Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|086260
Gene name
Locationscaffold_05b:327048..327752
Strand+
Gene length (bp)704
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00227 Proteasome Proteasome subunit 3.5E-39 3 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CQ12|PSB4_CRYNJ Probable proteasome subunit beta type-4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPR1 PE=3 SV=1 1 194 3.0E-80
sp|P0CQ13|PSB4_CRYNB Probable proteasome subunit beta type-4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPR1 PE=3 SV=1 1 194 3.0E-80
sp|P22141|PSB4_YEAST Proteasome subunit beta type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE1 PE=1 SV=2 13 193 2.0E-64
sp|O23714|PSB2A_ARATH Proteasome subunit beta type-2-A OS=Arabidopsis thaliana GN=PBD1 PE=1 SV=1 1 191 2.0E-63
sp|O24633|PSB2B_ARATH Proteasome subunit beta type-2-B OS=Arabidopsis thaliana GN=PBD2 PE=1 SV=1 1 191 4.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CQ12|PSB4_CRYNJ Probable proteasome subunit beta type-4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPR1 PE=3 SV=1 1 194 3.0E-80
sp|P0CQ13|PSB4_CRYNB Probable proteasome subunit beta type-4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPR1 PE=3 SV=1 1 194 3.0E-80
sp|P22141|PSB4_YEAST Proteasome subunit beta type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE1 PE=1 SV=2 13 193 2.0E-64
sp|O23714|PSB2A_ARATH Proteasome subunit beta type-2-A OS=Arabidopsis thaliana GN=PBD1 PE=1 SV=1 1 191 2.0E-63
sp|O24633|PSB2B_ARATH Proteasome subunit beta type-2-B OS=Arabidopsis thaliana GN=PBD2 PE=1 SV=1 1 191 4.0E-63
sp|Q09720|PSB4_SCHPO Probable proteasome subunit beta type-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31A2.04c PE=3 SV=1 1 194 2.0E-61
sp|Q9LST6|PSB2_ORYSJ Proteasome subunit beta type-2 OS=Oryza sativa subsp. japonica GN=PBD1 PE=2 SV=2 1 191 2.0E-60
sp|Q9P6U7|PSB4_NEUCR Probable proteasome subunit beta type-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pcb-4 PE=3 SV=2 1 194 3.0E-60
sp|P49721|PSB2_HUMAN Proteasome subunit beta type-2 OS=Homo sapiens GN=PSMB2 PE=1 SV=1 1 193 1.0E-59
sp|Q5E9K0|PSB2_BOVIN Proteasome subunit beta type-2 OS=Bos taurus GN=PSMB2 PE=1 SV=1 1 193 5.0E-59
sp|P40307|PSB2_RAT Proteasome subunit beta type-2 OS=Rattus norvegicus GN=Psmb2 PE=1 SV=1 1 193 6.0E-59
sp|Q9R1P3|PSB2_MOUSE Proteasome subunit beta type-2 OS=Mus musculus GN=Psmb2 PE=1 SV=1 1 193 9.0E-59
sp|A5DB52|PSB4_PICGU Probable proteasome subunit beta type-4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRO2 PE=3 SV=1 13 190 1.0E-56
sp|Q55DY7|PSB2_DICDI Proteasome subunit beta type-2 OS=Dictyostelium discoideum GN=psmB2 PE=3 SV=1 1 190 1.0E-56
sp|Q9VQE5|PSB2_DROME Probable proteasome subunit beta type-2 OS=Drosophila melanogaster GN=Prosbeta4R2 PE=2 SV=3 1 193 2.0E-44
sp|Q9NHC6|PSB2_TRYBB Proteasome subunit beta type-2 OS=Trypanosoma brucei brucei GN=PSB4 PE=2 SV=1 2 192 4.0E-39
sp|P91477|PSB2_CAEEL Proteasome subunit beta type-2 OS=Caenorhabditis elegans GN=pbs-4 PE=3 SV=2 12 193 1.0E-37
sp|Q8SRF1|PSB4_ENCCU Probable proteasome subunit beta type-4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE1 PE=1 SV=1 1 189 5.0E-28
sp|A2BN27|PSB2_HYPBU Proteasome subunit beta 2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB2 PE=3 SV=1 3 191 6.0E-19
sp|A8AB58|PSB2_IGNH4 Proteasome subunit beta 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB2 PE=3 SV=1 3 189 3.0E-16
sp|A5UM14|PSB_METS3 Proteasome subunit beta OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmB PE=3 SV=1 33 193 3.0E-16
sp|O50110|PSB2_PYRHO Proteasome subunit beta 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB2 PE=3 SV=1 3 192 5.0E-15
sp|Q8U125|PSB2_PYRFU Proteasome subunit beta 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB2 PE=3 SV=1 3 191 6.0E-15
sp|C5A7L1|PSB1_THEGJ Proteasome subunit beta 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB1 PE=3 SV=1 3 193 7.0E-15
sp|Q6L181|PSB_PICTO Proteasome subunit beta OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmB PE=3 SV=1 3 185 2.0E-14
sp|Q9YER0|PSB2_AERPE Proteasome subunit beta 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB2 PE=3 SV=2 3 184 2.0E-14
sp|A1RWY6|PSB1_THEPD Proteasome subunit beta 1 OS=Thermofilum pendens (strain Hrk 5) GN=psmB1 PE=3 SV=1 3 190 2.0E-14
sp|C9REN7|PSB_METVM Proteasome subunit beta OS=Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7) GN=psmB PE=3 SV=1 3 190 3.0E-14
sp|Q5JDJ9|PSB1_THEKO Proteasome subunit beta 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB1 PE=3 SV=1 3 191 7.0E-14
sp|C7P6N4|PSB_METFA Proteasome subunit beta OS=Methanocaldococcus fervens (strain DSM 4213 / JCM 157852 / AG86) GN=psmB PE=3 SV=1 3 190 9.0E-14
sp|C5A2D5|PSB2_THEGJ Proteasome subunit beta 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB2 PE=3 SV=1 3 191 1.0E-13
sp|C6A2V9|PSB1_THESM Proteasome subunit beta 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB1 PE=3 SV=1 3 192 2.0E-13
sp|A2SS78|PSB_METLZ Proteasome subunit beta OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=psmB PE=3 SV=1 3 187 4.0E-13
sp|A3DN27|PSB2_STAMF Proteasome subunit beta 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB2 PE=3 SV=1 3 184 4.0E-13
sp|Q9V0N9|PSB2_PYRAB Proteasome subunit beta 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB2 PE=3 SV=1 3 192 8.0E-13
sp|Q5JHL8|PSB2_THEKO Proteasome subunit beta 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB2 PE=3 SV=1 3 191 1.0E-12
sp|Q58634|PSB_METJA Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmB PE=1 SV=1 3 190 1.0E-12
sp|D3S8M7|PSB_METSF Proteasome subunit beta OS=Methanocaldococcus sp. (strain FS406-22) GN=psmB PE=3 SV=1 3 190 1.0E-12
sp|A7I841|PSB_METB6 Proteasome subunit beta OS=Methanoregula boonei (strain 6A8) GN=psmB PE=3 SV=1 3 187 5.0E-12
sp|A4YIE0|PSB1_METS5 Proteasome subunit beta 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB1 PE=3 SV=1 3 171 9.0E-12
sp|A6UT20|PSB_META3 Proteasome subunit beta OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=psmB PE=3 SV=1 3 190 1.0E-11
sp|B6YSW2|PSB1_THEON Proteasome subunit beta 1 OS=Thermococcus onnurineus (strain NA1) GN=psmB1 PE=3 SV=1 3 193 1.0E-11
sp|C6A3R1|PSB2_THESM Proteasome subunit beta 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB2 PE=3 SV=1 3 191 2.0E-11
sp|B8GG66|PSB_METPE Proteasome subunit beta OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmB PE=3 SV=1 3 187 2.0E-11
sp|C3NHF1|PSB2_SULIN Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB2 PE=3 SV=1 13 171 2.0E-11
sp|Q0W2D6|PSB_METAR Proteasome subunit beta OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=psmB PE=3 SV=1 3 171 3.0E-11
sp|Q975D1|PSB2_SULTO Proteasome subunit beta 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB2 PE=3 SV=1 3 171 4.0E-11
sp|A3CUS9|PSB_METMJ Proteasome subunit beta OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmB PE=3 SV=1 3 187 5.0E-11
sp|Q6LZD4|PSB_METMP Proteasome subunit beta OS=Methanococcus maripaludis (strain S2 / LL) GN=psmB PE=3 SV=1 3 190 5.0E-11
sp|D2RGT4|PSB_ARCPA Proteasome subunit beta OS=Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18) GN=psmB PE=3 SV=1 3 188 6.0E-11
sp|A6VK02|PSB_METM7 Proteasome subunit beta OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmB PE=3 SV=1 3 190 8.0E-11
sp|A9A788|PSB_METM6 Proteasome subunit beta OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmB PE=3 SV=1 3 190 8.0E-11
sp|B5IEE5|PSB_ACIB4 Proteasome subunit beta OS=Aciduliprofundum boonei (strain DSM 19572 / T469) GN=psmB PE=3 SV=1 34 187 9.0E-11
sp|D1Z199|PSB_METPS Proteasome subunit beta OS=Methanocella paludicola (strain DSM 17711 / JCM 13418 / NBRC 101707 / SANAE) GN=psmB PE=3 SV=1 3 171 9.0E-11
sp|D0KTH0|PSB2_SULS9 Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB2 PE=3 SV=2 13 171 1.0E-10
sp|Q9UXF3|PSB2_SULSO Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB2 PE=3 SV=2 13 171 1.0E-10
sp|Q4JAA8|PSB2_SULAC Proteasome subunit beta 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB2 PE=3 SV=1 3 171 1.0E-10
sp|C3NE98|PSB1_SULIY Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB1 PE=3 SV=1 13 171 2.0E-10
sp|C3MVD5|PSB1_SULIM Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB1 PE=3 SV=1 13 171 2.0E-10
sp|C3MQ16|PSB1_SULIL Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB1 PE=3 SV=1 13 171 2.0E-10
sp|C4KHB0|PSB1_SULIK Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB1 PE=3 SV=1 13 171 2.0E-10
sp|D2PK63|PSB1_SULID Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB1 PE=3 SV=1 13 171 2.0E-10
sp|C3N5N4|PSB1_SULIA Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB1 PE=3 SV=1 13 171 2.0E-10
sp|B6YXV3|PSB2_THEON Proteasome subunit beta 2 OS=Thermococcus onnurineus (strain NA1) GN=psmB2 PE=3 SV=1 10 191 2.0E-10
sp|A9A2U7|PSB2_NITMS Proteasome subunit beta 2 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB2 PE=3 SV=1 3 190 2.0E-10
sp|A4FYA5|PSB_METM5 Proteasome subunit beta OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmB PE=3 SV=1 3 190 2.0E-10
sp|Q8TW10|PSB_METKA Proteasome subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmB PE=3 SV=1 3 192 2.0E-10
sp|Q97AZ7|PSB_THEVO Proteasome subunit beta OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmB PE=3 SV=1 28 188 2.0E-10
sp|Q8U4C9|PSB1_PYRFU Proteasome subunit beta 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB1 PE=3 SV=1 3 191 3.0E-10
sp|A6USJ3|PSB_METVS Proteasome subunit beta OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmB PE=3 SV=1 3 189 3.0E-10
sp|P28061|PSB_THEAC Proteasome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmB PE=1 SV=1 1 188 4.0E-10
sp|Q54BC8|PSB5_DICDI Proteasome subunit beta type-5 OS=Dictyostelium discoideum GN=psmB5 PE=1 SV=1 3 192 4.0E-10
sp|Q9V247|PSB1_PYRAB Proteasome subunit beta 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB1 PE=3 SV=1 3 191 4.0E-10
sp|B1L6X8|PSB2_KORCO Proteasome subunit beta 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB2 PE=3 SV=1 1 190 5.0E-10
sp|Q09841|PSB2_SCHPO Probable proteasome subunit beta type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup1 PE=2 SV=1 3 166 9.0E-10
sp|Q18GX3|PSB_HALWD Proteasome subunit beta OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmB PE=3 SV=1 3 189 1.0E-09
sp|D4GYZ1|PSB_HALVD Proteasome subunit beta OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmB PE=1 SV=1 13 189 1.0E-09
sp|P34065|PSB5_CHICK Proteasome subunit beta type-5 (Fragment) OS=Gallus gallus GN=PSMB5 PE=2 SV=2 13 192 2.0E-09
sp|Q46G14|PSB_METBF Proteasome subunit beta OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmB PE=3 SV=1 34 193 2.0E-09
sp|B8D683|PSB2_DESK1 Proteasome subunit beta 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB2 PE=3 SV=1 3 156 3.0E-09
sp|Q8LD27|PSB6_ARATH Proteasome subunit beta type-6 OS=Arabidopsis thaliana GN=PBA1 PE=1 SV=2 10 189 6.0E-09
sp|Q9P992|PSB_METTE Proteasome subunit beta OS=Methanosarcina thermophila GN=psmB PE=3 SV=1 44 193 7.0E-09
sp|Q32KL2|PSB5_BOVIN Proteasome subunit beta type-5 OS=Bos taurus GN=PSMB5 PE=1 SV=1 3 188 7.0E-09
sp|P28075|PSB5_RAT Proteasome subunit beta type-5 OS=Rattus norvegicus GN=Psmb5 PE=1 SV=3 3 188 1.0E-08
sp|Q8ZST5|PSB2_PYRAE Proteasome subunit beta 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB2 PE=3 SV=1 3 191 1.0E-08
sp|O55234|PSB5_MOUSE Proteasome subunit beta type-5 OS=Mus musculus GN=Psmb5 PE=1 SV=3 13 188 1.0E-08
sp|Q980L4|PSB1_SULSO Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB1 PE=3 SV=1 42 188 2.0E-08
sp|D0KRX1|PSB1_SULS9 Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB1 PE=3 SV=1 42 188 2.0E-08
sp|Q5R8S2|PSB5_PONAB Proteasome subunit beta type-5 OS=Pongo abelii GN=PSMB5 PE=2 SV=3 3 188 3.0E-08
sp|P28074|PSB5_HUMAN Proteasome subunit beta type-5 OS=Homo sapiens GN=PSMB5 PE=1 SV=3 3 188 3.0E-08
sp|O57983|PSB1_PYRHO Proteasome subunit beta 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB1 PE=3 SV=1 3 191 3.0E-08
sp|D3E0A3|PSB_METRM Proteasome subunit beta OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=psmB PE=3 SV=1 33 190 3.0E-08
sp|C3N7K2|PSB2_SULIY Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB2 PE=3 SV=1 42 188 3.0E-08
sp|C3MY41|PSB2_SULIM Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB2 PE=3 SV=1 42 188 3.0E-08
sp|C3MRE5|PSB2_SULIL Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB2 PE=3 SV=1 42 188 3.0E-08
sp|C4KIR0|PSB2_SULIK Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB2 PE=3 SV=1 42 188 3.0E-08
sp|D2PDG6|PSB2_SULID Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB2 PE=3 SV=1 42 188 3.0E-08
sp|C3MZI0|PSB2_SULIA Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB2 PE=3 SV=1 42 188 3.0E-08
sp|C3NFX2|PSB1_SULIN Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB1 PE=3 SV=1 42 188 3.0E-08
sp|Q8TJB5|PSB_METAC Proteasome subunit beta OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmB PE=3 SV=1 34 193 3.0E-08
sp|Q2NI68|PSB_METST Proteasome subunit beta OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=psmB PE=3 SV=1 3 190 4.0E-08
sp|Q2TBX6|PSB1_BOVIN Proteasome subunit beta type-1 OS=Bos taurus GN=PSMB1 PE=1 SV=1 3 190 5.0E-08
sp|Q8PZ04|PSB_METMA Proteasome subunit beta OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmB PE=3 SV=1 44 193 5.0E-08
sp|A1RSJ8|PSB1_PYRIL Proteasome subunit beta 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB1 PE=3 SV=1 3 191 5.0E-08
sp|B1YDJ0|PSB2_PYRNV Proteasome subunit beta 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB2 PE=3 SV=1 3 191 6.0E-08
sp|P28024|PSB4_XENLA Proteasome subunit beta type-4 (Fragment) OS=Xenopus laevis GN=psmb4 PE=2 SV=2 1 189 6.0E-08
sp|P20618|PSB1_HUMAN Proteasome subunit beta type-1 OS=Homo sapiens GN=PSMB1 PE=1 SV=2 3 191 7.0E-08
sp|Q3T108|PSB4_BOVIN Proteasome subunit beta type-4 OS=Bos taurus GN=PSMB4 PE=1 SV=1 1 189 9.0E-08
sp|A0B5B1|PSB_METTP Proteasome subunit beta OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=psmB PE=3 SV=1 3 171 9.0E-08
sp|Q7DLS1|PSB7B_ARATH Proteasome subunit beta type-7-B OS=Arabidopsis thaliana GN=PBB2 PE=1 SV=2 3 165 9.0E-08
sp|A1XQU1|PSB7_PIG Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2 10 165 1.0E-07
sp|O43063|PSB1_SCHPO Probable proteasome subunit beta type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre3 PE=3 SV=1 10 189 1.0E-07
sp|Q9P996|PSB_ARCFU Proteasome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmB PE=1 SV=1 3 171 1.0E-07
sp|Q2FQL8|PSB_METHJ Proteasome subunit beta OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=psmB PE=3 SV=1 3 187 1.0E-07
sp|A1RX71|PSB2_THEPD Proteasome subunit beta 2 OS=Thermofilum pendens (strain Hrk 5) GN=psmB2 PE=3 SV=1 13 188 1.0E-07
sp|O09061|PSB1_MOUSE Proteasome subunit beta type-1 OS=Mus musculus GN=Psmb1 PE=1 SV=1 3 191 1.0E-07
sp|A8AA46|PSB1_IGNH4 Proteasome subunit beta 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB1 PE=3 SV=1 3 194 2.0E-07
sp|O23710|PSB7A_ARATH Proteasome subunit beta type-7-A OS=Arabidopsis thaliana GN=PBB1 PE=1 SV=2 3 165 2.0E-07
sp|Q8SR11|PSB1_ENCCU Probable proteasome subunit beta type-1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE3 PE=1 SV=1 13 190 2.0E-07
sp|Q3T112|PSB8_BOVIN Proteasome subunit beta type-8 OS=Bos taurus GN=PSMB8 PE=1 SV=2 3 171 2.0E-07
sp|Q4KM35|PSB10_RAT Proteasome subunit beta type-10 OS=Rattus norvegicus GN=Psmb10 PE=2 SV=1 3 165 2.0E-07
sp|Q975U8|PSB1_SULTO Proteasome subunit beta 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB1 PE=3 SV=1 47 187 2.0E-07
sp|O35955|PSB10_MOUSE Proteasome subunit beta type-10 OS=Mus musculus GN=Psmb10 PE=1 SV=1 3 165 2.0E-07
sp|P99026|PSB4_MOUSE Proteasome subunit beta type-4 OS=Mus musculus GN=Psmb4 PE=1 SV=1 1 189 2.0E-07
sp|A3MXQ6|PSB2_PYRCJ Proteasome subunit beta 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB2 PE=3 SV=1 3 191 2.0E-07
sp|D3RX66|PSB_FERPA Proteasome subunit beta OS=Ferroglobus placidus (strain DSM 10642 / AEDII12DO) GN=psmB PE=3 SV=1 3 171 3.0E-07
sp|A4YJ04|PSB2_METS5 Proteasome subunit beta 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB2 PE=3 SV=1 47 188 3.0E-07
sp|A3MS44|PSB1_PYRCJ Proteasome subunit beta 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB1 PE=3 SV=1 1 192 3.0E-07
sp|O73817|PSB3_ONCMY Proteasome subunit beta type-3 OS=Oncorhynchus mykiss GN=psmb3 PE=2 SV=1 5 189 4.0E-07
sp|Q2TBP0|PSB7_BOVIN Proteasome subunit beta type-7 OS=Bos taurus GN=PSMB7 PE=1 SV=1 13 165 5.0E-07
sp|Q9JHW0|PSB7_RAT Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1 10 165 5.0E-07
sp|P70195|PSB7_MOUSE Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1 10 165 5.0E-07
sp|Q5W416|PSB8_CANLF Proteasome subunit beta type-8 OS=Canis lupus familiaris GN=PSMB8 PE=1 SV=1 3 171 6.0E-07
sp|Q99436|PSB7_HUMAN Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1 10 165 6.0E-07
sp|B8D673|PSB1_DESK1 Proteasome subunit beta 1 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB1 PE=3 SV=1 28 188 7.0E-07
sp|Q9YES4|PSB1_AERPE Proteasome subunit beta 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB1 PE=3 SV=2 13 156 8.0E-07
sp|Q9IB84|PSB1A_CARAU Proteasome subunit beta type-1-A OS=Carassius auratus GN=psmb1-A PE=2 SV=1 3 191 1.0E-06
sp|P25451|PSB3_YEAST Proteasome subunit beta type-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP3 PE=1 SV=1 6 189 1.0E-06
sp|Q9IB83|PSB1B_CARAU Proteasome subunit beta type-1-B OS=Carassius auratus GN=psmb1-B PE=2 SV=1 3 191 1.0E-06
sp|P34286|PSB1_CAEEL Proteasome subunit beta type-1 OS=Caenorhabditis elegans GN=pbs-6 PE=1 SV=2 3 185 1.0E-06
sp|B1L6S7|PSB1_KORCO Proteasome subunit beta 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB1 PE=3 SV=1 10 189 2.0E-06
sp|P18421|PSB1_RAT Proteasome subunit beta type-1 OS=Rattus norvegicus GN=Psmb1 PE=1 SV=3 3 191 2.0E-06
sp|D5EAS6|PSB_METMS Proteasome subunit beta OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP) GN=psmB PE=3 SV=1 34 193 3.0E-06
sp|P38624|PSB1_YEAST Proteasome subunit beta type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE3 PE=1 SV=2 5 170 4.0E-06
sp|Q9U794|PSB1_TRYBB Proteasome subunit beta type-1 OS=Trypanosoma brucei brucei PE=2 SV=1 6 189 5.0E-06
sp|O23717|PSB5A_ARATH Proteasome subunit beta type-5-A OS=Arabidopsis thaliana GN=PBE1 PE=1 SV=1 3 171 6.0E-06
sp|Q86A21|PSB1_DICDI Proteasome subunit beta type-1 OS=Dictyostelium discoideum GN=psmB1 PE=3 SV=1 3 190 6.0E-06
sp|A1RTI7|PSB2_PYRIL Proteasome subunit beta 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB2 PE=3 SV=1 1 192 7.0E-06
sp|P28062|PSB8_HUMAN Proteasome subunit beta type-8 OS=Homo sapiens GN=PSMB8 PE=1 SV=3 3 171 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0051603 proteolysis involved in protein catabolic process Yes
GO:0005839 proteasome core complex Yes
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0019538 protein metabolic process No
GO:0006508 proteolysis No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|086260
METSFALIGKGYVIVAADTTSARSIVKMKNDEDKIKTVSPHLLMTYSGEPGDTVQFAEYIERNLRLYQIRNIYPL
RPAAASSWIRRSLAESLRSRHPYSVNLLLGGYDTSLSEPKLYWIDYLGTVTEVPFAAHGYGSYFVLSLMDRYHDP
EAPLEEGLETLKKCIQEVSKRLIVSPERYKVKIVDKDGVRDIDL*
Coding >Agabi119p4|086260
ATGGAAACATCCTTCGCACTGATAGGAAAAGGCTATGTCATCGTCGCCGCAGACACGACCTCCGCCCGTTCAATC
GTCAAGATGAAAAACGACGAGGACAAAATCAAAACCGTCTCTCCCCATCTCTTAATGACCTACTCAGGCGAACCA
GGTGACACAGTTCAATTCGCAGAGTACATCGAACGTAATCTCCGCCTTTACCAAATTCGTAACATATATCCCCTC
CGTCCGGCTGCTGCCTCATCCTGGATCCGCCGTTCTTTGGCAGAGTCCCTTCGTTCTCGTCATCCTTACTCCGTC
AACCTCCTCTTAGGCGGCTATGATACTTCGCTTTCAGAGCCTAAGCTCTACTGGATCGATTATCTCGGCACCGTA
ACAGAAGTCCCGTTTGCGGCTCATGGATATGGGTCTTATTTCGTACTGAGTTTGATGGATCGGTATCACGATCCT
GAGGCACCTTTGGAGGAAGGCTTAGAGACGCTTAAGAAGTGTATCCAGGAAGTGTCGAAGAGGCTGATCGTTAGT
CCTGAGAGGTACAAAGTCAAGATTGTAGACAAAGATGGTGTACGCGATATCGATTTGTAA
Transcript >Agabi119p4|086260
ATGGAAACATCCTTCGCACTGATAGGAAAAGGCTATGTCATCGTCGCCGCAGACACGACCTCCGCCCGTTCAATC
GTCAAGATGAAAAACGACGAGGACAAAATCAAAACCGTCTCTCCCCATCTCTTAATGACCTACTCAGGCGAACCA
GGTGACACAGTTCAATTCGCAGAGTACATCGAACGTAATCTCCGCCTTTACCAAATTCGTAACATATATCCCCTC
CGTCCGGCTGCTGCCTCATCCTGGATCCGCCGTTCTTTGGCAGAGTCCCTTCGTTCTCGTCATCCTTACTCCGTC
AACCTCCTCTTAGGCGGCTATGATACTTCGCTTTCAGAGCCTAAGCTCTACTGGATCGATTATCTCGGCACCGTA
ACAGAAGTCCCGTTTGCGGCTCATGGATATGGGTCTTATTTCGTACTGAGTTTGATGGATCGGTATCACGATCCT
GAGGCACCTTTGGAGGAAGGCTTAGAGACGCTTAAGAAGTGTATCCAGGAAGTGTCGAAGAGGCTGATCGTTAGT
CCTGAGAGGTACAAAGTCAAGATTGTAGACAAAGATGGTGTACGCGATATCGATTTGTAA
Gene >Agabi119p4|086260
ATGGAAACATCCTTCGCACTGATAGGAAAAGGCTATGTCATCGTCGCCGCAGACACGACCTCCGCCCGTTCAATC
GTCAAGATGAAAAACGACGAGGACAAAATCAAAACCGTCTCTCCCCATCTCTTAATGACCTACTCAGGCGAACCA
GGTTTGCTTTTACATCTTTCTGAAACAAAGAGTCCTCCGGTTTATCGAGTTTTTTGCATAGGTGACACAGTTCAA
TTCGCAGAGTACATCGAACGTAATCTCCGCCTTTACCAAATTCGTAACATATATCCCCTCCGTCCGGCTGCTGCC
TCATCCTGGATCCGCCGTTCTTTGGCAGAGTCCCTTCGTTCTCGTCATCCTTACTCCGTCAACCTCCTCTTAGGC
GGCTATGATACTTCGCTTTCAGAGCCTAAGCTCTACTGGATCGATTATCTCGGCACCGTAACAGAAGTCCCGTTT
GCGGCTCATGGATATGGGTCTTATTTCGTACTGAGTTTGATGGATCGGTGAGTTCCATGTTTAGGTAGTTTTGAT
CTATGAGTCTCACAGTGTATCTTCTGCATAGGTATCACGATCCTGAGGCACCTTTGGAGGAAGGCTTAGAGACGC
TTAAGAAGTGTATCCAGGAAGTGTCGAAGAGGCTGATCGTTAGTCCTGAGAGGTACAAAGTCAAGATTGTAGACA
AAGATGGTGTACGCGATATCGATTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail