© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|085520 |
| Gene name | |
| Location | scaffold_05b:151667..152423 |
| Strand | - |
| Gene length (bp) | 756 |
| Transcript length (bp) | 501 |
| Coding sequence length (bp) | 501 |
| Protein length (aa) | 167 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00160 | Pro_isomerase | Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD | 9.3E-49 | 3 | 153 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P0CP86|PPIL3_CRYNJ | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP10 PE=3 SV=1 | 1 | 161 | 2.0E-90 |
| sp|P0CP87|PPIL3_CRYNB | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP10 PE=3 SV=1 | 1 | 161 | 2.0E-90 |
| sp|P0C1I5|PPIL3_RHIO9 | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp4 PE=3 SV=1 | 1 | 164 | 6.0E-88 |
| sp|Q4PCH8|PPIL3_USTMA | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP10 PE=3 SV=1 | 1 | 160 | 3.0E-85 |
| sp|Q9LPC7|CP18A_ARATH | Peptidyl-prolyl cis-trans isomerase CYP18-1 OS=Arabidopsis thaliana GN=CYP18-1 PE=2 SV=1 | 1 | 160 | 3.0E-80 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P0CP86|PPIL3_CRYNJ | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP10 PE=3 SV=1 | 1 | 161 | 2.0E-90 |
| sp|P0CP87|PPIL3_CRYNB | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP10 PE=3 SV=1 | 1 | 161 | 2.0E-90 |
| sp|P0C1I5|PPIL3_RHIO9 | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp4 PE=3 SV=1 | 1 | 164 | 6.0E-88 |
| sp|Q4PCH8|PPIL3_USTMA | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP10 PE=3 SV=1 | 1 | 160 | 3.0E-85 |
| sp|Q9LPC7|CP18A_ARATH | Peptidyl-prolyl cis-trans isomerase CYP18-1 OS=Arabidopsis thaliana GN=CYP18-1 PE=2 SV=1 | 1 | 160 | 3.0E-80 |
| sp|Q9H2H8|PPIL3_HUMAN | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Homo sapiens GN=PPIL3 PE=1 SV=1 | 1 | 160 | 3.0E-78 |
| sp|Q812D3|PPIL3_RAT | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rattus norvegicus GN=Ppil3 PE=2 SV=1 | 1 | 160 | 4.0E-78 |
| sp|Q9D6L8|PPIL3_MOUSE | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Mus musculus GN=Ppil3 PE=1 SV=1 | 1 | 160 | 3.0E-77 |
| sp|Q5ZLV2|PPIL3_CHICK | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gallus gallus GN=PPIL3 PE=2 SV=1 | 1 | 160 | 4.0E-76 |
| sp|P52017|CYP10_CAEEL | Peptidyl-prolyl cis-trans isomerase 10 OS=Caenorhabditis elegans GN=cyn-10 PE=2 SV=2 | 1 | 160 | 1.0E-75 |
| sp|Q54E95|PPIL3_DICDI | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Dictyostelium discoideum GN=ppil3 PE=3 SV=1 | 1 | 161 | 4.0E-72 |
| sp|Q4IPB8|PPIL3_GIBZE | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP10 PE=3 SV=2 | 1 | 160 | 2.0E-65 |
| sp|Q6MWS8|PPIL3_NEUCR | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-10 PE=3 SV=1 | 1 | 160 | 8.0E-65 |
| sp|P0C1J1|PPIL2_RHIO9 | Peptidyl-prolyl cis-trans isomerase-like 2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp14 PE=3 SV=1 | 7 | 165 | 4.0E-55 |
| sp|Q9FJX0|PPIL2_ARATH | Peptidyl-prolyl cis-trans isomerase CYP65 OS=Arabidopsis thaliana GN=CYP65 PE=2 SV=1 | 3 | 158 | 1.0E-53 |
| sp|Q4P555|PPIL2_USTMA | Peptidyl-prolyl cis-trans isomerase-like 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP8 PE=3 SV=1 | 3 | 166 | 4.0E-49 |
| sp|Q4IBK5|PPIL2_GIBZE | Peptidyl-prolyl cis-trans isomerase-like 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP8 PE=3 SV=1 | 5 | 163 | 5.0E-48 |
| sp|Q9SIH1|CP18B_ARATH | Peptidyl-prolyl cis-trans isomerase CYP18-2 OS=Arabidopsis thaliana GN=CYP18-2 PE=2 SV=1 | 3 | 154 | 6.0E-48 |
| sp|Q5ASQ0|PPIL1_EMENI | Peptidyl-prolyl cis-trans isomerase-like 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp1 PE=3 SV=1 | 3 | 154 | 1.0E-47 |
| sp|Q7RXA6|PPIL2_NEUCR | Peptidyl-prolyl cis-trans isomerase-like 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ppi-2 PE=3 SV=1 | 3 | 161 | 1.0E-47 |
| sp|Q09928|PPIL2_SCHPO | Peptidyl-prolyl cis-trans isomerase cyp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp8 PE=2 SV=3 | 7 | 159 | 4.0E-47 |
| sp|P0CP84|PPIL1_CRYNJ | Peptidyl-prolyl cis-trans isomerase-like 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP1 PE=3 SV=1 | 3 | 162 | 5.0E-46 |
| sp|P0CP85|PPIL1_CRYNB | Peptidyl-prolyl cis-trans isomerase-like 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP1 PE=3 SV=1 | 3 | 162 | 5.0E-46 |
| sp|Q2U5W8|PPIL2_ASPOR | Peptidyl-prolyl cis-trans isomerase-like 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp8 PE=3 SV=1 | 5 | 161 | 5.0E-46 |
| sp|Q7SF72|PPIL1_NEUCR | Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ppi-1 PE=3 SV=2 | 3 | 154 | 6.0E-46 |
| sp|Q4I1Y1|PPIL1_GIBZE | Peptidyl-prolyl cis-trans isomerase-like 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP1 PE=3 SV=1 | 2 | 154 | 3.0E-45 |
| sp|Q8W4D0|CPY71_ARATH | Peptidyl-prolyl cis-trans isomerase CYP71 OS=Arabidopsis thaliana GN=CYP71 PE=1 SV=1 | 2 | 154 | 4.0E-45 |
| sp|Q2U6U0|PPIL1_ASPOR | Peptidyl-prolyl cis-trans isomerase-like 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp1 PE=3 SV=1 | 3 | 154 | 4.0E-45 |
| sp|P87051|PPIL1_SCHPO | Peptidyl-prolyl cis-trans isomerase ppi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppi1 PE=1 SV=1 | 2 | 149 | 4.0E-45 |
| sp|Q4WVU5|PPIL2_ASPFU | Peptidyl-prolyl cis-trans isomerase-like 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp8 PE=3 SV=2 | 5 | 161 | 1.0E-44 |
| sp|Q4WCR3|PPIL1_ASPFU | Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp1 PE=3 SV=1 | 3 | 154 | 1.0E-44 |
| sp|Q9NI62|CYPE_DICDI | Peptidyl-prolyl cis-trans isomerase cypE OS=Dictyostelium discoideum GN=cypE PE=1 SV=1 | 2 | 153 | 2.0E-44 |
| sp|Q9D0W5|PPIL1_MOUSE | Peptidyl-prolyl cis-trans isomerase-like 1 OS=Mus musculus GN=Ppil1 PE=1 SV=1 | 2 | 149 | 2.0E-44 |
| sp|Q9Y3C6|PPIL1_HUMAN | Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens GN=PPIL1 PE=1 SV=1 | 2 | 149 | 2.0E-44 |
| sp|Q5E992|PPIL1_BOVIN | Peptidyl-prolyl cis-trans isomerase-like 1 OS=Bos taurus GN=PPIL1 PE=2 SV=1 | 2 | 149 | 2.0E-44 |
| sp|Q5AXT6|PPIL2_EMENI | Peptidyl-prolyl cis-trans isomerase-like 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp8 PE=3 SV=1 | 5 | 161 | 2.0E-44 |
| sp|Q9D787|PPIL2_MOUSE | Peptidyl-prolyl cis-trans isomerase-like 2 OS=Mus musculus GN=Ppil2 PE=1 SV=2 | 3 | 164 | 3.0E-44 |
| sp|Q13356|PPIL2_HUMAN | Peptidyl-prolyl cis-trans isomerase-like 2 OS=Homo sapiens GN=PPIL2 PE=1 SV=1 | 3 | 164 | 1.0E-43 |
| sp|Q8X191|PPIL1_ASPNG | Peptidyl-prolyl cis-trans isomerase-like 1 OS=Aspergillus niger GN=cypC PE=3 SV=1 | 3 | 154 | 2.0E-43 |
| sp|Q4R713|CWC27_MACFA | Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Macaca fascicularis GN=CWC27 PE=2 SV=1 | 3 | 161 | 1.0E-42 |
| sp|Q5R7W3|CWC27_PONAB | Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Pongo abelii GN=CWC27 PE=2 SV=1 | 3 | 161 | 2.0E-42 |
| sp|Q6UX04|CWC27_HUMAN | Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Homo sapiens GN=CWC27 PE=1 SV=1 | 3 | 161 | 3.0E-42 |
| sp|P0C1I4|PPIL1_RHIO9 | Peptidyl-prolyl cis-trans isomerase-like 1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp3 PE=3 SV=1 | 2 | 142 | 6.0E-41 |
| sp|Q5BAH7|PPIL3_EMENI | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp10 PE=3 SV=2 | 1 | 160 | 7.0E-41 |
| sp|P0CP90|PPIL2_CRYNJ | Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP8 PE=3 SV=1 | 3 | 165 | 9.0E-41 |
| sp|P0CP91|PPIL2_CRYNB | Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP8 PE=3 SV=1 | 3 | 165 | 9.0E-41 |
| sp|P0C1J2|CWC27_RHIO9 | Peptidyl-prolyl isomerase cwc27 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cwc27 PE=3 SV=1 | 3 | 161 | 2.0E-40 |
| sp|P52012|PPIL2_CAEEL | Peptidyl-prolyl cis-trans isomerase 4 OS=Caenorhabditis elegans GN=cyn-4 PE=1 SV=3 | 3 | 163 | 5.0E-40 |
| sp|P0CP92|CWC27_CRYNJ | Peptidyl-prolyl isomerase CWC27 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC27 PE=3 SV=1 | 3 | 161 | 1.0E-39 |
| sp|P0CP93|CWC27_CRYNB | Peptidyl-prolyl isomerase CWC27 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC27 PE=3 SV=1 | 3 | 161 | 1.0E-39 |
| sp|O74942|CYP9_SCHPO | Peptidyl-prolyl cis-trans isomerase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp9 PE=1 SV=1 | 5 | 154 | 4.0E-39 |
| sp|Q6Q152|CPY57_ARATH | Peptidyl-prolyl cis-trans isomerase CYP57 OS=Arabidopsis thaliana GN=CYP57 PE=1 SV=1 | 3 | 161 | 2.0E-38 |
| sp|Q29RZ2|PPWD1_BOVIN | Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Bos taurus GN=PPWD1 PE=2 SV=1 | 2 | 154 | 2.0E-38 |
| sp|Q8CEC6|PPWD1_MOUSE | Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Mus musculus GN=Ppwd1 PE=1 SV=2 | 2 | 154 | 2.0E-38 |
| sp|Q5XAQ1|BPPI_STRP6 | Putative bifunctional phosphatase/peptidyl-prolyl cis-trans isomerase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy1377 PE=1 SV=1 | 3 | 154 | 7.0E-38 |
| sp|O42941|CYP7_SCHPO | Peptidylprolyl isomerase cyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp7 PE=1 SV=1 | 2 | 165 | 1.0E-37 |
| sp|Q96BP3|PPWD1_HUMAN | Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens GN=PPWD1 PE=1 SV=1 | 2 | 154 | 1.0E-37 |
| sp|Q5NVL7|PPWD1_PONAB | Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Pongo abelii GN=PPWD1 PE=2 SV=1 | 2 | 154 | 1.0E-37 |
| sp|Q4WMB6|PPIL3_ASPFU | Peptidyl-prolyl cis-trans isomerase-like 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp10 PE=3 SV=2 | 1 | 160 | 4.0E-37 |
| sp|P0C1I9|CYP11_RHIO9 | Peptidyl-prolyl cis-trans isomerase cyp11 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp11 PE=3 SV=1 | 10 | 151 | 5.0E-37 |
| sp|Q7SBX8|CWC27_NEUCR | Peptidyl-prolyl isomerase cwc-27 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cwc-27 PE=3 SV=1 | 2 | 166 | 9.0E-37 |
| sp|P35627|CYPX_USEUD | Peptidyl-prolyl cis-trans isomerase OS=Unspecified eudicot DB-1992 PE=2 SV=1 | 10 | 149 | 2.0E-35 |
| sp|P0C1J0|CYP15_RHIO9 | Peptidyl-prolyl cis-trans isomerase cyp15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp15 PE=3 SV=1 | 2 | 144 | 2.0E-35 |
| sp|Q3TKY6|CWC27_MOUSE | Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Mus musculus GN=Cwc27 PE=1 SV=1 | 3 | 161 | 2.0E-35 |
| sp|Q4P6X6|PPIH_USTMA | Peptidyl-prolyl cis-trans isomerase H (Fragment) OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP3 PE=3 SV=2 | 7 | 152 | 2.0E-35 |
| sp|Q17QX9|CWC27_BOVIN | Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Bos taurus GN=CWC27 PE=2 SV=1 | 3 | 161 | 2.0E-35 |
| sp|Q4P7H2|CWC27_USTMA | Peptidyl-prolyl isomerase CWC27 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC27 PE=3 SV=1 | 3 | 165 | 2.0E-35 |
| sp|Q5XIB2|CWC27_RAT | Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Rattus norvegicus GN=Cwc27 PE=1 SV=1 | 3 | 161 | 3.0E-35 |
| sp|Q7ZW86|CWC27_DANRE | Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Danio rerio GN=cwc27 PE=2 SV=1 | 3 | 161 | 3.0E-35 |
| sp|Q8CT84|PPI1_STAES | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0648 PE=3 SV=1 | 1 | 155 | 4.0E-35 |
| sp|Q5HQK8|PPI1_STAEQ | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0540 PE=3 SV=1 | 1 | 155 | 4.0E-35 |
| sp|O94273|PPIB_SCHPO | Peptidyl-prolyl cis-trans isomerase B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp4 PE=3 SV=1 | 10 | 149 | 9.0E-35 |
| sp|Q7A1C0|PPI1_STAAW | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain MW2) GN=MW0836 PE=3 SV=1 | 1 | 155 | 1.0E-34 |
| sp|Q6GAX2|PPI1_STAAS | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0824 PE=3 SV=1 | 1 | 155 | 1.0E-34 |
| sp|Q6GID4|PPI1_STAAR | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0916 PE=3 SV=1 | 1 | 155 | 1.0E-34 |
| sp|Q7A6I1|PPI1_STAAN | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain N315) GN=SA0815 PE=1 SV=1 | 1 | 155 | 1.0E-34 |
| sp|Q99VD4|PPI1_STAAM | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0954 PE=3 SV=1 | 1 | 155 | 1.0E-34 |
| sp|Q2YWT2|PPI1_STAAB | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB0821 PE=3 SV=1 | 1 | 155 | 1.0E-34 |
| sp|Q2FZU9|PPI1_STAA8 | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00891 PE=3 SV=1 | 1 | 155 | 1.0E-34 |
| sp|Q2FIC1|PPI1_STAA3 | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0857 PE=3 SV=1 | 1 | 155 | 1.0E-34 |
| sp|Q5HHD1|PPI1_STAAC | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain COL) GN=SACOL0957 PE=3 SV=1 | 1 | 155 | 1.0E-34 |
| sp|Q5B4R3|PPIB_EMENI | Peptidyl-prolyl cis-trans isomerase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpr2 PE=3 SV=1 | 3 | 150 | 2.0E-34 |
| sp|Q4L4W9|PPI1_STAHJ | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1997 PE=3 SV=1 | 1 | 155 | 2.0E-34 |
| sp|P45877|PPIC_HUMAN | Peptidyl-prolyl cis-trans isomerase C OS=Homo sapiens GN=PPIC PE=1 SV=1 | 10 | 151 | 7.0E-34 |
| sp|P30412|PPIC_MOUSE | Peptidyl-prolyl cis-trans isomerase C OS=Mus musculus GN=Ppic PE=1 SV=1 | 10 | 151 | 3.0E-33 |
| sp|Q6GLX7|CWC27_XENLA | Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Xenopus laevis GN=cwc27 PE=2 SV=1 | 3 | 161 | 3.0E-33 |
| sp|Q08E11|PPIC_BOVIN | Peptidyl-prolyl cis-trans isomerase C OS=Bos taurus GN=PPIC PE=2 SV=1 | 10 | 151 | 7.0E-33 |
| sp|P0C1I8|CYP6_RHIO9 | Peptidyl-prolyl cis-trans isomerase cyp6 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp6 PE=3 SV=1 | 10 | 150 | 7.0E-33 |
| sp|P21569|CYPH_MAIZE | Peptidyl-prolyl cis-trans isomerase OS=Zea mays GN=CYP PE=2 SV=1 | 10 | 139 | 7.0E-33 |
| sp|P0C1I7|CYP5_RHIO9 | Peptidyl-prolyl cis-trans isomerase cyp5 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp5 PE=3 SV=1 | 10 | 134 | 1.0E-32 |
| sp|P0C1I6|PPIL4_RHIO9 | Peptidyl-prolyl cis-trans isomerase-like 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp13 PE=3 SV=1 | 1 | 161 | 2.0E-32 |
| sp|Q49W93|PPI1_STAS1 | Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1821 PE=3 SV=1 | 1 | 154 | 2.0E-32 |
| sp|P24367|PPIB_CHICK | Peptidyl-prolyl cis-trans isomerase B OS=Gallus gallus GN=PPIB PE=2 SV=1 | 10 | 149 | 2.0E-32 |
| sp|Q4IPB3|CWC27_GIBZE | Peptidyl-prolyl isomerase CWC27 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CWC27 PE=3 SV=1 | 2 | 165 | 2.0E-32 |
| sp|O93826|PPIB_ARTBE | Peptidyl-prolyl cis-trans isomerase B OS=Arthroderma benhamiae GN=CPR2 PE=2 SV=1 | 10 | 150 | 3.0E-32 |
| sp|D4AY02|CYPB_ARTBC | Probable peptidyl-prolyl cis-trans isomerase ARB_01071 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01071 PE=1 SV=2 | 10 | 150 | 3.0E-32 |
| sp|Q6Q151|CYP59_ARATH | Peptidyl-prolyl cis-trans isomerase CYP59 OS=Arabidopsis thaliana GN=CYP59 PE=1 SV=1 | 1 | 161 | 3.0E-32 |
| sp|Q8X166|PPIB_ASPNG | Peptidyl-prolyl cis-trans isomerase B OS=Aspergillus niger GN=cypB PE=3 SV=1 | 10 | 150 | 8.0E-32 |
| sp|Q4WP12|PPIB_ASPFU | Peptidyl-prolyl cis-trans isomerase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cpr2 PE=3 SV=1 | 10 | 150 | 8.0E-32 |
| sp|Q9LY75|CYP63_ARATH | Peptidyl-prolyl cis-trans isomerase CYP63 OS=Arabidopsis thaliana GN=CYP63 PE=1 SV=1 | 14 | 149 | 9.0E-32 |
| sp|Q9UA41|PPID_DICDI | Peptidyl-prolyl cis-trans isomerase D, mitochondrial OS=Dictyostelium discoideum GN=cypD PE=1 SV=1 | 10 | 143 | 9.0E-32 |
| sp|O43447|PPIH_HUMAN | Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens GN=PPIH PE=1 SV=1 | 10 | 151 | 1.0E-31 |
| sp|Q0P5D0|PPIH_BOVIN | Peptidyl-prolyl cis-trans isomerase H OS=Bos taurus GN=PPIH PE=2 SV=1 | 10 | 151 | 1.0E-31 |
| sp|P0C1I0|PPIB2_RHIO9 | Peptidyl-prolyl cis-trans isomerase B2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp9 PE=3 SV=1 | 10 | 166 | 1.0E-31 |
| sp|B3A0R0|PPI_LOTGI | Putative peptidyl-prolyl cis-trans isomerase OS=Lottia gigantea PE=1 SV=1 | 10 | 151 | 1.0E-31 |
| sp|Q2UGK2|PPIB_ASPOR | Peptidyl-prolyl cis-trans isomerase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpr2 PE=3 SV=1 | 10 | 149 | 2.0E-31 |
| sp|Q5B4E7|PPID_EMENI | Peptidyl-prolyl cis-trans isomerase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpr6 PE=3 SV=1 | 10 | 151 | 3.0E-31 |
| sp|Q75A33|PPID_ASHGO | Peptidyl-prolyl cis-trans isomerase D OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CPR6 PE=3 SV=1 | 10 | 154 | 3.0E-31 |
| sp|Q27774|PPIB_SCHJA | Peptidyl-prolyl cis-trans isomerase B OS=Schistosoma japonicum PE=2 SV=1 | 10 | 151 | 4.0E-31 |
| sp|P0CP82|PPIH_CRYNJ | Peptidyl-prolyl cis-trans isomerase H OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP3 PE=3 SV=1 | 7 | 149 | 4.0E-31 |
| sp|P0CP83|PPIH_CRYNB | Peptidyl-prolyl cis-trans isomerase H OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP3 PE=3 SV=1 | 7 | 149 | 4.0E-31 |
| sp|P80311|PPIB_BOVIN | Peptidyl-prolyl cis-trans isomerase B OS=Bos taurus GN=PPIB PE=1 SV=4 | 10 | 149 | 4.0E-31 |
| sp|P52016|CYP8_CAEEL | Peptidyl-prolyl cis-trans isomerase 8 OS=Caenorhabditis elegans GN=cyn-8 PE=2 SV=1 | 10 | 152 | 5.0E-31 |
| sp|P0C1I1|PPID_RHIO9 | Peptidyl-prolyl cis-trans isomerase D OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp12 PE=3 SV=1 | 9 | 146 | 6.0E-31 |
| sp|Q6CBP4|PPID_YARLI | Peptidyl-prolyl cis-trans isomerase D OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CPR6 PE=3 SV=1 | 8 | 143 | 6.0E-31 |
| sp|O00060|CYPH_UROFA | Peptidyl-prolyl cis-trans isomerase OS=Uromyces fabae GN=PIG28 PE=2 SV=1 | 10 | 134 | 7.0E-31 |
| sp|Q6C4W6|PPIB_YARLI | Peptidyl-prolyl cis-trans isomerase B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CPR2 PE=3 SV=1 | 10 | 149 | 9.0E-31 |
| sp|P24369|PPIB_MOUSE | Peptidyl-prolyl cis-trans isomerase B OS=Mus musculus GN=Ppib PE=1 SV=2 | 10 | 147 | 9.0E-31 |
| sp|P9WHW3|PPIA_MYCTU | Peptidyl-prolyl cis-trans isomerase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppiA PE=1 SV=1 | 2 | 154 | 1.0E-30 |
| sp|P9WHW2|PPIA_MYCTO | Peptidyl-prolyl cis-trans isomerase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppiA PE=3 SV=1 | 2 | 154 | 1.0E-30 |
| sp|P65763|PPIA_MYCBO | Probable peptidyl-prolyl cis-trans isomerase A OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppiA PE=3 SV=1 | 2 | 154 | 1.0E-30 |
| sp|P24368|PPIB_RAT | Peptidyl-prolyl cis-trans isomerase B OS=Rattus norvegicus GN=Ppib PE=1 SV=3 | 10 | 147 | 1.0E-30 |
| sp|Q4HXF6|PPID_GIBZE | Peptidyl-prolyl cis-trans isomerase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CPR6 PE=3 SV=1 | 10 | 146 | 1.0E-30 |
| sp|P18253|CYPH_SCHPO | Peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppi1 PE=3 SV=1 | 10 | 139 | 2.0E-30 |
| sp|O66105|PPIB_TREPA | Probable peptidyl-prolyl cis-trans isomerase OS=Treponema pallidum (strain Nichols) GN=ppiB PE=1 SV=1 | 4 | 126 | 3.0E-30 |
| sp|Q6CL78|PPID_KLULA | Peptidyl-prolyl cis-trans isomerase D OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CPR6 PE=3 SV=1 | 10 | 149 | 3.0E-30 |
| sp|Q7S7Z6|PPIB_NEUCR | Peptidyl-prolyl cis-trans isomerase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpr2 PE=3 SV=3 | 10 | 149 | 3.0E-30 |
| sp|P73789|PPI2_SYNY3 | Peptidyl-prolyl cis-trans isomerase slr1251 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1251 PE=3 SV=1 | 8 | 138 | 3.0E-30 |
| sp|P34791|CP20C_ARATH | Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic OS=Arabidopsis thaliana GN=CYP20-3 PE=1 SV=1 | 10 | 133 | 4.0E-30 |
| sp|P23284|PPIB_HUMAN | Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens GN=PPIB PE=1 SV=2 | 16 | 147 | 7.0E-30 |
| sp|P52014|CYP6_CAEEL | Peptidyl-prolyl cis-trans isomerase 6 OS=Caenorhabditis elegans GN=cyn-6 PE=2 SV=1 | 10 | 163 | 7.0E-30 |
| sp|Q26551|PPIB_SCHMA | Peptidyl-prolyl cis-trans isomerase B OS=Schistosoma mansoni GN=CYP PE=2 SV=1 | 14 | 149 | 1.0E-29 |
| sp|P0CP78|PPIB_CRYNJ | Peptidyl-prolyl cis-trans isomerase B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPR2 PE=3 SV=1 | 10 | 149 | 1.0E-29 |
| sp|P0CP79|PPIB_CRYNB | Peptidyl-prolyl cis-trans isomerase B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPR2 PE=3 SV=1 | 10 | 149 | 1.0E-29 |
| sp|Q0ZQK6|PPIA_SYMSY | Peptidyl-prolyl cis-trans isomerase A OS=Symphalangus syndactylus GN=PPIA PE=3 SV=3 | 10 | 139 | 1.0E-29 |
| sp|Q5R8S7|PPIA_PONPY | Peptidyl-prolyl cis-trans isomerase A OS=Pongo pygmaeus GN=PPIA PE=2 SV=4 | 10 | 139 | 1.0E-29 |
| sp|P62941|PPIA_PAPAN | Peptidyl-prolyl cis-trans isomerase A OS=Papio anubis GN=PPIA PE=2 SV=2 | 10 | 139 | 1.0E-29 |
| sp|Q0ZQL1|PPIA_PANTR | Peptidyl-prolyl cis-trans isomerase A OS=Pan troglodytes GN=PPIA PE=3 SV=3 | 10 | 139 | 1.0E-29 |
| sp|Q0ZQL2|PPIA_PANPA | Peptidyl-prolyl cis-trans isomerase A OS=Pan paniscus GN=PPIA PE=3 SV=3 | 10 | 139 | 1.0E-29 |
| sp|Q0ZQK7|PPIA_NOMLE | Peptidyl-prolyl cis-trans isomerase A OS=Nomascus leucogenys GN=PPIA PE=3 SV=3 | 10 | 139 | 1.0E-29 |
| sp|P62940|PPIA_MACMU | Peptidyl-prolyl cis-trans isomerase A OS=Macaca mulatta GN=PPIA PE=1 SV=2 | 10 | 139 | 1.0E-29 |
| sp|Q0ZQK8|PPIA_HYLLA | Peptidyl-prolyl cis-trans isomerase A OS=Hylobates lar GN=PPIA PE=3 SV=3 | 10 | 139 | 1.0E-29 |
| sp|P62937|PPIA_HUMAN | Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens GN=PPIA PE=1 SV=2 | 10 | 139 | 1.0E-29 |
| sp|Q0ZQL0|PPIA_GORGO | Peptidyl-prolyl cis-trans isomerase A OS=Gorilla gorilla gorilla GN=PPIA PE=3 SV=3 | 10 | 139 | 1.0E-29 |
| sp|P62938|PPIA_CHLAE | Peptidyl-prolyl cis-trans isomerase A OS=Chlorocebus aethiops GN=PPIA PE=2 SV=2 | 10 | 139 | 1.0E-29 |
| sp|Q9CDE9|PPIA_MYCLE | Probable peptidyl-prolyl cis-trans isomerase A OS=Mycobacterium leprae (strain TN) GN=ppiA PE=3 SV=1 | 2 | 154 | 1.0E-29 |
| sp|P52018|CYP11_CAEEL | Peptidyl-prolyl cis-trans isomerase 11 OS=Caenorhabditis elegans GN=cyn-11 PE=2 SV=1 | 10 | 159 | 1.0E-29 |
| sp|Q4WIF3|PPID_ASPFU | Peptidyl-prolyl cis-trans isomerase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cpr6 PE=3 SV=1 | 17 | 150 | 2.0E-29 |
| sp|Q38867|CP19C_ARATH | Peptidyl-prolyl cis-trans isomerase CYP19-3 OS=Arabidopsis thaliana GN=CYP19-3 PE=2 SV=2 | 10 | 158 | 2.0E-29 |
| sp|P62936|PPIA_PIG | Peptidyl-prolyl cis-trans isomerase A OS=Sus scrofa GN=PPIA PE=1 SV=2 | 10 | 139 | 2.0E-29 |
| sp|P62935|PPIA_BOVIN | Peptidyl-prolyl cis-trans isomerase A OS=Bos taurus GN=PPIA PE=1 SV=2 | 10 | 139 | 2.0E-29 |
| sp|P10111|PPIA_RAT | Peptidyl-prolyl cis-trans isomerase A OS=Rattus norvegicus GN=Ppia PE=1 SV=2 | 10 | 139 | 2.0E-29 |
| sp|P77949|PPIB_STRAQ | Peptidyl-prolyl cis-trans isomerase B OS=Streptomyces anulatus GN=cypB PE=1 SV=1 | 1 | 155 | 2.0E-29 |
| sp|Q39613|CYPH_CATRO | Peptidyl-prolyl cis-trans isomerase OS=Catharanthus roseus GN=PCKR1 PE=1 SV=1 | 10 | 139 | 2.0E-29 |
| sp|P17742|PPIA_MOUSE | Peptidyl-prolyl cis-trans isomerase A OS=Mus musculus GN=Ppia PE=1 SV=2 | 10 | 139 | 2.0E-29 |
| sp|P34887|CYPH_ALLCE | Peptidyl-prolyl cis-trans isomerase OS=Allium cepa GN=CYP PE=2 SV=1 | 14 | 139 | 2.0E-29 |
| sp|P14851|PPIA_CRIGR | Peptidyl-prolyl cis-trans isomerase A OS=Cricetulus griseus GN=PPIA PE=2 SV=2 | 10 | 139 | 2.0E-29 |
| sp|Q8LDP4|CP19D_ARATH | Peptidyl-prolyl cis-trans isomerase CYP19-4 OS=Arabidopsis thaliana GN=CYP19-4 PE=1 SV=2 | 10 | 126 | 3.0E-29 |
| sp|Q5U8Z7|PPID_AMAMU | Peptidyl-prolyl cis-trans isomerase D OS=Amanita muscaria GN=Cyp40 PE=2 SV=1 | 10 | 143 | 3.0E-29 |
| sp|P14832|CYPH_YEAST | Peptidyl-prolyl cis-trans isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR1 PE=1 SV=3 | 10 | 126 | 4.0E-29 |
| sp|Q9P3X9|PPID_NEUCR | 41 kDa peptidyl-prolyl cis-trans isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp41 PE=1 SV=1 | 10 | 138 | 4.0E-29 |
| sp|P0C1H9|PPIB1_RHIO9 | Peptidyl-prolyl cis-trans isomerase B1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp8 PE=3 SV=1 | 10 | 147 | 4.0E-29 |
| sp|P0C1I3|PPIH_RHIO9 | Peptidyl-prolyl cis-trans isomerase H OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp7 PE=3 SV=1 | 10 | 152 | 5.0E-29 |
| sp|P0CP81|PPID_CRYNB | Peptidyl-prolyl cis-trans isomerase D OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPR6 PE=3 SV=1 | 10 | 154 | 6.0E-29 |
| sp|P30405|PPIF_HUMAN | Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens GN=PPIF PE=1 SV=1 | 10 | 126 | 6.0E-29 |
| sp|Q0ZQK3|PPIA_SAGOE | Peptidyl-prolyl cis-trans isomerase A OS=Saguinus oedipus GN=PPIA PE=3 SV=3 | 10 | 139 | 7.0E-29 |
| sp|Q6DTV9|PPIA_AOTTR | Peptidyl-prolyl cis-trans isomerase A OS=Aotus trivirgatus GN=PPIA PE=2 SV=3 | 10 | 139 | 7.0E-29 |
| sp|P21568|CYPH_SOLLC | Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum GN=CYP PE=2 SV=1 | 10 | 126 | 8.0E-29 |
| sp|A8X8D0|CYP9_CAEBR | Peptidyl-prolyl cis-trans isomerase 9 OS=Caenorhabditis briggsae GN=cyn-9 PE=2 SV=2 | 10 | 149 | 8.0E-29 |
| sp|Q8W171|CYP1_SOYBN | Peptidyl-prolyl cis-trans isomerase 1 OS=Glycine max GN=Cyp1 PE=2 SV=1 | 10 | 135 | 8.0E-29 |
| sp|Q9TTC6|PPIA_RABIT | Peptidyl-prolyl cis-trans isomerase A OS=Oryctolagus cuniculus GN=PPIA PE=2 SV=3 | 10 | 139 | 1.0E-28 |
| sp|Q09637|CYP9_CAEEL | Peptidyl-prolyl cis-trans isomerase 9 OS=Caenorhabditis elegans GN=cyn-9 PE=2 SV=3 | 10 | 152 | 1.0E-28 |
| sp|Q9D868|PPIH_MOUSE | Peptidyl-prolyl cis-trans isomerase H OS=Mus musculus GN=Ppih PE=1 SV=1 | 10 | 124 | 1.0E-28 |
| sp|Q11004|PPID_SCHPO | 40 kDa peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis2 PE=2 SV=1 | 14 | 139 | 1.0E-28 |
| sp|P52015|CYP7_CAEEL | Peptidyl-prolyl cis-trans isomerase 7 OS=Caenorhabditis elegans GN=cyn-7 PE=1 SV=2 | 10 | 146 | 1.0E-28 |
| sp|Q8WUA2|PPIL4_HUMAN | Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens GN=PPIL4 PE=1 SV=1 | 1 | 154 | 1.0E-28 |
| sp|Q4I5R9|PPIB_GIBZE | Peptidyl-prolyl cis-trans isomerase B OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CPR2 PE=3 SV=2 | 10 | 149 | 1.0E-28 |
| sp|P30404|PPIF_BOVIN | Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Bos taurus GN=PPIF PE=1 SV=3 | 10 | 126 | 2.0E-28 |
| sp|Q9C566|CYP40_ARATH | Peptidyl-prolyl cis-trans isomerase CYP40 OS=Arabidopsis thaliana GN=CYP40 PE=2 SV=1 | 9 | 147 | 2.0E-28 |
| sp|P29117|PPIF_RAT | Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Rattus norvegicus GN=Ppif PE=1 SV=2 | 10 | 126 | 2.0E-28 |
| sp|P53691|PPID_YEAST | Peptidyl-prolyl cis-trans isomerase CPR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR6 PE=1 SV=1 | 9 | 149 | 2.0E-28 |
| sp|Q9CR16|PPID_MOUSE | Peptidyl-prolyl cis-trans isomerase D OS=Mus musculus GN=Ppid PE=1 SV=3 | 10 | 140 | 2.0E-28 |
| sp|P0CP88|PPIL4_CRYNJ | Peptidyl-prolyl cis-trans isomerase-like 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP6 PE=3 SV=1 | 1 | 161 | 2.0E-28 |
| sp|P0CP89|PPIL4_CRYNB | Peptidyl-prolyl cis-trans isomerase-like 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP6 PE=3 SV=1 | 1 | 161 | 2.0E-28 |
| sp|P23285|CYPB_YEAST | Peptidyl-prolyl cis-trans isomerase B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR2 PE=1 SV=1 | 10 | 149 | 2.0E-28 |
| sp|Q99KR7|PPIF_MOUSE | Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Mus musculus GN=Ppif PE=1 SV=1 | 10 | 126 | 2.0E-28 |
| sp|Q6DGG0|PPID_RAT | Peptidyl-prolyl cis-trans isomerase D OS=Rattus norvegicus GN=Ppid PE=1 SV=3 | 10 | 124 | 2.0E-28 |
| sp|Q9CXG3|PPIL4_MOUSE | Peptidyl-prolyl cis-trans isomerase-like 4 OS=Mus musculus GN=Ppil4 PE=1 SV=2 | 1 | 154 | 2.0E-28 |
| sp|Q01490|PPIB_ORPSP | Peptidyl-prolyl cis-trans isomerase B OS=Orpinomyces sp. (strain PC-2) GN=CYPB PE=1 SV=1 | 10 | 147 | 3.0E-28 |
| sp|Q27450|CYP1_BRUMA | Peptidyl-prolyl cis-trans isomerase 1 OS=Brugia malayi GN=CYP-1 PE=1 SV=1 | 10 | 147 | 3.0E-28 |
| sp|Q6BXZ7|PPID_DEBHA | Peptidyl-prolyl cis-trans isomerase D OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CPR6 PE=3 SV=1 | 10 | 146 | 3.0E-28 |
| sp|Q42406|CP18D_ARATH | Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Arabidopsis thaliana GN=CYP18-4 PE=1 SV=1 | 10 | 139 | 3.0E-28 |
| sp|Q6FNU6|PPID_CANGA | Peptidyl-prolyl cis-trans isomerase D OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CPR6 PE=3 SV=1 | 7 | 149 | 3.0E-28 |
| sp|Q9ASS6|PNSL5_ARATH | Photosynthetic NDH subunit of lumenal location 5, chloroplastic OS=Arabidopsis thaliana GN=PNSL5 PE=1 SV=1 | 10 | 147 | 4.0E-28 |
| sp|P0CP80|PPID_CRYNJ | Peptidyl-prolyl cis-trans isomerase D OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPR6 PE=3 SV=1 | 10 | 154 | 5.0E-28 |
| sp|P25007|PPIA_DROME | Peptidyl-prolyl cis-trans isomerase OS=Drosophila melanogaster GN=Cyp1 PE=1 SV=2 | 10 | 126 | 5.0E-28 |
| sp|Q8HXS3|PPIA_FELCA | Peptidyl-prolyl cis-trans isomerase A OS=Felis catus GN=PPIA PE=2 SV=3 | 10 | 139 | 6.0E-28 |
| sp|P52013|CYP5_CAEEL | Peptidyl-prolyl cis-trans isomerase 5 OS=Caenorhabditis elegans GN=cyn-5 PE=1 SV=2 | 10 | 147 | 7.0E-28 |
| sp|P25719|CYPC_YEAST | Peptidyl-prolyl cis-trans isomerase C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR3 PE=1 SV=1 | 7 | 147 | 7.0E-28 |
| sp|P52011|CYP3_CAEEL | Peptidyl-prolyl cis-trans isomerase 3 OS=Caenorhabditis elegans GN=cyn-3 PE=1 SV=1 | 10 | 138 | 8.0E-28 |
| sp|P22011|PPIA_CANAL | Peptidyl-prolyl cis-trans isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CYP1 PE=3 SV=1 | 10 | 126 | 8.0E-28 |
| sp|Q2U0E0|PPID_ASPOR | Peptidyl-prolyl cis-trans isomerase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpr6 PE=3 SV=1 | 21 | 151 | 8.0E-28 |
| sp|Q871A4|PPIL4_NEUCR | Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-6 PE=3 SV=1 | 1 | 161 | 9.0E-28 |
| sp|P54985|PPIA_BLAGE | Peptidyl-prolyl cis-trans isomerase OS=Blattella germanica GN=CYPA PE=2 SV=1 | 10 | 126 | 1.0E-27 |
| sp|P84343|PPIA_NEOCA | Peptidyl-prolyl cis-trans isomerase OS=Neospora caninum PE=1 SV=1 | 10 | 154 | 1.0E-27 |
| sp|Q9SKQ0|CP19B_ARATH | Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Arabidopsis thaliana GN=CYP19-2 PE=1 SV=1 | 10 | 139 | 1.0E-27 |
| sp|Q5AUG9|CWC27_EMENI | Peptidyl-prolyl isomerase cwc27 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc27 PE=3 SV=1 | 2 | 154 | 1.0E-27 |
| sp|O74729|PPIH_SCHPO | Peptidyl-prolyl cis-trans isomerase cyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp3 PE=3 SV=1 | 10 | 151 | 2.0E-27 |
| sp|P24525|CYPH_BRANA | Peptidyl-prolyl cis-trans isomerase OS=Brassica napus GN=CYP PE=2 SV=2 | 10 | 139 | 2.0E-27 |
| sp|Q4WE62|CWC27_ASPFU | Peptidyl-prolyl isomerase cwc27 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc27 PE=3 SV=1 | 2 | 154 | 3.0E-27 |
| sp|P26882|PPID_BOVIN | Peptidyl-prolyl cis-trans isomerase D OS=Bos taurus GN=PPID PE=1 SV=6 | 10 | 124 | 3.0E-27 |
| sp|Q9SP02|CP20A_ARATH | Peptidyl-prolyl cis-trans isomerase CYP20-1 OS=Arabidopsis thaliana GN=CYP20-1 PE=1 SV=1 | 10 | 126 | 3.0E-27 |
| sp|Q5ACI8|PPID_CANAL | Peptidyl-prolyl cis-trans isomerase D OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPR6 PE=3 SV=2 | 10 | 149 | 4.0E-27 |
| sp|Q08752|PPID_HUMAN | Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens GN=PPID PE=1 SV=3 | 10 | 124 | 4.0E-27 |
| sp|Q5ARI5|PPIL4_EMENI | Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 | 1 | 161 | 4.0E-27 |
| sp|Q4IPH4|PPIH_GIBZE | Peptidyl-prolyl cis-trans isomerase H OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP3 PE=3 SV=1 | 10 | 149 | 5.0E-27 |
| sp|Q4WAQ9|PPIL4_ASPFU | Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp6 PE=3 SV=1 | 1 | 161 | 5.0E-27 |
| sp|O49886|CYPH_LUPLU | Peptidyl-prolyl cis-trans isomerase OS=Lupinus luteus PE=2 SV=1 | 10 | 145 | 5.0E-27 |
| sp|Q4IE79|PPIL4_GIBZE | Peptidyl-prolyl cis-trans isomerase-like 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP6 PE=3 SV=2 | 1 | 161 | 6.0E-27 |
| sp|Q5AQL0|PPIH_EMENI | Peptidyl-prolyl cis-trans isomerase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp3 PE=3 SV=2 | 10 | 126 | 6.0E-27 |
| sp|P34790|CP18C_ARATH | Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Arabidopsis thaliana GN=CYP18-3 PE=1 SV=1 | 10 | 139 | 7.0E-27 |
| sp|Q7SG06|PPIH_NEUCR | Peptidyl-prolyl cis-trans isomerase H OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-3 PE=3 SV=1 | 10 | 149 | 7.0E-27 |
| sp|Q13427|PPIG_HUMAN | Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens GN=PPIG PE=1 SV=2 | 10 | 149 | 9.0E-27 |
| sp|Q41651|CYPB_VICFA | Peptidyl-prolyl cis-trans isomerase, chloroplastic OS=Vicia faba PE=1 SV=1 | 10 | 149 | 1.0E-26 |
| sp|Q8L8W5|CP21B_ARATH | Peptidyl-prolyl cis-trans isomerase CYP21-2 OS=Arabidopsis thaliana GN=CYP21-2 PE=2 SV=1 | 10 | 126 | 1.0E-26 |
| sp|Q38900|CP19A_ARATH | Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Arabidopsis thaliana GN=CYP19-1 PE=1 SV=1 | 10 | 139 | 1.0E-26 |
| sp|O55035|PPIG_RAT | Peptidyl-prolyl cis-trans isomerase G OS=Rattus norvegicus GN=Ppig PE=1 SV=2 | 10 | 149 | 1.0E-26 |
| sp|A2AR02|PPIG_MOUSE | Peptidyl-prolyl cis-trans isomerase G OS=Mus musculus GN=Ppig PE=1 SV=1 | 10 | 149 | 1.0E-26 |
| sp|P0C1H7|PPIA1_RHIO9 | Peptidyl-prolyl cis-trans isomerase A1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp2 PE=3 SV=1 | 10 | 126 | 1.0E-26 |
| sp|P0C1I2|PPIE_RHIO9 | Peptidyl-prolyl cis-trans isomerase E OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp10 PE=3 SV=1 | 6 | 134 | 2.0E-26 |
| sp|Q1RMP7|PPIL6_BOVIN | Peptidyl-prolyl cis-trans isomerase-like 6 OS=Bos taurus GN=PPIL6 PE=2 SV=1 | 1 | 150 | 2.0E-26 |
| sp|O00845|PPIA_PARPR | Peptidyl-prolyl cis-trans isomerase OS=Paramecium primaurelia PE=3 SV=1 | 14 | 150 | 2.0E-26 |
| sp|Q26516|PPIE_SCHJA | Peptidyl-prolyl cis-trans isomerase E (Fragment) OS=Schistosoma japonicum PE=2 SV=1 | 9 | 135 | 2.0E-26 |
| sp|P52009|CYP1_CAEEL | Peptidyl-prolyl cis-trans isomerase 1 OS=Caenorhabditis elegans GN=cyn-1 PE=2 SV=1 | 10 | 135 | 3.0E-26 |
| sp|P91791|PPIA_HEMPU | Peptidyl-prolyl cis-trans isomerase OS=Hemicentrotus pulcherrimus PE=2 SV=1 | 10 | 150 | 3.0E-26 |
| sp|Q8IXY8|PPIL6_HUMAN | Peptidyl-prolyl cis-trans isomerase-like 6 OS=Homo sapiens GN=PPIL6 PE=2 SV=1 | 10 | 150 | 4.0E-26 |
| sp|Q06118|PPIA_STRAQ | Peptidyl-prolyl cis-trans isomerase A OS=Streptomyces anulatus GN=ppiA PE=1 SV=1 | 10 | 150 | 4.0E-26 |
| sp|Q4P0V4|PPID_USTMA | Peptidyl-prolyl cis-trans isomerase D OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CPR6 PE=3 SV=1 | 14 | 149 | 5.0E-26 |
| sp|P0C196|PPIL4_USTMA | Peptidyl-prolyl cis-trans isomerase-like 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP6 PE=3 SV=1 | 1 | 161 | 7.0E-26 |
| sp|P0C1H8|PPIA2_RHIO9 | Peptidyl-prolyl cis-trans isomerase A2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp1 PE=3 SV=1 | 10 | 121 | 7.0E-26 |
| sp|Q9TW32|PPIB_DICDI | Peptidyl-prolyl cis-trans isomerase B OS=Dictyostelium discoideum GN=cypB PE=1 SV=1 | 10 | 126 | 1.0E-25 |
| sp|P0DN26|PAL4F_HUMAN | Peptidyl-prolyl cis-trans isomerase A-like 4F OS=Homo sapiens GN=PPIAL4F PE=3 SV=1 | 10 | 139 | 1.0E-25 |
| sp|A0A075B759|PAL4E_HUMAN | Peptidyl-prolyl cis-trans isomerase A-like 4E OS=Homo sapiens GN=PPIAL4E PE=3 SV=1 | 10 | 139 | 1.0E-25 |
| sp|P30415|NKTR_MOUSE | NK-tumor recognition protein OS=Mus musculus GN=Nktr PE=1 SV=4 | 10 | 159 | 1.0E-25 |
| sp|A0A0B4J2A2|PAL4C_HUMAN | Peptidyl-prolyl cis-trans isomerase A-like 4C OS=Homo sapiens GN=PPIAL4C PE=2 SV=1 | 10 | 139 | 1.0E-25 |
| sp|Q8SRE1|CYPH_ENCCU | Peptidyl-prolyl cis-trans isomerase OS=Encephalitozoon cuniculi (strain GB-M1) GN=CPR1 PE=1 SV=1 | 21 | 126 | 2.0E-25 |
| sp|Q54SM3|PPIA_DICDI | Peptidyl-prolyl cis-trans isomerase A OS=Dictyostelium discoideum GN=ppiA PE=1 SV=1 | 10 | 126 | 2.0E-25 |
| sp|Q2U256|PPIL4_ASPOR | Peptidyl-prolyl cis-trans isomerase-like 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp6 PE=3 SV=1 | 1 | 161 | 2.0E-25 |
| sp|Q4G338|PPIE_HAECO | Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 | 10 | 126 | 2.0E-25 |
| sp|P30414|NKTR_HUMAN | NK-tumor recognition protein OS=Homo sapiens GN=NKTR PE=1 SV=2 | 10 | 149 | 3.0E-25 |
| sp|Q26548|PPIE_SCHMA | Peptidyl-prolyl cis-trans isomerase E OS=Schistosoma mansoni PE=1 SV=2 | 10 | 135 | 3.0E-25 |
| sp|O49605|CP21A_ARATH | Peptidyl-prolyl cis-trans isomerase CYP21-1 OS=Arabidopsis thaliana GN=CYP21-1 PE=2 SV=1 | 10 | 147 | 3.0E-25 |
| sp|Q4WCM6|PPIH_ASPFU | Peptidyl-prolyl cis-trans isomerase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp3 PE=3 SV=2 | 10 | 126 | 3.0E-25 |
| sp|P52010|CYP2_CAEEL | Peptidyl-prolyl cis-trans isomerase 2 OS=Caenorhabditis elegans GN=cyn-2 PE=2 SV=2 | 10 | 126 | 3.0E-25 |
| sp|P0DN37|PAL4G_HUMAN | Peptidyl-prolyl cis-trans isomerase A-like 4G OS=Homo sapiens GN=PPIAL4G PE=3 SV=1 | 10 | 139 | 4.0E-25 |
| sp|P15425|CYPR_DROME | Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme OS=Drosophila melanogaster GN=ninaA PE=1 SV=1 | 10 | 151 | 5.0E-25 |
| sp|Q9ZVJ4|CYP22_ARATH | Peptidyl-prolyl cis-trans isomerase CYP22 OS=Arabidopsis thaliana GN=CYP22 PE=2 SV=1 | 10 | 152 | 5.0E-25 |
| sp|F5H284|PAL4D_HUMAN | Peptidyl-prolyl cis-trans isomerase A-like 4D OS=Homo sapiens GN=PPIAL4D PE=3 SV=1 | 10 | 121 | 5.0E-25 |
| sp|P35176|CYPD_YEAST | Peptidyl-prolyl cis-trans isomerase D OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR5 PE=2 SV=1 | 3 | 147 | 2.0E-24 |
| sp|Q2TZ33|PPIH_ASPOR | Peptidyl-prolyl cis-trans isomerase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp3 PE=3 SV=1 | 10 | 126 | 1.0E-23 |
| sp|Q9Y536|PAL4A_HUMAN | Peptidyl-prolyl cis-trans isomerase A-like 4A OS=Homo sapiens GN=PPIAL4A PE=2 SV=1 | 10 | 139 | 1.0E-23 |
| sp|Q9ZJH5|PPIA_HELPJ | Peptidyl-prolyl cis-trans isomerase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ppiA PE=3 SV=1 | 4 | 134 | 2.0E-23 |
| sp|P14088|PPIA_ECHGR | Peptidyl-prolyl cis-trans isomerase OS=Echinococcus granulosus GN=CYP-1 PE=2 SV=2 | 21 | 150 | 3.0E-23 |
| sp|A4FV72|PPIE_BOVIN | Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 | 10 | 126 | 3.0E-23 |
| sp|Q9UUE4|PPIL4_SCHPO | Peptidyl-prolyl cis-trans isomerase cyp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp6 PE=1 SV=1 | 1 | 161 | 5.0E-23 |
| sp|Q9QZH3|PPIE_MOUSE | Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 | 10 | 126 | 8.0E-23 |
| sp|Q9UNP9|PPIE_HUMAN | Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 | 10 | 126 | 9.0E-23 |
| sp|Q5R723|PPIE_PONAB | Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 | 10 | 126 | 1.0E-22 |
| sp|Q9ERU9|RBP2_MOUSE | E3 SUMO-protein ligase RanBP2 OS=Mus musculus GN=Ranbp2 PE=1 SV=2 | 10 | 127 | 1.0E-22 |
| sp|P10255|CYPH_NEUCR | Peptidyl-prolyl cis-trans isomerase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csr-1 PE=1 SV=1 | 10 | 123 | 1.0E-22 |
| sp|P48820|RBP2_BOVIN | E3 SUMO-protein ligase RanBP2 (Fragment) OS=Bos taurus GN=RANBP2 PE=2 SV=2 | 10 | 127 | 2.0E-22 |
| sp|Q9V3G3|PPIE_DROME | Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 | 19 | 135 | 4.0E-22 |
| sp|Q26565|PPIA_SCHMA | Peptidyl-prolyl cis-trans isomerase OS=Schistosoma mansoni PE=1 SV=1 | 10 | 135 | 6.0E-22 |
| sp|P49792|RBP2_HUMAN | E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 | 10 | 127 | 8.0E-22 |
| sp|H2QII6|RBP2_PANTR | E3 SUMO-protein ligase RanBP2 OS=Pan troglodytes GN=RANBP2 PE=1 SV=1 | 10 | 127 | 2.0E-21 |
| sp|P28517|CYPR_CALVI | Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme OS=Calliphora vicina GN=NINAA PE=2 SV=1 | 10 | 151 | 4.0E-21 |
| sp|P42693|PPIA_ACIAD | Peptidyl-prolyl cis-trans isomerase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rotA PE=3 SV=1 | 3 | 156 | 6.0E-20 |
| sp|P44499|PPIB_HAEIN | Peptidyl-prolyl cis-trans isomerase B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ppiB PE=3 SV=1 | 3 | 155 | 2.0E-19 |
| sp|P47103|CYP7_YEAST | Peptidyl-prolyl cis-trans isomerase CYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR7 PE=1 SV=1 | 10 | 154 | 3.0E-18 |
| sp|Q59641|PPIA_PSEAE | Peptidyl-prolyl cis-trans isomerase A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ppiA PE=3 SV=2 | 3 | 141 | 1.0E-17 |
| sp|O25982|PPIA_HELPY | Peptidyl-prolyl cis-trans isomerase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ppiA PE=3 SV=1 | 4 | 134 | 2.0E-17 |
| sp|P35137|PPIB_BACSU | Peptidyl-prolyl cis-trans isomerase B OS=Bacillus subtilis (strain 168) GN=ppiB PE=1 SV=1 | 12 | 135 | 1.0E-16 |
| sp|P23869|PPIB_ECOLI | Peptidyl-prolyl cis-trans isomerase B OS=Escherichia coli (strain K12) GN=ppiB PE=1 SV=2 | 3 | 154 | 2.0E-16 |
| sp|P9WHW1|PPIB_MYCTU | Probable peptidyl-prolyl cis-trans isomerase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppiB PE=1 SV=1 | 1 | 154 | 9.0E-16 |
| sp|P9WHW0|PPIB_MYCTO | Probable peptidyl-prolyl cis-trans isomerase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppiB PE=3 SV=1 | 1 | 154 | 9.0E-16 |
| sp|Q8RWY7|CYP95_ARATH | Peptidyl-prolyl cis-trans isomerase CYP95 OS=Arabidopsis thaliana GN=CYP95 PE=1 SV=2 | 15 | 149 | 3.0E-15 |
| sp|P29820|PPI_SYNE7 | Peptidyl-prolyl cis-trans isomerase OS=Synechococcus elongatus (strain PCC 7942) GN=rot PE=3 SV=1 | 5 | 145 | 4.0E-15 |
| sp|Q94A16|CP21C_ARATH | Peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial OS=Arabidopsis thaliana GN=CYP21-3 PE=2 SV=2 | 4 | 154 | 6.0E-15 |
| sp|Q57D43|PPI1_BRUAB | Probable peptidyl-prolyl cis-trans isomerase OS=Brucella abortus biovar 1 (strain 9-941) GN=ppi PE=3 SV=1 | 2 | 157 | 9.0E-15 |
| sp|Q2YPY5|PPI1_BRUA2 | Probable peptidyl-prolyl cis-trans isomerase OS=Brucella abortus (strain 2308) GN=ppi PE=3 SV=1 | 2 | 157 | 9.0E-15 |
| sp|Q8G0J9|PPI1_BRUSU | Probable peptidyl-prolyl cis-trans isomerase OS=Brucella suis biovar 1 (strain 1330) GN=ppi PE=3 SV=1 | 2 | 157 | 2.0E-14 |
| sp|Q8YHB5|PPI1_BRUME | Probable peptidyl-prolyl cis-trans isomerase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ppi PE=3 SV=2 | 2 | 157 | 2.0E-14 |
| sp|P0AFL3|PPIA_ECOLI | Peptidyl-prolyl cis-trans isomerase A OS=Escherichia coli (strain K12) GN=ppiA PE=1 SV=1 | 3 | 139 | 2.0E-14 |
| sp|P0AFL4|PPIA_ECOL6 | Peptidyl-prolyl cis-trans isomerase A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ppiA PE=3 SV=1 | 3 | 139 | 2.0E-14 |
| sp|P0AFL5|PPIA_ECO57 | Peptidyl-prolyl cis-trans isomerase A OS=Escherichia coli O157:H7 GN=ppiA PE=3 SV=1 | 3 | 139 | 2.0E-14 |
| sp|P20753|PPIA_SALTY | Peptidyl-prolyl cis-trans isomerase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ppiA PE=3 SV=2 | 3 | 139 | 6.0E-14 |
| sp|O53021|PPIA_DICD3 | Peptidyl-prolyl cis-trans isomerase A OS=Dickeya dadantii (strain 3937) GN=rotA PE=3 SV=2 | 3 | 139 | 2.0E-13 |
| sp|P83221|PPIB_STRAT | Peptidyl-prolyl cis-trans isomerase cyp18 OS=Streptomyces antibioticus GN=cyp18 PE=1 SV=3 | 2 | 137 | 2.0E-12 |
| sp|P72704|PPI1_SYNY3 | Probable peptidyl-prolyl cis-trans isomerase sll0227 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0227 PE=3 SV=1 | 2 | 129 | 3.0E-12 |
| sp|Q6BWH6|CWC27_DEBHA | Peptidyl-prolyl isomerase CWC27 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC27 PE=3 SV=1 | 3 | 122 | 1.0E-11 |
| sp|Q9C835|CP21D_ARATH | Peptidyl-prolyl cis-trans isomerase CYP21-4 OS=Arabidopsis thaliana GN=CYP21-4 PE=2 SV=1 | 5 | 154 | 3.0E-11 |
| sp|P46697|PPIB_MYCLE | Probable peptidyl-prolyl cis-trans isomerase B OS=Mycobacterium leprae (strain TN) GN=ppiB PE=3 SV=1 | 1 | 134 | 8.0E-11 |
| sp|Q8LDR3|CYP23_ARATH | Peptidyl-prolyl cis-trans isomerase CYP23 OS=Arabidopsis thaliana GN=CYP23 PE=2 SV=1 | 3 | 140 | 1.0E-09 |
| sp|Q6CGK4|CWC27_YARLI | Peptidyl-prolyl isomerase CWC27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC27 PE=3 SV=1 | 3 | 125 | 2.0E-09 |
| sp|P25334|CYPR_YEAST | Peptidyl-prolyl cis-trans isomerase CPR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR4 PE=3 SV=1 | 10 | 154 | 4.0E-09 |
| sp|Q75A74|CWC27_ASHGO | Peptidyl-prolyl isomerase CWC27 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CWC27 PE=3 SV=1 | 3 | 122 | 3.0E-08 |
| sp|O49939|TLP40_SPIOL | Peptidyl-prolyl cis-trans isomerase, chloroplastic OS=Spinacia oleracea GN=TLP40 PE=1 SV=1 | 22 | 130 | 9.0E-08 |
| sp|Q9LIK6|CP26A_ARATH | Peptidyl-prolyl cis-trans isomerase CYP26-1 OS=Arabidopsis thaliana GN=CYP26-1 PE=2 SV=1 | 10 | 143 | 2.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0000413 | protein peptidyl-prolyl isomerization | Yes |
| GO:0003755 | peptidyl-prolyl cis-trans isomerase activity | Yes |
| GO:0043412 | macromolecule modification | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:0003674 | molecular_function | No |
| GO:0008152 | metabolic process | No |
| GO:0016859 | cis-trans isomerase activity | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0044238 | primary metabolic process | No |
| GO:0016853 | isomerase activity | No |
| GO:0019538 | protein metabolic process | No |
| GO:0140096 | catalytic activity, acting on a protein | No |
| GO:0018193 | peptidyl-amino acid modification | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0003824 | catalytic activity | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:0036211 | protein modification process | No |
| GO:0008150 | biological_process | No |
| GO:0018208 | peptidyl-proline modification | No |
| Orthofinder run ID | 5 |
| Orthogroup | 5763 |
| Change Orthofinder run |
| Species | Protein ID |
|---|---|
| Agaricus bisporus var bisporus H39 | AgabiH39|085520 |
| Agaricus bisporus var bisporus H97 | AgabiH97|085520 |
| Agaricus bisporus var burnettii H119p4 | Agabi119p4|085520 (this protein) |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|085520 MSVTLHTTHGDLKIEVFCEAVPKAAENFLALCASNYYDGSLFHRNIKSFMVQTGDPSGTGKGGQSIWGASFPDEI RSTLKFNARGIVAMANAGPDTNKSQFFITYAKQPHLDGKYTIFGKVIDGTDSTLDAMERVPTNNKNRPLSEIKLT HVTIHANPLADAQLRH* |
| Coding | >Agabi119p4|085520 ATGTCAGTGACGCTGCACACCACCCACGGCGACCTCAAGATTGAAGTCTTCTGCGAGGCTGTACCCAAGGCCGCT GAGAATTTCCTCGCCTTGTGCGCGTCGAATTATTACGATGGTAGTCTCTTCCACAGAAATATCAAGTCTTTCATG GTGCAGACCGGCGACCCCTCTGGGACTGGCAAAGGGGGCCAGAGTATCTGGGGCGCTTCTTTTCCAGACGAGATA CGTTCTACACTCAAATTCAATGCACGAGGCATCGTTGCCATGGCTAATGCGGGACCCGACACCAACAAATCACAG TTCTTTATCACCTATGCAAAACAGCCACACCTGGATGGCAAGTACACCATCTTCGGCAAAGTAATCGATGGCACA GACTCCACCCTTGATGCAATGGAGCGCGTTCCTACGAACAACAAGAATAGGCCGCTAAGCGAAATCAAACTCACC CATGTCACCATTCACGCCAACCCGTTAGCTGATGCCCAGCTGAGGCATTGA |
| Transcript | >Agabi119p4|085520 ATGTCAGTGACGCTGCACACCACCCACGGCGACCTCAAGATTGAAGTCTTCTGCGAGGCTGTACCCAAGGCCGCT GAGAATTTCCTCGCCTTGTGCGCGTCGAATTATTACGATGGTAGTCTCTTCCACAGAAATATCAAGTCTTTCATG GTGCAGACCGGCGACCCCTCTGGGACTGGCAAAGGGGGCCAGAGTATCTGGGGCGCTTCTTTTCCAGACGAGATA CGTTCTACACTCAAATTCAATGCACGAGGCATCGTTGCCATGGCTAATGCGGGACCCGACACCAACAAATCACAG TTCTTTATCACCTATGCAAAACAGCCACACCTGGATGGCAAGTACACCATCTTCGGCAAAGTAATCGATGGCACA GACTCCACCCTTGATGCAATGGAGCGCGTTCCTACGAACAACAAGAATAGGCCGCTAAGCGAAATCAAACTCACC CATGTCACCATTCACGCCAACCCGTTAGCTGATGCCCAGCTGAGGCATTGA |
| Gene | >Agabi119p4|085520 ATGGTATGTGTTTCTCGCCGTCGCGCTGGATGTTGTTCACCAAATTCTAGTCAGTGACGCTGCACACCACCCACG GCGACCTCAAGGTACACTCGCACGTTCCATCCTTGACAACACCGCTCATCATTTTTCAGATTGAAGTCTTCTGCG AGGCTGTACCCAAGGCCGCTGAGGTAAGGGCTTCTTCAACTGCTTATATCTGATATGTTTGACTCCACCGCTGTA TAGAATTTCCTCGCCTTGTGCGCGTCGAATTATTACGATGGTAGTCTCTTCCACAGAAATATCAAGTCTTTCATG GTGCAGACCGGCGACCCCTCTGGGACTGGCAAAGGGGGCCAGAGTATCTGGGGCGCTTCTTTTCCAGACGAGATA CGTTCTACACTCAAAGTAAGTGCATGGCTATTACTATCGCATACTGATCCGCCTTTCGCGATTCCAGTTCAATGC ACGAGGCATCGTTGCCATGGCTAATGCGGGACCCGACACCAACAAATCACAGTTCTTTATCACCTATGCAAAACA GCCACACCTGGATGGCAAGTACACCATCTTCGGCAAAGTAATCGATGGCACAGACTCCACCCTTGATGCAATGGA GCGCGTTCCTACGAACAACAAGAATAGGCCGCTAAGCGAAATCAAACTCACCCATGTAAGTAAATGCTGTTCCCT ACTCTGGACTTCATCTCATCAAGTTCCCACTAGGTCACCATTCACGCCAACCCGTTAGCTGATGCCCAGCTGAGG CATTGA |