Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|086190
Gene name
Locationscaffold_05b:312085..314746
Strand+
Gene length (bp)2661
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 6.6E-21 65 405

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19571|AMT6_BACS7 Glucan 1,4-alpha-maltohexaosidase OS=Bacillus sp. (strain 707) PE=1 SV=1 33 522 6.0E-123
sp|P06279|AMY_GEOSE Alpha-amylase OS=Geobacillus stearothermophilus GN=amyS PE=1 SV=3 36 521 3.0E-122
sp|P00692|AMY_BACAM Alpha-amylase OS=Bacillus amyloliquefaciens PE=1 SV=1 33 522 3.0E-118
sp|P06278|AMY_BACLI Alpha-amylase OS=Bacillus licheniformis GN=amyS PE=1 SV=1 36 522 4.0E-117
sp|P26613|AMY2_SALTY Cytoplasmic alpha-amylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=amyA PE=3 SV=3 36 521 5.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19571|AMT6_BACS7 Glucan 1,4-alpha-maltohexaosidase OS=Bacillus sp. (strain 707) PE=1 SV=1 33 522 6.0E-123
sp|P06279|AMY_GEOSE Alpha-amylase OS=Geobacillus stearothermophilus GN=amyS PE=1 SV=3 36 521 3.0E-122
sp|P00692|AMY_BACAM Alpha-amylase OS=Bacillus amyloliquefaciens PE=1 SV=1 33 522 3.0E-118
sp|P06278|AMY_BACLI Alpha-amylase OS=Bacillus licheniformis GN=amyS PE=1 SV=1 36 522 4.0E-117
sp|P26613|AMY2_SALTY Cytoplasmic alpha-amylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=amyA PE=3 SV=3 36 521 5.0E-108
sp|P26612|AMY2_ECOLI Cytoplasmic alpha-amylase OS=Escherichia coli (strain K12) GN=amyA PE=1 SV=3 36 521 6.0E-106
sp|P27932|AMY3A_ORYSJ Alpha-amylase isozyme 3A OS=Oryza sativa subsp. japonica GN=AMY1.2 PE=2 SV=2 33 407 1.0E-19
sp|Q94A41|AMY3_ARATH Alpha-amylase 3, chloroplastic OS=Arabidopsis thaliana GN=AMY3 PE=2 SV=1 38 431 2.0E-17
sp|P27933|AMY3D_ORYSJ Alpha-amylase isozyme 3D OS=Oryza sativa subsp. japonica GN=AMY1.3 PE=2 SV=2 38 430 2.0E-17
sp|P08117|AMY3_WHEAT Alpha-amylase AMY3 OS=Triticum aestivum GN=AMY1.1 PE=2 SV=1 34 435 6.0E-17
sp|P27934|AMY3E_ORYSJ Alpha-amylase isozyme 3E OS=Oryza sativa subsp. japonica GN=AMY1.4 PE=2 SV=1 34 407 4.0E-16
sp|P27937|AMY3B_ORYSJ Alpha-amylase isozyme 3B OS=Oryza sativa subsp. japonica GN=AMY1.6 PE=2 SV=1 34 407 8.0E-16
sp|P27939|AMY3C_ORYSJ Alpha-amylase isozyme 3C OS=Oryza sativa subsp. japonica GN=AMY1.7 PE=2 SV=2 34 407 3.0E-15
sp|P04747|AMY3_HORVU Alpha-amylase type B isozyme (Fragment) OS=Hordeum vulgare GN=AMY1.3 PE=2 SV=1 34 407 9.0E-15
sp|Q8VZ56|AMY1_ARATH Alpha-amylase 1 OS=Arabidopsis thaliana GN=AMY1 PE=1 SV=1 30 403 4.0E-14
sp|P21543|AMYB_PAEPO Beta/alpha-amylase OS=Paenibacillus polymyxa PE=1 SV=1 60 425 5.0E-11
sp|Q8A1G0|SUSA_BACTN Neopullulanase SusA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susA PE=3 SV=1 56 404 6.0E-11
sp|P17859|AMYA_VIGMU Alpha-amylase OS=Vigna mungo GN=AMY1.1 PE=2 SV=1 239 407 2.0E-08
sp|Q8LFG1|AMY2_ARATH Probable alpha-amylase 2 OS=Arabidopsis thaliana GN=AMY2 PE=2 SV=1 38 144 7.0E-08
sp|P17859|AMYA_VIGMU Alpha-amylase OS=Vigna mungo GN=AMY1.1 PE=2 SV=1 38 142 5.0E-07
sp|P09121|CDGT_BACS3 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 38-2) GN=cgt PE=1 SV=2 113 520 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|086190
MMASLMKDWLTWLKLRPQTPPALERMRLGPNDNANNPLMIQFFTWDALKEDTSWWKHLENEVPRLVELGFTQAWL
PPMNKAAENGRQAGRGYDAYDLWDLGEFNQKGGVATRWGSKEELIRACETAKQYGLDILIDAVLNHKHGGDTTEQ
AQAIPSHPQNRLKDVGKRQQIESWTVFNFPGRNGKYSSFRWNQAHFTGVDYDHKSKSNNIYRLVGPGHKGWSRNV
DNELGNYDFLMGNDIDHRHPDVREDFLKWGTWILETTGASGFRLDAIKHIDRKFLVHFIRSVRERSRRERLFSVA
EYWSGDVRKLLPYVRMLQGEVAFFDVPLHMNLCQASQQRSRYDLRKIFDGSLCQRKPRDAVTFVDNHDTVEGQSL
ESWVEPAFKIQAYALILLRGVGHPCVFYGDLYPNKECYNESVARDLTLLINARQKFAYGPLQDYCHEKNCIGFVR
KGDGRHAGCAVVVSNKEEDLDASVHNLRMNVGKEKAGAIYRSFMTQHGEVEIDGDGWGTFTCFANCVQVWVQAF*
Coding >Agabi119p4|086190
ATGATGGCTTCTCTCATGAAGGACTGGCTAACTTGGCTCAAATTACGACCACAAACACCTCCTGCACTGGAGCGC
ATGAGGCTCGGCCCCAATGACAACGCAAATAATCCCTTAATGATTCAGTTCTTCACTTGGGACGCGCTGAAAGAA
GATACTTCCTGGTGGAAACATCTTGAAAATGAAGTGCCTCGTCTCGTCGAGCTAGGATTTACCCAGGCTTGGCTT
CCGCCGATGAATAAAGCCGCTGAAAACGGACGACAAGCGGGACGGGGATATGACGCGTATGACCTGTGGGATCTC
GGTGAATTTAATCAAAAAGGTGGCGTGGCAACGCGATGGGGGTCCAAGGAGGAGCTCATCCGAGCCTGCGAAACT
GCCAAGCAGTATGGGCTCGATATTTTAATTGATGCAGTCTTGAACCATAAACATGGCGGAGACACAACGGAGCAG
GCCCAGGCTATCCCTTCACATCCACAAAACCGCCTCAAAGACGTAGGCAAGAGGCAACAAATAGAGAGTTGGACC
GTCTTCAATTTCCCCGGAAGGAATGGAAAGTATAGCAGCTTCAGATGGAATCAAGCTCACTTTACAGGAGTGGAC
TATGACCACAAGTCGAAATCAAACAACATTTACCGACTTGTTGGGCCTGGACATAAAGGCTGGTCTCGCAACGTG
GATAATGAGCTCGGAAATTATGATTTTCTTATGGGAAATGACATCGATCATCGCCATCCGGATGTCAGAGAGGAT
TTCTTGAAGTGGGGCACTTGGATTCTTGAAACTACAGGTGCATCTGGCTTTCGACTCGATGCCATAAAACATATC
GACCGCAAATTTCTTGTTCACTTCATTCGATCAGTTCGGGAGAGGTCTCGTCGGGAAAGGCTTTTCTCAGTTGCC
GAATATTGGTCGGGAGACGTCCGGAAATTGTTACCATATGTTCGAATGCTACAAGGGGAGGTAGCCTTCTTCGAT
GTTCCATTGCACATGAATCTATGTCAGGCTAGCCAACAACGCAGTCGGTACGATCTTCGTAAAATTTTCGACGGT
TCTCTTTGTCAGCGTAAACCTCGAGACGCTGTAACATTCGTTGATAATCACGATACGGTTGAGGGACAGAGCCTC
GAAAGTTGGGTGGAGCCGGCTTTCAAAATTCAAGCCTATGCGTTGATATTACTCCGAGGTGTCGGTCACCCCTGC
GTCTTTTACGGTGACCTTTATCCCAACAAAGAATGCTACAACGAGAGTGTCGCCAGAGACCTCACCCTCTTGATC
AATGCTAGGCAGAAATTCGCTTACGGCCCTCTGCAAGATTATTGCCATGAAAAGAATTGTATCGGATTTGTCCGC
AAAGGCGATGGTCGGCACGCGGGTTGCGCGGTGGTCGTCAGTAACAAAGAAGAAGACCTTGATGCTTCCGTTCAT
AATCTTCGCATGAACGTCGGAAAAGAAAAAGCCGGAGCTATCTATCGAAGCTTTATGACGCAACATGGAGAAGTC
GAAATAGATGGCGATGGCTGGGGGACTTTTACTTGTTTTGCTAATTGTGTTCAGGTTTGGGTTCAAGCGTTTTGA
Transcript >Agabi119p4|086190
ATGATGGCTTCTCTCATGAAGGACTGGCTAACTTGGCTCAAATTACGACCACAAACACCTCCTGCACTGGAGCGC
ATGAGGCTCGGCCCCAATGACAACGCAAATAATCCCTTAATGATTCAGTTCTTCACTTGGGACGCGCTGAAAGAA
GATACTTCCTGGTGGAAACATCTTGAAAATGAAGTGCCTCGTCTCGTCGAGCTAGGATTTACCCAGGCTTGGCTT
CCGCCGATGAATAAAGCCGCTGAAAACGGACGACAAGCGGGACGGGGATATGACGCGTATGACCTGTGGGATCTC
GGTGAATTTAATCAAAAAGGTGGCGTGGCAACGCGATGGGGGTCCAAGGAGGAGCTCATCCGAGCCTGCGAAACT
GCCAAGCAGTATGGGCTCGATATTTTAATTGATGCAGTCTTGAACCATAAACATGGCGGAGACACAACGGAGCAG
GCCCAGGCTATCCCTTCACATCCACAAAACCGCCTCAAAGACGTAGGCAAGAGGCAACAAATAGAGAGTTGGACC
GTCTTCAATTTCCCCGGAAGGAATGGAAAGTATAGCAGCTTCAGATGGAATCAAGCTCACTTTACAGGAGTGGAC
TATGACCACAAGTCGAAATCAAACAACATTTACCGACTTGTTGGGCCTGGACATAAAGGCTGGTCTCGCAACGTG
GATAATGAGCTCGGAAATTATGATTTTCTTATGGGAAATGACATCGATCATCGCCATCCGGATGTCAGAGAGGAT
TTCTTGAAGTGGGGCACTTGGATTCTTGAAACTACAGGTGCATCTGGCTTTCGACTCGATGCCATAAAACATATC
GACCGCAAATTTCTTGTTCACTTCATTCGATCAGTTCGGGAGAGGTCTCGTCGGGAAAGGCTTTTCTCAGTTGCC
GAATATTGGTCGGGAGACGTCCGGAAATTGTTACCATATGTTCGAATGCTACAAGGGGAGGTAGCCTTCTTCGAT
GTTCCATTGCACATGAATCTATGTCAGGCTAGCCAACAACGCAGTCGGTACGATCTTCGTAAAATTTTCGACGGT
TCTCTTTGTCAGCGTAAACCTCGAGACGCTGTAACATTCGTTGATAATCACGATACGGTTGAGGGACAGAGCCTC
GAAAGTTGGGTGGAGCCGGCTTTCAAAATTCAAGCCTATGCGTTGATATTACTCCGAGGTGTCGGTCACCCCTGC
GTCTTTTACGGTGACCTTTATCCCAACAAAGAATGCTACAACGAGAGTGTCGCCAGAGACCTCACCCTCTTGATC
AATGCTAGGCAGAAATTCGCTTACGGCCCTCTGCAAGATTATTGCCATGAAAAGAATTGTATCGGATTTGTCCGC
AAAGGCGATGGTCGGCACGCGGGTTGCGCGGTGGTCGTCAGTAACAAAGAAGAAGACCTTGATGCTTCCGTTCAT
AATCTTCGCATGAACGTCGGAAAAGAAAAAGCCGGAGCTATCTATCGAAGCTTTATGACGCAACATGGAGAAGTC
GAAATAGATGGCGATGGCTGGGGGACTTTTACTTGTTTTGCTAATTGTGTTCAGGTTTGGGTTCAAGCGTTTTGA
Gene >Agabi119p4|086190
ATGATGGCTTCTCTCATGAAGGACTGGCTAACTTGGCTCAAATTACGACCACAAACACCTCCTGCACTGGAGCGC
ATGAGGCTCGGCCCCAATGACAACGCAAATAATCCCTTAATGGTTCGGTTGCGTTACCCTTTTCCGGCTTTCATG
GATCCCTAAATCTTCTGAAATAGATTCAGTTCTTCACTTGGGACGCGCTGAAAGAAGATACTTCCTGGTGGAAAC
ATCTTGAAAATGAAGTGCCTCGTCTCGTCGAGCTAGGATTTACCCAGGCTTGGCTTCCGCCGATGAATAAAGCCG
CTGAAAACGTTAGTTAAAAAATGCCAGAAATATAGAGCGTTACTATCGATCCGGGCTGGTCGCTTTTCGCCCTTA
TTTGTCGTACACCGCATATTGCCAGGCCAAGCTTTCTCACTTTCGAATTAACAGGGACGACAAGCGGGACGGGGA
TATGACGCGTATGACCTGGTAAGGAAATTTCTGGAATCTCAAGAAGTAACTACGACGATGTATTGTGCCCCGCCA
GTGGGATCTCGGTGAATTTAATCAAAAAGGTGGCGTGGCAACGCGATGGGGGTCCAAGGAGGAGCTCATCCGAGC
CTGCGAAACTGCCAAGCAGTATGGGCTCGATATTTTAATTGATGCAGTCTTGAACGTGAGTTATACTGCTCCGGA
ATTTTGTTTGATACTAACTATTGTCAGCATAAACATGGCGGAGACACAACGGAGCAGGCCCAGGCTATCCCTTCA
CATCCACAAAACCGCCTCAAAGACGTAGGCAAGAGGCAACAAATAGAGGTCTGTCTTTATTTTTGTCTGCGATCA
TAATTTAATAACCTTCTTCAGAGTTGGACCGTCTTCAATTTCCCCGGAAGGAATGGAAAGGTGAGTTTATATCTA
TTTTAGCACCCTGGACTCGCAAAATGACTGTAATTCTGAAAAGTATAGCAGCTTCAGATGGAATCAAGCTCACTT
TACAGGTTCGTTCATCCACCTGTGTCCGCTTTGGTGTCATAATTTTTGTACAGGAGTGGACTATGACCACAAGTC
GAAATCAAACAACATTTACCGACTTGTTGGGCCTGGACATAAAGGCTGGTCTCGCAACGTGGATAATGAGCTCGG
AAATTATGATTTTCTTATGGGAAATGACGTTCGTGTCTTTGTACCATGCTGTCCGTAAGAATCACCTGCTAACGA
CTTTCGCCAGATCGATCATCGCCATCCGGATGTCAGAGAGGATTTCTTGAAGTGGGGCACTTGGATTCTTGAAGT
CAGTTATATCATTTGCCTCTTATGGCATAATTGACACAGCCTATTCAGACTACAGGTGCATCTGGCTTTCGACTC
GATGCCATAAAACATATCGACCGCAAATTTCTTGTTCACTTCGTAAGAAAATACTACCATTTGTGATTACCTTTC
TTACCTGTTTTCTTAGATTCGATCAGTTCGGGAGAGGTCTCGTCGGGAAAGGCTTTTCTCAGTTGGTGCGACCTT
CCTCTTCTTTTTCACATCAAAGCTAATTCATTTGCAGCCGAATATTGGTCGGGAGAGTAAGTCAATCCCCGCAGG
GGTGGAGTACACCAAGACACTCATACACTCCCAGCGTCCGGAAATTGTTACCATATGTTCGAATGCTACAAGGGG
AGGTTGGTTGATAATCAACAACCCTTGAATACTCATTCTAATTGATCTCCACTACATTCCAGGTAGCCTTCTTCG
ATGTTCCATTGCACATGAATCTATGTCAGGCTAGCCAACAACGCAGTCGGTACGATCTTCGTAAAATTTTCGACG
GTTCTCTTTGTCAGCGTAAACCTCGAGACGCTGTAACATTCGTTGATAATCACGAGTGAGCGCTTGACACTTTTC
GCGATTGAGATTTTGGATTCTGACGGCTACTCAGTACGGTATGTATGTCCATTGATCCTTTTGATTCGCTTTTTG
AGAGTGATATCATGTTCCAAGGTTGAGGGACAGAGCCTCGAAAGTTGGGTAAGCCTCACGCTCGTTGAACTTTTT
AAAACCCTGTGCCCATTACATATCGATCAGGTGGAGCCGGCTTTCAAAATTCAAGCCTATGCGTTGATATTACTC
CGAGGTGTCGGTCACCCGTGAGTACTTTCTGACTCCTCTAGAACGCTCTTATCAACTCAAGTCGGGTTTCAGCTG
CGTCTTTTACGGTGACCTTTATCCCAACAAAGAATGCTACAACGAGAGTGTCGCCAGAGACCTCACCCTCTTGAT
CAATGCTAGGCAGAAATTCGCTTACGGCCCTCTGCAAGATTATTGCCATGAAAAGAATTGTATCGGATTTGTCCG
CAAAGGCGATGGTCGGCACGCGGGTTGCGCGGTGGTCGTCAGTAACAAAGAAGAAGAGTAAGCGCCTGAAAGGCT
CAGTGTCGGTAATTTCCTTTAACTCTGTTATTCAGCCTTGATGCTTCCGTTCATAATCTTCGCATGAACGTCGGA
AAAGTGAGTATCAATTCTCTGCCTTCAGGATGTAGTGTGTGTAACAAGTTACCTTGTTAGGAAAAAGCCGGAGCT
ATCTATCGAAGCTTTATGACGCAACATGGAGAAGTCGAAATAGATGGCGATGGCTGGGGGACTTTTACTTGTTTT
GCTAATTGTGTTCAGGTTTGGGTTCAAGCGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail