCACTTTGCAATGCGAGGGAGGAGAATGTCTTCATTATTCCCAAGTCCCAGGATATGTGCGG
CCCCCCAAACCGAGAAATAATCTCTGGCTGGCACTCAGTTCCTCGGGGGCGATCGTCATCGTGTTACTTTCTTCA
GCTGTCCTCTGGTATGCTGGTCGCGTAGGGAAGGGGGGCGATTTTGGAAAGATCCGTCTTCCAGAGGCGGAAACT
GCGAAACTAATGTCGGACCATGTTCCTACTTCCCTCTATTTCTCTGGAATATCATATTCCCTTGGTGATCGTACC
ATCATCGACAATATATCAGGTAATGTCAAATCAGGGCAGGTCATGGCCATCATGGGAGCGTCTGGTGCGGGAAAG
TCGACCTTCCTTGACATTCTTGCACGCAAGAACAAGCGAGGTGTTGTTACTGGCTCCATGTTAGTGAATGGGCGG
GAGGTGAAGGACAGTGAATTCAAGAAGGTTGCGGGTTTTGTTGACCAAGAGGATACTTTGATGTCTACGTTGACT
GTCTACGAGACAGTTTTGTACAGTGCACTACTGAGGTTGCCGAGGGACATGAGTTTCGAAGCGAAAAAGTTTCGG
ACTTTGGAGACCATGAATGAGCTAGGTATACTCGATATCAAGGATTCAAGAATCGGTGATTCTGGAACGCGTTCG
ATATCTGGGGGCGAAAAACGTCGTGTTTCAATTGCATGCGAGCTTGTCACAAGCCCGTCTATCTTGTTTTTGGAC
GAACCTACGAGTGGACTGGATTCCTTCAACGCATTCAACGTTGTTGAGTGCTTGGTTTCCCTTGCCCGCGATTAC
AACCGGACAGTTGTGTTCACTATCCATCAACCCCGTAGCAACATCGTCGCATTATTCGACCAACTTGTGGTTCTG
GGTGCCGGTAAACTAGTTTATTCTGGTGTATACTCAAAGTGCCCGGAATACTTTACATCGATCGGCTACCCTTGC
CCAACCGGGTTCAACATCGCCGATTATCTCATTGACCTGACGATGCAAGCTAGCATGGAACGCAAAGACAATGGG
AACAGCCGATCTAGCGTGCTTGCCTCATCCTCGGCTACGTCTCCCGCTGGCGATGAAGAACAAGGTCTTCCTGTA
GCTCCTCACTCTGCTGCCTTATCAGTTCGGTCCAATATATCCGCTAATGGTATACCAGAGGACACTGATGAGTCT
GTTGTCTCCTCCACGGGCGATTATCTACGGAAGAAGACGTCTCAGATTGTCAATGCTGTCAGTTCTTTTGCTTCA
CATCGTGGACCGGATGCGTCGATTACGCCGAAACTGGCTTCACTCGTACAGTCATACGTTGATAGCACGATAGCT
GCGGATATCAAAGCTGAGGGAGAAGAAATTGCTCGACAGGCGTCGCTGGCAACTACCCGTGATTCTGCGAGTGGG
CAACTGCCAGATGTTGCGGAGGAAACGTCATTGTTGCGTGGACGCAAGAGAGCATCTTGGGGTACTCAATTCAGA
ATTTTGAGTGGGAGGGCATTCAAGAACTTGTATCGTGACCCTGCGTTGCTGGCCGCCCATTACTTGTCCGCAATT
GGACTAGCAGTGCTTTGTGGACTGTTCTACCATAATATCACCAACGACATCGCTGGCTTCCAAAACCGTCTTGGA
CTCTTTTTTTTCACTCTAGCTCTATTTGGATTTTCTTGCTTGTCGAGTCTTGGTCTGTTTGCAAATGAGCGGATC
TTATTCATGCGCGAGCGCTCGAATGGTTACTACTCTACATTCACATACTTTTCATCGAAGATCTTATTCGATATC
CTCCCCCTTCGACTTGTTCCCCCTCTTATGTTTGGTGGTATCGTGTATGGCCTTGTTGGGCTTGTACCTACTGTT
GCCGGCTTTTGGAAGTTCCTACTTGCATTGGTTCTCTTTAACCTTACTACAGCGAGTGTTGTTTTACTGCTCTCT
ATCGTGTTTGACAGCATCAGCGTGGCGAGCTTGGTTGGAACATTGGTCATGCTGTTCAACCTTATGTTCACTGGT
TTACTCATCAACCGTGATACGGTTCCGGTGGCGTTCAGATGGCTGCACACGATCTCATTCTTCCATGCCGCATTC
GAGTCTCTTGCTGTGAACGAGCTACGATACCTGCAATTGAAGGAAGTCAAGTATGGGGTCGAGTTGGATGTACCC
GCTGCAACTATTTTGTCGACTTTTGGACTTCGAGCCCAGTCGTATTGGTGGCCAAACATCTCGCTACTCGGAATT
TTCTTTGCTGTGTTTACTATTGGGAGCTTTATGTACCTGCATTTCTTTGTGAAGGAAAGGCGATAA
Transcript >Agabi119p4|086350
ATGTCGTTTCTGACGCCAAACGCGTTGAGGACCATGCCTTGGTCCTTGCTTCTACTCGTACTATCGTCGACTTGG
GTTACTGCGCAGCGGAATCAATCCGTCCTTGATCGCCAGCTGGACAATGGGACTTCGCTTCCGACCGCGTTGTCA
CTGGATTATGCGCTTGCGCCTGGAAGATGCCCACCTTGTTTCAATTGCCTGCTTCCGGCATTTACTTGTGGCCAA
TATGGACAGTGCAACAAATTTAATGGCCAGTGTGAATGCCCTCCCGGCTGGTCCGGCATCGATTGTCTTACTCCT
CAGTGCGATTCCCTTGCGGATCGTGACCACCGAAGACCCAGAAGAGAAGGAGAATCATGCCAGTGCAAGGATGGC
TGGGGAGGCGTCAATTGCAATGTGTGTCAGAACGACAATGCTTGCGCCGGCTTTCCCATTCCTGAAGTTTCATCG
CTTCTTGACGGTGACAACGGCGGAAACATGACTTGTTATAAGGGTGGAGAAACGGTTTTCAGTAATCATCAAATG
TGCAATGTGACCAACAGAAAAATCCTCGATATGCTTCCAGACCGTCCGCCACAAGTGACATTTAGCTGTGATCGT
CAAGATTCAACTTGTTCCTTCCAGTTCTGGACTGCAGAGGTCGAATCCTTCTATTGTGCGTTGGAGGGATGCACC
TCGGAAACACAGCCAGGTTACGACACAAATACAACAATATATGCATGTGATAAAATCAAATGTAGCTGCGTTACC
GGTCGTTTCTTATGTGGCGAGTCTGGTAGTATTGATATCGGCGATTTCTTGAAGGAAGAAATACGGGGACCGGCT
CAGTTCAGCTGCAAGACTGGCAACGGCTGCAAGTTTGAAGAGCCAGCTATGAATGATCTCATCGACAGTGTATTT
GGTGATAGCTACATCACTTTGCAATGCGAGGGAGGAGAATGTCTTCATTATTCCCAAGTCCCAGGATATGTGCGG
CCCCCCAAACCGAGAAATAATCTCTGGCTGGCACTCAGTTCCTCGGGGGCGATCGTCATCGTGTTACTTTCTTCA
GCTGTCCTCTGGTATGCTGGTCGCGTAGGGAAGGGGGGCGATTTTGGAAAGATCCGTCTTCCAGAGGCGGAAACT
GCGAAACTAATGTCGGACCATGTTCCTACTTCCCTCTATTTCTCTGGAATATCATATTCCCTTGGTGATCGTACC
ATCATCGACAATATATCAGGTAATGTCAAATCAGGGCAGGTCATGGCCATCATGGGAGCGTCTGGTGCGGGAAAG
TCGACCTTCCTTGACATTCTTGCACGCAAGAACAAGCGAGGTGTTGTTACTGGCTCCATGTTAGTGAATGGGCGG
GAGGTGAAGGACAGTGAATTCAAGAAGGTTGCGGGTTTTGTTGACCAAGAGGATACTTTGATGTCTACGTTGACT
GTCTACGAGACAGTTTTGTACAGTGCACTACTGAGGTTGCCGAGGGACATGAGTTTCGAAGCGAAAAAGTTTCGG
ACTTTGGAGACCATGAATGAGCTAGGTATACTCGATATCAAGGATTCAAGAATCGGTGATTCTGGAACGCGTTCG
ATATCTGGGGGCGAAAAACGTCGTGTTTCAATTGCATGCGAGCTTGTCACAAGCCCGTCTATCTTGTTTTTGGAC
GAACCTACGAGTGGACTGGATTCCTTCAACGCATTCAACGTTGTTGAGTGCTTGGTTTCCCTTGCCCGCGATTAC
AACCGGACAGTTGTGTTCACTATCCATCAACCCCGTAGCAACATCGTCGCATTATTCGACCAACTTGTGGTTCTG
GGTGCCGGTAAACTAGTTTATTCTGGTGTATACTCAAAGTGCCCGGAATACTTTACATCGATCGGCTACCCTTGC
CCAACCGGGTTCAACATCGCCGATTATCTCATTGACCTGACGATGCAAGCTAGCATGGAACGCAAAGACAATGGG
AACAGCCGATCTAGCGTGCTTGCCTCATCCTCGGCTACGTCTCCCGCTGGCGATGAAGAACAAGGTCTTCCTGTA
GCTCCTCACTCTGCTGCCTTATCAGTTCGGTCCAATATATCCGCTAATGGTATACCAGAGGACACTGATGAGTCT
GTTGTCTCCTCCACGGGCGATTATCTACGGAAGAAGACGTCTCAGATTGTCAATGCTGTCAGTTCTTTTGCTTCA
CATCGTGGACCGGATGCGTCGATTACGCCGAAACTGGCTTCACTCGTACAGTCATACGTTGATAGCACGATAGCT
GCGGATATCAAAGCTGAGGGAGAAGAAATTGCTCGACAGGCGTCGCTGGCAACTACCCGTGATTCTGCGAGTGGG
CAACTGCCAGATGTTGCGGAGGAAACGTCATTGTTGCGTGGACGCAAGAGAGCATCTTGGGGTACTCAATTCAGA
ATTTTGAGTGGGAGGGCATTCAAGAACTTGTATCGTGACCCTGCGTTGCTGGCCGCCCATTACTTGTCCGCAATT
GGACTAGCAGTGCTTTGTGGACTGTTCTACCATAATATCACCAACGACATCGCTGGCTTCCAAAACCGTCTTGGA
CTCTTTTTTTTCACTCTAGCTCTATTTGGATTTTCTTGCTTGTCGAGTCTTGGTCTGTTTGCAAATGAGCGGATC
TTATTCATGCGCGAGCGCTCGAATGGTTACTACTCTACATTCACATACTTTTCATCGAAGATCTTATTCGATATC
CTCCCCCTTCGACTTGTTCCCCCTCTTATGTTTGGTGGTATCGTGTATGGCCTTGTTGGGCTTGTACCTACTGTT
GCCGGCTTTTGGAAGTTCCTACTTGCATTGGTTCTCTTTAACCTTACTACAGCGAGTGTTGTTTTACTGCTCTCT
ATCGTGTTTGACAGCATCAGCGTGGCGAGCTTGGTTGGAACATTGGTCATGCTGTTCAACCTTATGTTCACTGGT
TTACTCATCAACCGTGATACGGTTCCGGTGGCGTTCAGATGGCTGCACACGATCTCATTCTTCCATGCCGCATTC
GAGTCTCTTGCTGTGAACGAGCTACGATACCTGCAATTGAAGGAAGTCAAGTATGGGGTCGAGTTGGATGTACCC
GCTGCAACTATTTTGTCGACTTTTGGACTTCGAGCCCAGTCGTATTGGTGGCCAAACATCTCGCTACTCGGAATT
TTCTTTGCTGTGTTTACTATTGGGAGCTTTATGTACCTGCATTTCTTTGTGAAGGAAAGGCGATAA
Gene >Agabi119p4|086350
ATGTCGTTTCTGACGCCAAACGCGTTGAGGACCATGCCTTGGTCCTTGCTTCTACTCGTACTATCGTCGACTTGG
GTTACTGCGCAGCGGAATCAATCCGTCCTTGATCGCCAGCTGGACAATGGGACTTCGCTTCCGACCGTGAGTGGC
TGCGGAAACTTATGCCAGACCACTCATAACTATGCCTGCAGGCGTTGTCACTGGATTATGCGCTTGCGCCTGGTG
TGTATCTCGTTGCAAGAAGGTCTGATCATGCTCTGAATGTGTCTACGTCATCAGGAAGATGCCCACCTTGTTTCA
ATTGCCTGCTTCCGGCATTTACTTGTGGCCAATATGGACAGTGCAACAAATTTAATGGCCAGTGTGAATGCCCTC
CCGGCTGGTCCGGCATCGATTGTCTTACTCCTCGTGTGCATTTTTCGCTTGCGTCTAACTTCGTAACTGATGTAG
CTTTTAGAGTGCGATTCCCTTGCGGATCGTGACCACCGAAGACCCAGAAGAGAAGGAGAATCATGCCAGTGCAAG
GATGGCTGGGGAGGCGTCAATTGCAATGGTGCGTTTTCGCATGAGTATCTCGTTATGCGTCAATTGATTCGCGAT
ATCAGTGTGTCAGAACGACAATGCTTGCGCCGGCTTTCCCATTCCTGAAGTTTCATCGCTTCTTGACGGTGACAA
CGGCGGAAACATGACTTGTTATAAGGGTGGAGAAACGGTTTTCAGTAATCATCAAATGTGCAATGTGACCAGTAT
GTCTGTTCAATTCCATGCATCTTCTCGCCTAAGCCCTCCGTCCAGACAGAAAAATCCTCGATATGCTTCCAGACC
GTCCGCCACAAGTGACATTTAGCTGTGATCGTCAAGATTCAACTTGTTCCTTCCAGTTCTGGACTGCAGAGGTCG
AATCCTTCTATTGTGCGTTGGAGGGATGCACCTCGGAAACACAGCCAGGTTACGACACAAATACAACAATATATG
CATGTGATAAAATCAAATGTAGCTGCGTTACCGGTCGTTTCTTATGTGGCGAGTCTGGTAGTATTGGTACGTAAT
AGGTGTTTTCTGTTACACAGGTCATCGGTGACAACTCTCCCAGATATCGGCGATTTCTTGAAGGAAGAAATACGG
GGACCGGCTCAGTTCAGCTGCAAGACTGGCAACGGCTGCAAGTTTGAAGAGCCAGCTATGAATGATCTCATCGAC
AGTGTATTTGGTGATAGCTACATCACTTTGCAATGCGAGGGAGGAGAATGTCTTCATTATTCCCAAGTCCCAGGA
TATGTGGTAAGTCTGGACGTTGAGTGACATTAAAGTGAAGGCTCTCATGACTAGTAGCGGCCCCCCAAACCGAGA
AATAATCTCTGGCTGGCACTCAGTTCCTCGGGGGCGATCGTCATCGTGTTACTTTCTTCAGCTGGTCAGTGGTTC
GCAATCAAGTATACATCATTTATATTGAATACCCCACGTAGTCCTCTGGTATGCTGGTCGCGTAGGGAAGGGGGG
CGATTTTGGAAAGATCCGTCTTCCAGAGGCGGAAACTGCGAAACTAATGTCGGACCATGTTCCTACTTCCCTCTA
TTTCTCTGGAATATCATATTCCCTTGGTGATCGTACCATCATCGACAATATATCAGGTAATGTCAAATCAGGGCA
GGTCATGGCCATCATGGGAGCGTCTGGTGCGGGAAAGTCGACCTTCCTTGACATTCTTGCACGCAAGAACAAGCG
AGGTGTTGTTACTGGCTCCATGTTAGTGAATGGGCGGGAGGTGAAGGACAGTGAATTCAAGAAGGTTGCGGGTTT
TGTTGACCAAGAGGATACTTTGATGTCTACGTTGACTGTCTACGAGACAGTTTTGTACAGTGCACTACTGAGGTT
GCCGAGGGACATGAGTTTCGAAGCGAAAAAGTTTCGGACTTTGGAGACCATGAATGAGCTAGGTATACTCGATAT
CAAGGATTCAAGAATCGGTGATTCTGGTATGTACTATATCCTGACTACGATACGCATCTCATCCCGCGGTTTTAG
GAACGCGTTCGATATCTGGGGGCGAAAAACGTCGTGTTTCAATTGCATGCGAGCTTGTCACAAGCCCGTCTATCT
TGTTTTTGGACGAACCTACGAGTGGTGAGTAATCTTTCCGGCTCTTGTGACACTCGATCGGTTGGTGACTCTCAG
CAGGACTGGATTCCTTCAACGCATTCAACGTTGTTGAGTGCTTGGTTTCCCTTGCCCGCGATTACAACCGGACAG
TTGTGTTCACTATCCATCAACCCCGTAGCAACATCGTCGCATTATTCGACCAACTTGTGGTTCTGGGTGCCGGTA
AACTAGTTTATTCTGGTGTATACTCAAAGTGCCCGGAATACTTTACATCGATCGGCTACCCTTGCCCAACCGGGT
TCAACATCGCCGATTATCTCAGTGAGTGATCGCATGAATCTGCGATACAGAAAACTCAACAGTTTTATAGTTGAC
CTGACGATGCAAGCTAGCATGGAACGCAAAGACAATGGGAACAGCCGATCTAGCGTGCTTGCCTCATCCTCGGCT
ACGTCTCCCGCTGGCGATGAAGAACAAGGTCTTCCTGTAGCTCCTCACTCTGCTGCCTTATCAGTTCGGTCCAAT
ATATCCGCTAATGGTATACCAGAGGACACTGATGAGTCTGTTGTCTCCTCCACGGGCGATTATCTACGGAAGAAG
ACGTCTCAGATTGTCAATGCTGTCAGTTCTTTTGCTTCACATCGTGGACCGGATGCGTCGATTACGCCGAAACTG
GCTTCACTCGTACAGTCATACGTTGATAGCACGATAGCTGCGGATATCAAAGCTGAGGGAGAAGAAATTGCTCGA
CAGGCGTCGCTGGCAACTACCCGTGATTCTGCGAGTGGGCAACTGCCAGATGTTGCGGAGGAAACGTCATTGTTG
CGTGGACGCAAGAGAGCATCTTGGGGTACTCAATTCAGAATTTTGAGTGGGAGGGCATTCAAGAACTTGTATCGT
GACCCTGCGTTGCTGGCCGCCCATTACTTGTCCGCAATTGGACTAGCAGGTGAGTGTTTGCGTGGAGTTGATGAT
GGCTTGACTGATCATGAGCCGTCTTTTTGCGACTACAGTGCTTTGTGGACTGTTCTACCATAATATCACGTAGGT
GTTGTCATTTGTTGCTTGACCATCATTTCTCAGGAAGATCCTAGCAACGACATCGCTGGCTTCCAAAACCGTCTT
GGACTCTTTTTTTTCACTCTAGCTCTATTTGGATTTTCTTGCTTGTCGAGTCTTGGTCTGTTTGCAAATGAGCGG
ATCTTATTCATGCGCGAGCGGTAGGTGATGATGATATGATTGTCGTGTATGTGGTCTTGAGCTGAGTTCACAGCT
CGAATGGTTACTACTCTACATTCACATACTTTTCATCGAAGGTGATTGTTTCGCGGCGCCGCGGCTACTTGTCGG
CTAATCATGAGAAACATAGATCTTATTCGATATCCTCCCCCTTCGACTTGTTCCCCCTCTTATGTTTGGTGGTAT
CGTGTATGGCCTTGTTGGGCTTGTACCTACTGTTGCCGGCTTTTGGAAGTTCCTACTTGCATTGGTTCTCTTTAA
CCTTACTACAGCGAGTGTTGTTTTACTGCTCTCTATCGTGTTTGACAGCATCAGCGTGGCGAGCTTGGTTGGAAC
ATTGGTCATGCTGTTCAAGTAAGTTGCCGGTTTCCGCTGCATGAATATAGGTATCCTGAAGATCGGTGATCGCCT
AGCCTTATGTTCACTGGTTTACTCATCAACCGTGATACGGTTCCGGTGGCGTTCAGATGGCTGCACACGATCTCA
TTCTTCCATGCCGCATTCGAGTCTCTTGCTGTGAACGAGCTACGATACCTGCAATTGAAGGAAGTCAAGTATGGG
GTCGAGTTGGATGTACCCGCTGCAACTATTTTGTCGACTTTTGGACTTCGAGCCCAGGTGAGTATTTCGACTTTG
CTCTGACTAGATGTTAATGTGCCCTTAGTCGTATTGGTGGCCAAACATCTCGCTACTCGGAATTTTCTTTGCTGT
GTTTACTATTGGGAGCTTTATGTACCTGCATTTCTTTGTGAAGGAAAGGCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail