Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|085650
Gene name
Locationscaffold_05b:184378..184690
Strand-
Gene length (bp)312
Transcript length (bp)216
Coding sequence length (bp)216
Protein length (aa) 72

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05493 ATP_synt_H ATP synthase subunit H 6.0E-19 8 65

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q69Z14|VA0E_SCHPO V-type proton ATPase subunit e OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma9 PE=3 SV=2 24 69 1.0E-08
sp|Q3E7B6|VA0E_YEAST V-type proton ATPase subunit e OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA9 PE=1 SV=1 3 67 4.0E-08
sp|Q20591|VA0E_CAEEL V-type proton ATPase subunit e OS=Caenorhabditis elegans GN=vha-17 PE=3 SV=2 8 70 3.0E-07
sp|Q5K8S8|VA0E_CRYNJ V-type proton ATPase subunit e OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VMA9 PE=3 SV=2 15 67 1.0E-06
sp|Q9BDP4|VA0E1_CANLF V-type proton ATPase subunit e 1 OS=Canis lupus familiaris GN=ATP6V0E1 PE=3 SV=3 7 71 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q69Z14|VA0E_SCHPO V-type proton ATPase subunit e OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma9 PE=3 SV=2 24 69 1.0E-08
sp|Q3E7B6|VA0E_YEAST V-type proton ATPase subunit e OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA9 PE=1 SV=1 3 67 4.0E-08
sp|Q20591|VA0E_CAEEL V-type proton ATPase subunit e OS=Caenorhabditis elegans GN=vha-17 PE=3 SV=2 8 70 3.0E-07
sp|Q5K8S8|VA0E_CRYNJ V-type proton ATPase subunit e OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VMA9 PE=3 SV=2 15 67 1.0E-06
sp|Q9BDP4|VA0E1_CANLF V-type proton ATPase subunit e 1 OS=Canis lupus familiaris GN=ATP6V0E1 PE=3 SV=3 7 71 1.0E-06
sp|Q75EU0|VA0E_ASHGO V-type proton ATPase subunit e OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VMA9 PE=3 SV=1 5 67 3.0E-06
sp|Q8NHE4|VA0E2_HUMAN V-type proton ATPase subunit e 2 OS=Homo sapiens GN=ATP6V0E2 PE=2 SV=1 24 71 5.0E-06
sp|Q2KIB5|VA0E2_BOVIN V-type proton ATPase subunit e 2 OS=Bos taurus GN=ATP6V0E2 PE=3 SV=1 24 71 5.0E-06
sp|Q5EB76|VA0E2_RAT V-type proton ATPase subunit e 2 OS=Rattus norvegicus GN=Atp6v0e2 PE=3 SV=1 24 71 5.0E-06
sp|Q91XE7|VA0E2_MOUSE V-type proton ATPase subunit e 2 OS=Mus musculus GN=Atp6v0e2 PE=3 SV=1 24 71 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0033179 proton-transporting V-type ATPase, V0 domain Yes
GO:1902600 proton transmembrane transport Yes
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0140657 ATP-dependent activity No
GO:0098796 membrane protein complex No
GO:0008324 cation transmembrane transporter activity No
GO:0022853 active ion transmembrane transporter activity No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0032991 protein-containing complex No
GO:0009987 cellular process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0006812 cation transport No
GO:0098662 inorganic cation transmembrane transport No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0051179 localization No
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0015075 ion transmembrane transporter activity No
GO:0098655 cation transmembrane transport No
GO:0005215 transporter activity No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0055085 transmembrane transport No
GO:0006810 transport No
GO:0098660 inorganic ion transmembrane transport No
GO:0015399 primary active transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain No
GO:0006811 ion transport No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0034220 ion transmembrane transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 33 55 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|085650
MPPPLFPILAVLVVVAALVACTAFLVPKGPNQVTIRTALMLTLTAAYLMWMITYLAQLHPLIQPVHTIKTE*
Coding >Agabi119p4|085650
ATGCCGCCCCCGCTCTTCCCCATCCTCGCCGTCTTGGTCGTCGTCGCCGCCCTCGTCGCCTGCACTGCCTTTCTC
GTCCCCAAGGGCCCCAACCAGGTCACCATCCGAACCGCGCTCATGCTCACTTTAACGGCCGCATATTTGATGTGG
ATGATCACCTATCTGGCACAGCTGCATCCCTTGATTCAACCCGTTCATACAATAAAAACGGAGTGA
Transcript >Agabi119p4|085650
ATGCCGCCCCCGCTCTTCCCCATCCTCGCCGTCTTGGTCGTCGTCGCCGCCCTCGTCGCCTGCACTGCCTTTCTC
GTCCCCAAGGGCCCCAACCAGGTCACCATCCGAACCGCGCTCATGCTCACTTTAACGGCCGCATATTTGATGTGG
ATGATCACCTATCTGGCACAGCTGCATCCCTTGATTCAACCCGTTCATACAATAAAAACGGAGTGA
Gene >Agabi119p4|085650
ATGCCGCCCCCGCTCTTCCCCATCCTCGCCGTCTTGGTCGTCGTCGCCGCCCTCGTCGCCTGCACTGCCTTTCTC
GTCCCCAAGGGCCCCAACCAGGTGTACGTGCCCCGCGTCTCCCCTTGCACTTTTCTCACCCGAGCCCTCTAGCAC
CATCCGAACCGCGCTCATGCTCACTTTAACGGCCGCATATTTGATGTGGATGATCACCTATCTGGCACAGCTGCA
TCCCTTGATTCGTACGTATCCCGCTCATGTCGCTGCCATGTCCTCATATATAGAACAGAACCCGTTCATACAATA
AAAACGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail