Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|083590
Gene name
Locationscaffold_05a:1431586..1437912
Strand+
Gene length (bp)6326
Transcript length (bp)5031
Coding sequence length (bp)5031
Protein length (aa) 1677

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00072 Response_reg Response regulator receiver domain 8.4E-19 1554 1668
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 8.1E-16 1091 1204
PF00512 HisKA His Kinase A (phospho-acceptor) domain 6.8E-14 941 1003

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 932 1202 4.0E-23
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 937 1197 4.0E-22
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 932 1201 2.0E-21
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 939 1207 3.0E-20
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 935 1194 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 932 1202 4.0E-23
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 937 1197 4.0E-22
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 932 1201 2.0E-21
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 939 1207 3.0E-20
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 935 1194 2.0E-19
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 931 1213 7.0E-19
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 937 1202 6.0E-18
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 930 1126 9.0E-18
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 939 1187 1.0E-17
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 930 1118 2.0E-17
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 931 1208 3.0E-17
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 931 1208 3.0E-17
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 931 1208 3.0E-17
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 930 1202 3.0E-17
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 930 1202 3.0E-17
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 931 1208 4.0E-17
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 930 1227 9.0E-17
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 930 1218 9.0E-17
sp|P30855|EVGS_ECOLI Sensor protein EvgS OS=Escherichia coli (strain K12) GN=evgS PE=1 SV=2 897 1207 1.0E-16
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 937 1206 2.0E-16
sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=luxQ PE=3 SV=1 939 1203 4.0E-16
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 939 1208 8.0E-16
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 937 1197 8.0E-16
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 936 1202 9.0E-16
sp|P58402|EVGS_ECO57 Sensor protein EvgS OS=Escherichia coli O157:H7 GN=evgS PE=3 SV=1 897 1207 9.0E-16
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 937 1202 3.0E-15
sp|Q52969|Y1002_RHIME Uncharacterized sensor-like histidine kinase R01002 OS=Rhizobium meliloti (strain 1021) GN=R01002 PE=3 SV=2 938 1203 4.0E-15
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 939 1203 4.0E-15
sp|P39453|TORS_ECOLI Sensor protein TorS OS=Escherichia coli (strain K12) GN=torS PE=1 SV=4 937 1197 5.0E-15
sp|P16575|BVGS_BORPE Virulence sensor protein BvgS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bvgS PE=1 SV=3 937 1207 5.0E-15
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 929 1191 9.0E-15
sp|P0AEC4|ARCB_SHIFL Aerobic respiration control sensor protein ArcB OS=Shigella flexneri GN=arcB PE=3 SV=1 937 1209 9.0E-15
sp|P0AEC3|ARCB_ECOLI Aerobic respiration control sensor protein ArcB OS=Escherichia coli (strain K12) GN=arcB PE=1 SV=1 937 1209 9.0E-15
sp|P58363|ARCB_ECO57 Aerobic respiration control sensor protein ArcB OS=Escherichia coli O157:H7 GN=arcB PE=3 SV=1 937 1209 1.0E-14
sp|P26762|BVGS_BORBR Virulence sensor protein BvgS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bvgS PE=3 SV=2 937 1207 1.0E-14
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 1553 1670 1.0E-14
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 935 1271 2.0E-14
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 937 1286 3.0E-14
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 937 1286 3.0E-14
sp|P40330|BVGS_BORPA Virulence sensor protein BvgS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bvgS PE=3 SV=2 937 1207 3.0E-14
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 930 1115 3.0E-14
sp|P58356|TORS_ECO57 Sensor protein TorS OS=Escherichia coli O157:H7 GN=torS PE=3 SV=1 937 1197 9.0E-14
sp|P20169|DSPA_SYNY3 Drug sensory protein A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dspA PE=3 SV=2 933 1197 1.0E-13
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 1503 1676 2.0E-13
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 939 1211 2.0E-13
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 939 1211 5.0E-13
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 931 1201 7.0E-13
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 930 1202 1.0E-12
sp|P37894|PLEC_CAUCR Non-motile and phage-resistance protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pleC PE=1 SV=2 937 1203 3.0E-12
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 1549 1672 6.0E-12
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 1553 1674 6.0E-12
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 1553 1674 3.0E-11
sp|O14283|PRR1_SCHPO Transcription factor prr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prr1 PE=1 SV=2 1553 1660 4.0E-11
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 931 1178 5.0E-11
sp|P28835|YCF27_PORAE Probable transcriptional regulator ycf27 OS=Porphyridium aerugineum GN=ycf27 PE=3 SV=1 1550 1671 9.0E-11
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 1537 1674 1.0E-10
sp|O78428|YCF27_GUITH Probable transcriptional regulator ycf27 OS=Guillardia theta GN=ycf27 PE=3 SV=1 1549 1671 1.0E-10
sp|Q9XH57|ETR2_PELHO Ethylene receptor 2 OS=Pelargonium hortorum GN=ETR2 PE=2 SV=1 937 1207 2.0E-10
sp|A5VRX4|PDHS_BRUO2 Cell-division control histidine kinase PdhS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pdhS PE=3 SV=1 937 1203 2.0E-10
sp|Q8FZ86|PDHS_BRUSU Cell-division control histidine kinase PdhS OS=Brucella suis biovar 1 (strain 1330) GN=pdhS PE=3 SV=1 937 1203 3.0E-10
sp|Q8YIM6|PDHS_BRUME Cell-division control histidine kinase PdhS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pdhS PE=3 SV=2 937 1203 3.0E-10
sp|B0CI82|PDHS_BRUSI Cell-division control histidine kinase PdhS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pdhS PE=3 SV=1 937 1203 3.0E-10
sp|Q8KIY1|TMOS_PSEME Sensor histidine kinase TmoS OS=Pseudomonas mendocina GN=tmoS PE=1 SV=1 893 1205 3.0E-10
sp|E0X9C7|TODS_PSEPT Sensor histidine kinase TodS OS=Pseudomonas putida (strain DOT-T1E) GN=todS PE=1 SV=1 938 1205 3.0E-10
sp|Q57BR6|PDHS_BRUAB Cell-division control histidine kinase PdhS OS=Brucella abortus biovar 1 (strain 9-941) GN=pdhS PE=1 SV=1 937 1203 3.0E-10
sp|Q2YRB4|PDHS_BRUA2 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain 2308) GN=pdhS PE=3 SV=1 937 1203 3.0E-10
sp|B2S758|PDHS_BRUA1 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain S19) GN=pdhS PE=3 SV=1 937 1203 3.0E-10
sp|A9M715|PDHS_BRUC2 Cell-division control histidine kinase PdhS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pdhS PE=3 SV=1 937 1203 3.0E-10
sp|A5W4E3|TODS_PSEP1 Sensor histidine kinase TodS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todS PE=1 SV=1 938 1205 4.0E-10
sp|Q44006|CZCR_CUPMC Transcriptional activator protein CzcR OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=czcR PE=2 SV=1 1552 1663 5.0E-10
sp|O48929|ETR1_TOBAC Ethylene receptor OS=Nicotiana tabacum GN=ETR1 PE=2 SV=1 931 1196 6.0E-10
sp|P32040|Y851_SYNP2 Probable transcriptional regulatory protein SYNPCC7002_A0851 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=SYNPCC7002_A0851 PE=3 SV=2 1551 1664 7.0E-10
sp|Q9XH58|ETR1_PELHO Ethylene receptor 1 OS=Pelargonium hortorum GN=ETR1 PE=2 SV=1 937 1228 1.0E-09
sp|B0R4K1|CHEY_HALS3 Chemotaxis protein CheY OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=cheY PE=1 SV=1 1553 1660 1.0E-09
sp|A6X5X4|PDHS_OCHA4 Cell-division control histidine kinase PdhS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pdhS PE=3 SV=1 937 1203 2.0E-09
sp|P48259|YCF27_CYAPA Probable transcriptional regulator ycf27 OS=Cyanophora paradoxa GN=ycf27 PE=3 SV=1 1551 1673 2.0E-09
sp|Q01473|RCAC_MICDP Protein RcaC OS=Microchaete diplosiphon GN=rcaC PE=3 SV=2 1552 1660 2.0E-09
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 1538 1672 3.0E-09
sp|P23836|PHOP_ECOLI Transcriptional regulatory protein PhoP OS=Escherichia coli (strain K12) GN=phoP PE=1 SV=1 1552 1676 3.0E-09
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 1552 1666 4.0E-09
sp|Q83RR0|PHOP_SHIFL Virulence transcriptional regulatory protein PhoP OS=Shigella flexneri GN=phoP PE=3 SV=1 1552 1676 4.0E-09
sp|Q8CXZ9|PHOP_ECOL6 Transcriptional regulatory protein PhoP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=phoP PE=3 SV=1 1552 1676 4.0E-09
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 1554 1673 4.0E-09
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 931 1115 4.0E-09
sp|Q53RH0|ERS1_ORYSJ Probable ethylene response sensor 1 OS=Oryza sativa subsp. japonica GN=ERS1 PE=2 SV=1 931 1216 5.0E-09
sp|A2XL32|ERS1_ORYSI Probable ethylene response sensor 1 OS=Oryza sativa subsp. indica GN=ERS1 PE=2 SV=1 931 1216 5.0E-09
sp|Q47456|PCOR_ECOLX Transcriptional regulatory protein PcoR OS=Escherichia coli GN=pcoR PE=3 SV=1 1553 1663 5.0E-09
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1546 1662 6.0E-09
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 1553 1672 7.0E-09
sp|P35163|RESD_BACSU Transcriptional regulatory protein ResD OS=Bacillus subtilis (strain 168) GN=resD PE=3 SV=2 1553 1662 7.0E-09
sp|P54443|YRKP_BACSU Uncharacterized transcriptional regulatory protein YrkP OS=Bacillus subtilis (strain 168) GN=yrkP PE=3 SV=1 1552 1662 7.0E-09
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 1542 1660 8.0E-09
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1548 1661 8.0E-09
sp|A1TEL7|MPRA_MYCVP Response regulator MprA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mprA PE=3 SV=1 1553 1673 8.0E-09
sp|Q41342|ETR1_SOLLC Ethylene receptor 1 OS=Solanum lycopersicum GN=ETR1 PE=1 SV=1 931 1196 9.0E-09
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 1542 1661 1.0E-08
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 1555 1674 1.0E-08
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 1550 1673 1.0E-08
sp|Q9SSY6|ETR1_CUCSA Ethylene receptor 1 OS=Cucumis sativus GN=ETR1 PE=2 SV=1 937 1219 1.0E-08
sp|O81122|ETR1_MALDO Ethylene receptor OS=Malus domestica GN=ETR1 PE=2 SV=1 937 1228 1.0E-08
sp|P45337|QSEB_HAEIN Transcriptional regulatory protein QseB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=qseB PE=3 SV=1 1552 1663 1.0E-08
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 1544 1668 1.0E-08
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 1553 1672 2.0E-08
sp|Q5SML4|OHK2_ORYSJ Probable histidine kinase 2 OS=Oryza sativa subsp. japonica GN=HK2 PE=2 SV=1 1537 1661 2.0E-08
sp|A2YA15|OHK2_ORYSI Probable histidine kinase 2 OS=Oryza sativa subsp. indica GN=HK2 PE=3 SV=1 1537 1661 2.0E-08
sp|Q04942|AFSQ1_STRCO Transcriptional regulatory protein AfsQ1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=afsQ1 PE=1 SV=2 1554 1673 2.0E-08
sp|P87323|MCS4_SCHPO Response regulator mcs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcs4 PE=3 SV=1 1552 1676 2.0E-08
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 1515 1672 3.0E-08
sp|Q1B3X8|MPRA_MYCSS Response regulator MprA OS=Mycobacterium sp. (strain MCS) GN=mprA PE=3 SV=1 1553 1673 3.0E-08
sp|A1UL70|MPRA_MYCSK Response regulator MprA OS=Mycobacterium sp. (strain KMS) GN=mprA PE=3 SV=1 1553 1673 3.0E-08
sp|A3Q5L9|MPRA_MYCSJ Response regulator MprA OS=Mycobacterium sp. (strain JLS) GN=mprA PE=3 SV=1 1553 1673 3.0E-08
sp|O82436|ETR1_CUCMN Ethylene receptor 1 OS=Cucumis melo var. cantalupensis GN=ETR1 PE=2 SV=1 937 1216 3.0E-08
sp|Q8X738|PHOP_ECO57 Transcriptional regulatory protein PhoP OS=Escherichia coli O157:H7 GN=phoP PE=3 SV=1 1552 1676 4.0E-08
sp|P28257|YCF27_GALSU Probable transcriptional regulator ycf27 OS=Galdieria sulphuraria GN=ycf27 PE=3 SV=1 1550 1671 4.0E-08
sp|Q5A4X5|SKN7_CANAL Transcription factor SKN7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKN7 PE=3 SV=1 1551 1660 4.0E-08
sp|O49230|ETR1_BRAOL Ethylene receptor 1 OS=Brassica oleracea GN=ETR1 PE=2 SV=1 937 1207 4.0E-08
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 937 1108 4.0E-08
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 1554 1668 5.0E-08
sp|P39663|SPHR_SYNE7 Alkaline phosphatase synthesis transcriptional regulatory protein SphR OS=Synechococcus elongatus (strain PCC 7942) GN=sphR PE=1 SV=1 1553 1660 5.0E-08
sp|Q7D9K0|TCRA2_MYCTO Transcriptional regulatory protein TcrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=tcrA PE=3 SV=2 1553 1673 5.0E-08
sp|O07776|TCRA1_MYCTU Transcriptional regulatory protein TcrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tcrA PE=1 SV=1 1553 1673 5.0E-08
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 1437 1668 5.0E-08
sp|Q742C1|MPRA_MYCPA Response regulator MprA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mprA PE=3 SV=1 1552 1673 5.0E-08
sp|A0QBQ9|MPRA_MYCA1 Response regulator MprA OS=Mycobacterium avium (strain 104) GN=mprA PE=3 SV=1 1552 1673 5.0E-08
sp|Q1XDC9|YCF27_PYRYE Probable transcriptional regulator ycf27 OS=Pyropia yezoensis GN=ycf27 PE=3 SV=2 1548 1671 6.0E-08
sp|Q9ZWL6|ETR1_PASED Ethylene receptor OS=Passiflora edulis GN=ETR1 PE=2 SV=1 937 1207 6.0E-08
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 1552 1674 7.0E-08
sp|A0R3I8|MPRA_MYCS2 Response regulator MprA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mprA PE=1 SV=1 1553 1673 7.0E-08
sp|P51358|YCF27_PORPU Probable transcriptional regulator ycf27 OS=Porphyra purpurea GN=ycf27 PE=3 SV=1 1548 1671 7.0E-08
sp|Q9ZHD3|SILR_SALTM Probable transcriptional regulatory protein SilR OS=Salmonella typhimurium GN=silR PE=3 SV=1 1553 1663 8.0E-08
sp|Q7A0U4|SRRA_STAAW Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain MW2) GN=srrA PE=3 SV=1 1554 1662 8.0E-08
sp|Q9L524|SRRA_STAAU Transcriptional regulatory protein SrrA OS=Staphylococcus aureus GN=srrA PE=2 SV=2 1554 1662 8.0E-08
sp|Q6G972|SRRA_STAAS Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain MSSA476) GN=srrA PE=3 SV=2 1554 1662 8.0E-08
sp|Q6GGK6|SRRA_STAAR Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain MRSA252) GN=srrA PE=3 SV=2 1554 1662 8.0E-08
sp|Q7A5H6|SRRA_STAAN Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain N315) GN=srrA PE=1 SV=1 1554 1662 8.0E-08
sp|Q7A2R6|SRRA_STAAM Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=srrA PE=3 SV=1 1554 1662 8.0E-08
sp|Q5HFT0|SRRA_STAAC Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain COL) GN=srrA PE=2 SV=1 1554 1662 8.0E-08
sp|Q2FY79|SRRA_STAA8 Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain NCTC 8325) GN=srrA PE=3 SV=1 1554 1662 8.0E-08
sp|P9WGM1|PRRA_MYCTU Transcriptional regulatory protein PrrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prrA PE=1 SV=1 1567 1660 8.0E-08
sp|P9WGM0|PRRA_MYCTO Transcriptional regulatory protein PrrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=prrA PE=3 SV=1 1567 1660 8.0E-08
sp|P0A5Z7|PRRA_MYCBO Transcriptional regulatory protein PrrA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=prrA PE=3 SV=1 1567 1660 8.0E-08
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 1552 1676 9.0E-08
sp|P18769|FRZE_MYXXA Gliding motility regulatory protein OS=Myxococcus xanthus GN=frzE PE=1 SV=1 1550 1659 9.0E-08
sp|A1KHB7|MPRA_MYCBP Response regulator MprA OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=mprA PE=3 SV=1 1553 1673 9.0E-08
sp|Q7U0X4|MPRA_MYCBO Response regulator MprA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mprA PE=1 SV=1 1553 1673 9.0E-08
sp|Q8XBS3|QSEB_ECO57 Transcriptional regulatory protein QseB OS=Escherichia coli O157:H7 GN=qseB PE=2 SV=1 1553 1663 9.0E-08
sp|Q04803|PFER_PSEAE Transcriptional activator protein PfeR OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pfeR PE=3 SV=1 1553 1667 9.0E-08
sp|A0PWB4|MPRA_MYCUA Response regulator MprA OS=Mycobacterium ulcerans (strain Agy99) GN=mprA PE=3 SV=1 1553 1673 1.0E-07
sp|P96126|CHEY_TREPA Chemotaxis protein CheY OS=Treponema pallidum (strain Nichols) GN=cheY PE=3 SV=1 1552 1661 1.0E-07
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 939 1189 1.0E-07
sp|Q9M7M1|ETR1_PRUPE Ethylene receptor OS=Prunus persica GN=ETR1 PE=2 SV=1 937 1178 1.0E-07
sp|P9WGM9|MPRA_MYCTU Response regulator MprA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mprA PE=1 SV=1 1553 1673 1.0E-07
sp|P9WGM8|MPRA_MYCTO Response regulator MprA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mprA PE=3 SV=1 1553 1673 1.0E-07
sp|A5U123|MPRA_MYCTA Response regulator MprA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mprA PE=3 SV=1 1553 1673 1.0E-07
sp|Q50136|PRRA_MYCLE Transcriptional regulatory protein PrrA OS=Mycobacterium leprae (strain TN) GN=prrA PE=3 SV=2 1567 1660 1.0E-07
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 1553 1672 2.0E-07
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 1554 1668 2.0E-07
sp|P24072|CHEY_BACSU Chemotaxis protein CheY OS=Bacillus subtilis (strain 168) GN=cheY PE=1 SV=3 1553 1660 2.0E-07
sp|P0A4I0|DLTR_STRA5 Transcriptional regulatory protein DltR OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltR PE=3 SV=1 1553 1675 2.0E-07
sp|P0A4H9|DLTR_STRA3 Transcriptional regulatory protein DltR OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltR PE=3 SV=1 1553 1675 2.0E-07
sp|P0ACZ8|CUSR_ECOLI Transcriptional regulatory protein CusR OS=Escherichia coli (strain K12) GN=cusR PE=1 SV=1 1553 1663 3.0E-07
sp|P0ACZ9|CUSR_ECOL6 Transcriptional regulatory protein CusR OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cusR PE=3 SV=1 1553 1663 3.0E-07
sp|P0AD00|CUSR_ECO57 Transcriptional regulatory protein CusR OS=Escherichia coli O157:H7 GN=cusR PE=3 SV=1 1553 1663 3.0E-07
sp|P42244|YCBL_BACSU Uncharacterized transcriptional regulatory protein YcbL OS=Bacillus subtilis (strain 168) GN=ycbL PE=3 SV=3 1555 1662 3.0E-07
sp|P9WGM3|PDTAR_MYCTU Probable transcriptional regulatory protein pdtaR OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pdtaR PE=1 SV=1 1553 1666 3.0E-07
sp|P9WGM2|PDTAR_MYCTO Probable transcriptional regulatory protein pdtaR OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pdtaR PE=3 SV=1 1553 1666 3.0E-07
sp|Q8D0P1|CHEY_YERPE Chemotaxis protein CheY OS=Yersinia pestis GN=cheY PE=3 SV=3 1549 1675 4.0E-07
sp|Q9AE24|RPRY_BACFR Transcriptional regulatory protein RprY OS=Bacteroides fragilis (strain YCH46) GN=rprY PE=3 SV=2 1549 1671 4.0E-07
sp|P52076|QSEB_ECOLI Transcriptional regulatory protein QseB OS=Escherichia coli (strain K12) GN=qseB PE=2 SV=1 1553 1663 4.0E-07
sp|A7N6S2|CQSS_VIBCB CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cqsS PE=1 SV=1 1540 1660 5.0E-07
sp|Q9CD68|MPRA_MYCLE Response regulator MprA OS=Mycobacterium leprae (strain TN) GN=mprA PE=3 SV=1 1552 1673 5.0E-07
sp|P0A4H8|CIAR_STRR6 Transcriptional regulatory protein CiaR OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ciaR PE=3 SV=1 1553 1660 5.0E-07
sp|P0A4H7|CIAR_STRPN Transcriptional regulatory protein CiaR OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ciaR PE=3 SV=1 1553 1660 5.0E-07
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 1552 1666 6.0E-07
sp|P37478|YYCF_BACSU Transcriptional regulatory protein YycF OS=Bacillus subtilis (strain 168) GN=yycF PE=1 SV=1 1553 1666 6.0E-07
sp|Q9HUI2|ARUR_PSEAE Transcriptional regulatory protein AruR OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruR PE=3 SV=1 1553 1661 8.0E-07
sp|P76340|YEDW_ECOLI Probable transcriptional regulatory protein YedW OS=Escherichia coli (strain K12) GN=yedW PE=1 SV=2 1552 1663 9.0E-07
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 1553 1660 1.0E-06
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 1533 1661 1.0E-06
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 1553 1666 1.0E-06
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 1543 1661 1.0E-06
sp|P66795|QSEB_SALTY Transcriptional regulatory protein QseB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qseB PE=3 SV=1 1553 1663 1.0E-06
sp|P66796|QSEB_SALTI Transcriptional regulatory protein QseB OS=Salmonella typhi GN=qseB PE=3 SV=1 1553 1663 1.0E-06
sp|Q93P00|CHEY_YEREN Chemotaxis protein CheY OS=Yersinia enterocolitica GN=cheY PE=3 SV=3 1549 1675 1.0E-06
sp|Q56312|CHEY_THEMA Chemotaxis protein CheY OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=cheY PE=1 SV=1 1553 1660 1.0E-06
sp|P72253|CHEB2_RHOCS Chemotaxis response regulator protein-glutamate methylesterase of group 2 operon OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=cheB PE=3 SV=1 1543 1660 3.0E-06
sp|P45606|PHOB_SHIDY Phosphate regulon transcriptional regulatory protein PhoB OS=Shigella dysenteriae GN=phoB PE=3 SV=1 1553 1666 3.0E-06
sp|P0AFJ5|PHOB_ECOLI Phosphate regulon transcriptional regulatory protein PhoB OS=Escherichia coli (strain K12) GN=phoB PE=1 SV=1 1553 1666 3.0E-06
sp|P0AFJ6|PHOB_ECO57 Phosphate regulon transcriptional regulatory protein PhoB OS=Escherichia coli O157:H7 GN=phoB PE=3 SV=1 1553 1666 3.0E-06
sp|P9WGL3|KDPD_MYCTU Sensor protein KdpD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpD PE=1 SV=1 937 1208 3.0E-06
sp|P45607|PHOB_SHIFL Phosphate regulon transcriptional regulatory protein PhoB OS=Shigella flexneri GN=phoB PE=3 SV=2 1553 1666 4.0E-06
sp|P45605|PHOB_KLEPN Phosphate regulon transcriptional regulatory protein PhoB OS=Klebsiella pneumoniae GN=phoB PE=3 SV=1 1553 1666 4.0E-06
sp|P30843|BASR_ECOLI Transcriptional regulatory protein BasR OS=Escherichia coli (strain K12) GN=basR PE=1 SV=3 1553 1673 4.0E-06
sp|Q9M8Y4|ARR22_ARATH Two-component response regulator ARR22 OS=Arabidopsis thaliana GN=ARR22 PE=2 SV=1 1549 1670 4.0E-06
sp|P9WGL2|KDPD_MYCTO Sensor protein KdpD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpD PE=3 SV=1 937 1208 4.0E-06
sp|Q47744|VANR_ENTFA Regulatory protein VanRB OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=vanRB PE=3 SV=1 1553 1676 4.0E-06
sp|P0A2D5|CHEY_SALTY Chemotaxis protein CheY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cheY PE=1 SV=2 1549 1675 5.0E-06
sp|P0A2D6|CHEY_SALTI Chemotaxis protein CheY OS=Salmonella typhi GN=cheY PE=3 SV=2 1549 1675 5.0E-06
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 1546 1672 5.0E-06
sp|Q51455|CHEY_PSEAE Chemotaxis protein CheY OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cheY PE=3 SV=1 1553 1673 5.0E-06
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 1551 1672 5.0E-06
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 1551 1672 5.0E-06
sp|Q7A0I0|VRAR_STAAW Response regulator protein VraR OS=Staphylococcus aureus (strain MW2) GN=vraR PE=3 SV=1 1553 1672 6.0E-06
sp|Q6G850|VRAR_STAAS Response regulator protein VraR OS=Staphylococcus aureus (strain MSSA476) GN=vraR PE=3 SV=1 1553 1672 6.0E-06
sp|Q6GFH3|VRAR_STAAR Response regulator protein VraR OS=Staphylococcus aureus (strain MRSA252) GN=vraR PE=3 SV=1 1553 1672 6.0E-06
sp|Q7A4R9|VRAR_STAAN Response regulator protein VraR OS=Staphylococcus aureus (strain N315) GN=vraR PE=1 SV=1 1553 1672 6.0E-06
sp|Q7A2Q1|VRAR_STAAM Response regulator protein VraR OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=vraR PE=1 SV=1 1553 1672 6.0E-06
sp|P0C0Z1|VRAR_STAA1 Response regulator protein VraR OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=vraR PE=3 SV=1 1553 1672 6.0E-06
sp|P44845|NARP_HAEIN Nitrate/nitrite response regulator protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=narP PE=3 SV=1 1549 1674 6.0E-06
sp|P49333|ETR1_ARATH Ethylene receptor 1 OS=Arabidopsis thaliana GN=ETR1 PE=1 SV=1 937 1211 8.0E-06
sp|Q9FAD7|CHEY_ENTCL Chemotaxis protein CheY OS=Enterobacter cloacae GN=cheY PE=3 SV=3 1549 1675 8.0E-06
sp|P13792|PHOP_BACSU Alkaline phosphatase synthesis transcriptional regulatory protein PhoP OS=Bacillus subtilis (strain 168) GN=phoP PE=1 SV=4 1553 1662 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0000160 phosphorelay signal transduction system Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0007165 signal transduction Yes
GO:0050794 regulation of cellular process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0035556 intracellular signal transduction No
GO:0065007 biological regulation No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0140096 catalytic activity, acting on a protein No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0050789 regulation of biological process No
GO:0004672 protein kinase activity No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0008150 biological_process No
GO:0140299 small molecule sensor activity No
GO:0004673 protein histidine kinase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|083590
MPEPSHTGSNTAPLPPQYLANNTPAHHHLPTPEPRLPLSVFLQRPSRKPSRPSTAPALDGTLMLPLGSSAPALSG
KHNDVAFSADQCGFPLPSNGIVRYSNGVARRSEEPLTISSPSISSGSPPTISQDPSSQGSSPGPRSATDNADLDW
PTFIHIYAQGRWDPHRTPSRPKRYNEVNRPSATETSKWNHPTIISAAASDSSEEARPNSPLQSPPAELPSPSDTT
NESLKSQQTPVQSSTTATSTTANSSFQELQVLQKPSFILPNAPPTPLKFHGFRTNIPLSLPSPSHRIRNSFSNAH
STPYENLTTTTAAANAELQTTVATMRWAASRVDISPLALPSPEHELADPMRGVMAALPNNHTSEMNSDYAITPGG
TRKSRLTEFWEGTTDVEEVESPKRISEGSYPETKEGHLLRLVDPTMNIVDRNGDSTTEQRRPYYSLLTSVPAATA
PSRGAYHGGDVAQDDYFGHAAFETNTQSEYTTDPSVTTEEVESESESFGNYSNSSLQSILPDFVPATEPGISSVP
AVAKRASFTRQFSSPLPAAVPSKGTRANRTVSDVRQSRLSKEEKAFDELQYLAPPYPADEVERRRALYKYNIWNT
GPDINFDRIAHLAKLVFNTKGVMIAFIDGGEVWHKSEWGLKLTSNLRSTSLTGHAILQRGDEPMVVMDAHVDWRF
ARNPMVAGGPKVRFFAGAPLRTQDGYNVGTLALIDDTPRDDFSPRQRHTLKEFAAIVVREMELWRDKIQLRIRDR
IQNSMEQFSRECLEIDEESPTRERSNSVGGSSMDKVYDRAAKLVKRTLDVEGVIVMDVSHCQVLETMSAEANVAV
TMHFGEPGTEMRKQKLTTDEYHRLNVFFTKSPEGKISEGIVPTCFRPFLPTRIQYALTVPIYNIDRQLFALICAY
NASDQTKRFLEGHELSYLRAIGVIILSAVLKRRMILADKAKSLFISNISHELRTPLHGILAAAELLGDTSLNPSQ
LSYLQTVQACGTSLVETVNHVLDFTKLSGNSKAGGVEHAIVPSSVDLMQLVEEAVDGCWVGHRARTANLGDSGIG
SVYSPPKEENGDSVITKRRHVETVIDIGHKKEGWRLRCEKGGIRRVLMNLFGNSLKFTTDGYIHVMLHQLPRSED
DPPNKVRVELVVLDSGKGISQHFLKNQLFHPFSQENPLQTGTGLGLAIVSSIVTSEVVGGKVDVWSQEGVGTEIK
VTFNAEMDDDESYENENEINCMEPIKPKGETFSVISLVGFDNPHRGTQLLERVLRLYLERWWHLEVVTGADNGDV
VIVNEDMSLVLSATERNDISRSFIIMSCARGSPTLMHVATQFEQIGGFCRIIYKPGGPSRLRSVLDLAIHYQRVG
RATRSWSPSAVAPSSQTEIRTKSFVGSEGSNANESKTPEPPSYRPPSILPPSSSNGSTRNKTNDAVLSPNSAFPP
MSDITLNAQQRCDLSESPDVRSPTTSDSWDILESPERMKPLVEISAGQRRSGECIYTLKRPAPEANPEFVKRVTS
NHPLQILMPSAKDASPSRISEFTASAVVHVGDSGTLLKSSLQSEPVHDEKKFRVLVVEDNGILRNLLTKWLSNKG
YEFRHAVDGQAGVSVYNEEGPFDVILLDLSMPVLDGVSATAMIRRKEREEVEGHRARILALTGMSSLEDKRRAFE
AGVDGYLIKPVAFKILDEMFRKMGLI*
Coding >Agabi119p4|083590
ATGCCCGAACCTTCGCACACGGGATCGAATACTGCTCCATTGCCACCCCAATATCTAGCTAATAATACCCCAGCT
CATCATCATCTACCTACCCCCGAGCCTCGCCTGCCGTTGAGTGTCTTCCTCCAGCGGCCTTCGCGGAAACCATCT
CGCCCGTCAACGGCACCCGCCTTGGACGGTACTCTTATGCTCCCTCTTGGAAGTTCGGCCCCAGCACTATCAGGA
AAGCACAATGACGTCGCGTTCTCAGCCGACCAATGCGGCTTCCCTCTGCCATCGAATGGTATAGTGAGGTATTCC
AATGGCGTTGCCAGACGAAGCGAAGAGCCATTGACTATTTCATCTCCAAGTATCAGTTCTGGATCACCGCCAACT
ATTTCACAGGATCCTTCGTCGCAAGGCTCTTCCCCCGGCCCAAGATCTGCGACCGATAATGCAGATTTAGACTGG
CCAACCTTTATTCACATCTATGCACAAGGACGTTGGGATCCTCATCGGACACCAAGTCGTCCAAAGCGATACAAT
GAGGTCAACAGACCCTCAGCTACGGAAACTTCAAAGTGGAATCACCCTACAATAATATCAGCAGCAGCATCGGAT
TCTTCTGAGGAAGCTCGCCCCAACTCCCCCCTGCAGTCTCCCCCCGCGGAATTACCATCCCCATCAGATACCACG
AATGAGAGTTTGAAATCTCAGCAAACGCCTGTCCAATCTTCTACAACTGCCACTTCCACTACTGCCAATTCAAGT
TTTCAGGAGCTGCAAGTCCTCCAGAAGCCCTCCTTCATTCTTCCCAACGCCCCACCCACGCCTCTCAAATTTCAT
GGCTTTCGGACTAACATTCCTCTAAGTCTTCCTTCACCCTCCCATCGTATCCGCAATTCGTTTTCAAATGCCCAT
TCCACACCATACGAAAATCTCACTACAACTACCGCAGCCGCAAATGCAGAGTTACAGACGACTGTTGCCACTATG
CGTTGGGCTGCTTCACGAGTGGATATCTCGCCTCTTGCGCTCCCCTCGCCTGAACATGAACTTGCCGACCCTATG
AGAGGGGTTATGGCTGCCCTTCCTAACAATCATACCTCAGAAATGAACTCTGATTATGCTATTACACCTGGTGGT
ACTCGTAAAAGTCGGCTGACAGAGTTTTGGGAGGGTACAACTGATGTTGAAGAAGTTGAGAGTCCAAAACGGATC
TCTGAAGGATCATACCCAGAAACGAAAGAAGGCCATTTGTTGCGACTGGTAGACCCAACAATGAATATTGTAGAT
CGCAATGGCGATTCTACAACGGAACAGCGAAGACCGTATTATAGCCTGCTCACGTCCGTGCCGGCTGCGACTGCA
CCTTCGAGGGGTGCCTATCATGGGGGTGATGTTGCCCAAGATGACTACTTTGGTCACGCTGCATTTGAAACGAAC
ACCCAGTCCGAGTATACCACAGATCCATCGGTGACAACGGAAGAAGTTGAATCGGAAAGCGAATCTTTCGGGAAC
TATTCAAATTCCTCCTTACAGTCTATTTTACCCGACTTTGTGCCTGCAACCGAGCCTGGTATCTCCTCGGTACCT
GCGGTGGCGAAAAGGGCATCGTTCACTAGGCAATTTTCTTCGCCGCTGCCAGCTGCGGTCCCATCCAAGGGAACT
CGTGCTAATCGTACGGTTTCAGACGTCAGGCAATCTCGACTCTCAAAAGAGGAAAAAGCTTTTGATGAATTGCAA
TATCTGGCTCCTCCTTACCCTGCGGATGAGGTCGAAAGAAGACGGGCACTATACAAATATAATATCTGGAACACT
GGACCGGATATCAATTTTGATCGAATAGCTCACCTGGCGAAGCTGGTTTTTAACACCAAGGGCGTGATGATCGCG
TTTATTGATGGTGGTGAAGTGTGGCATAAATCAGAGTGGGGTTTGAAACTTACGAGCAATCTGCGCTCTACGTCT
CTTACCGGCCACGCCATTTTACAGCGTGGGGATGAACCCATGGTCGTGATGGACGCTCACGTTGATTGGAGGTTT
GCACGGAATCCAATGGTAGCTGGAGGTCCTAAAGTACGTTTCTTTGCGGGGGCACCACTACGGACGCAAGACGGA
TACAATGTTGGAACTTTGGCTCTCATCGATGACACCCCTCGAGACGATTTTTCTCCTCGACAGAGACATACACTC
AAGGAATTTGCGGCTATTGTAGTGCGTGAAATGGAACTCTGGCGTGACAAGATTCAATTGCGGATCCGGGATCGA
ATTCAAAATTCTATGGAACAATTTTCCCGTGAGTGCCTTGAAATCGATGAAGAGTCTCCCACACGGGAACGCAGT
AATTCCGTTGGCGGTTCTTCAATGGATAAAGTGTACGATCGCGCAGCCAAGTTGGTGAAACGTACTCTCGATGTG
GAAGGCGTAATTGTAATGGATGTGTCGCATTGCCAAGTCTTGGAAACGATGAGTGCTGAGGCAAATGTAGCAGTG
ACAATGCACTTTGGGGAGCCAGGTACAGAGATGAGAAAGCAGAAGTTGACGACCGATGAATACCATCGACTCAAT
GTGTTTTTCACGAAATCCCCAGAGGGTAAAATCTCGGAAGGAATCGTTCCTACATGTTTCCGTCCCTTTTTGCCT
ACTCGCATTCAATACGCCTTGACCGTACCAATATACAATATTGACAGACAACTATTTGCACTGATATGTGCCTAT
AATGCATCTGACCAAACAAAACGTTTTCTCGAGGGCCATGAGCTTTCCTACCTTCGTGCCATTGGTGTTATCATA
CTTTCTGCGGTACTCAAACGTCGGATGATTCTGGCCGACAAAGCAAAAAGCTTGTTTATATCAAATATTTCGCAT
GAACTGCGGACACCTTTGCATGGGATTCTGGCCGCTGCTGAGCTTCTCGGAGACACATCTCTTAATCCATCGCAA
CTATCTTATTTACAGACCGTTCAGGCGTGTGGGACGTCACTCGTGGAAACCGTTAACCATGTCCTTGATTTCACC
AAGTTGAGCGGAAACTCGAAGGCTGGTGGAGTTGAACACGCTATTGTACCGTCCAGTGTGGACCTTATGCAGCTG
GTTGAAGAGGCTGTGGATGGTTGCTGGGTTGGCCATAGGGCTCGGACAGCTAATTTGGGCGATTCCGGTATCGGA
AGTGTTTATTCACCACCCAAGGAGGAAAATGGGGATTCGGTCATCACGAAACGAAGACATGTTGAAACCGTCATT
GATATCGGACACAAGAAGGAGGGTTGGAGATTAAGATGTGAGAAGGGAGGCATTCGACGTGTTCTGATGAACTTG
TTTGGGAACAGCCTGAAGTTCACCACGGACGGCTATATTCATGTCATGCTTCATCAACTACCGAGATCTGAGGAT
GATCCACCAAACAAAGTGAGGGTCGAACTGGTTGTCCTTGATTCGGGCAAGGGCATCAGCCAGCATTTTTTGAAG
AATCAACTCTTCCACCCATTTTCACAGGAAAACCCTCTACAAACAGGGACTGGGCTTGGATTGGCGATCGTCAGC
TCCATCGTAACGTCAGAAGTCGTAGGAGGTAAAGTAGATGTCTGGAGTCAGGAGGGCGTGGGCACCGAAATCAAA
GTAACCTTCAACGCTGAAATGGACGATGACGAATCCTACGAGAATGAAAATGAGATCAACTGTATGGAGCCAATC
AAGCCTAAAGGCGAGACTTTTTCAGTGATTTCTTTGGTTGGATTCGACAATCCCCATCGTGGAACTCAGTTGCTC
GAGAGGGTACTGCGCTTGTACTTGGAGAGATGGTGGCACCTAGAAGTTGTTACGGGCGCAGACAATGGCGACGTG
GTGATCGTGAATGAAGATATGTCGCTCGTCTTGTCTGCGACGGAACGCAACGATATTAGCCGTTCATTTATCATC
ATGTCTTGTGCGCGGGGCAGTCCAACTCTCATGCATGTAGCAACCCAATTCGAGCAGATCGGAGGATTTTGCCGT
ATCATCTACAAACCTGGTGGACCATCTCGACTTCGCTCTGTTCTCGACTTAGCCATCCACTACCAAAGGGTCGGT
CGTGCGACTCGTTCCTGGAGTCCATCCGCCGTTGCACCCTCTTCGCAGACGGAAATCAGAACCAAATCATTTGTG
GGGAGCGAGGGGAGTAATGCAAATGAATCCAAGACGCCTGAACCACCATCATACAGGCCCCCTTCCATTTTACCC
CCGTCATCTTCAAATGGATCCACGCGAAATAAAACTAACGACGCGGTGTTGTCACCGAACTCCGCGTTTCCGCCA
ATGAGTGATATAACGCTCAACGCTCAGCAAAGATGTGACCTATCAGAATCACCGGATGTAAGGTCTCCTACGACC
TCAGACTCGTGGGACATACTAGAAAGTCCTGAACGAATGAAACCTCTTGTCGAAATCTCTGCCGGGCAGCGACGG
AGTGGCGAATGTATCTACACCCTCAAAAGACCCGCCCCCGAAGCGAACCCAGAATTCGTCAAAAGGGTGACTTCA
AATCATCCGCTGCAAATTTTGATGCCTTCTGCCAAGGACGCCTCACCATCTCGTATCTCAGAGTTTACAGCCTCG
GCAGTCGTTCACGTTGGTGACTCTGGTACTCTGCTGAAGTCATCTCTTCAATCGGAGCCAGTTCATGATGAGAAG
AAGTTCCGTGTTCTTGTTGTGGAAGATAACGGTATTCTTCGTAACCTCTTAACGAAATGGTTGTCGAACAAAGGG
TACGAATTTCGTCACGCCGTGGACGGCCAGGCCGGTGTATCCGTGTACAACGAAGAAGGGCCCTTTGACGTGATT
CTATTGGATCTCTCCATGCCCGTCCTCGACGGCGTCTCTGCCACCGCCATGATTCGTCGAAAGGAGAGAGAGGAA
GTGGAAGGCCACCGCGCAAGAATCCTTGCACTCACAGGCATGTCTTCTCTCGAAGATAAGCGACGAGCATTCGAA
GCAGGTGTTGATGGATATCTCATCAAACCTGTCGCGTTCAAGATTCTCGACGAGATGTTTCGCAAAATGGGTCTT
ATCTAA
Transcript >Agabi119p4|083590
ATGCCCGAACCTTCGCACACGGGATCGAATACTGCTCCATTGCCACCCCAATATCTAGCTAATAATACCCCAGCT
CATCATCATCTACCTACCCCCGAGCCTCGCCTGCCGTTGAGTGTCTTCCTCCAGCGGCCTTCGCGGAAACCATCT
CGCCCGTCAACGGCACCCGCCTTGGACGGTACTCTTATGCTCCCTCTTGGAAGTTCGGCCCCAGCACTATCAGGA
AAGCACAATGACGTCGCGTTCTCAGCCGACCAATGCGGCTTCCCTCTGCCATCGAATGGTATAGTGAGGTATTCC
AATGGCGTTGCCAGACGAAGCGAAGAGCCATTGACTATTTCATCTCCAAGTATCAGTTCTGGATCACCGCCAACT
ATTTCACAGGATCCTTCGTCGCAAGGCTCTTCCCCCGGCCCAAGATCTGCGACCGATAATGCAGATTTAGACTGG
CCAACCTTTATTCACATCTATGCACAAGGACGTTGGGATCCTCATCGGACACCAAGTCGTCCAAAGCGATACAAT
GAGGTCAACAGACCCTCAGCTACGGAAACTTCAAAGTGGAATCACCCTACAATAATATCAGCAGCAGCATCGGAT
TCTTCTGAGGAAGCTCGCCCCAACTCCCCCCTGCAGTCTCCCCCCGCGGAATTACCATCCCCATCAGATACCACG
AATGAGAGTTTGAAATCTCAGCAAACGCCTGTCCAATCTTCTACAACTGCCACTTCCACTACTGCCAATTCAAGT
TTTCAGGAGCTGCAAGTCCTCCAGAAGCCCTCCTTCATTCTTCCCAACGCCCCACCCACGCCTCTCAAATTTCAT
GGCTTTCGGACTAACATTCCTCTAAGTCTTCCTTCACCCTCCCATCGTATCCGCAATTCGTTTTCAAATGCCCAT
TCCACACCATACGAAAATCTCACTACAACTACCGCAGCCGCAAATGCAGAGTTACAGACGACTGTTGCCACTATG
CGTTGGGCTGCTTCACGAGTGGATATCTCGCCTCTTGCGCTCCCCTCGCCTGAACATGAACTTGCCGACCCTATG
AGAGGGGTTATGGCTGCCCTTCCTAACAATCATACCTCAGAAATGAACTCTGATTATGCTATTACACCTGGTGGT
ACTCGTAAAAGTCGGCTGACAGAGTTTTGGGAGGGTACAACTGATGTTGAAGAAGTTGAGAGTCCAAAACGGATC
TCTGAAGGATCATACCCAGAAACGAAAGAAGGCCATTTGTTGCGACTGGTAGACCCAACAATGAATATTGTAGAT
CGCAATGGCGATTCTACAACGGAACAGCGAAGACCGTATTATAGCCTGCTCACGTCCGTGCCGGCTGCGACTGCA
CCTTCGAGGGGTGCCTATCATGGGGGTGATGTTGCCCAAGATGACTACTTTGGTCACGCTGCATTTGAAACGAAC
ACCCAGTCCGAGTATACCACAGATCCATCGGTGACAACGGAAGAAGTTGAATCGGAAAGCGAATCTTTCGGGAAC
TATTCAAATTCCTCCTTACAGTCTATTTTACCCGACTTTGTGCCTGCAACCGAGCCTGGTATCTCCTCGGTACCT
GCGGTGGCGAAAAGGGCATCGTTCACTAGGCAATTTTCTTCGCCGCTGCCAGCTGCGGTCCCATCCAAGGGAACT
CGTGCTAATCGTACGGTTTCAGACGTCAGGCAATCTCGACTCTCAAAAGAGGAAAAAGCTTTTGATGAATTGCAA
TATCTGGCTCCTCCTTACCCTGCGGATGAGGTCGAAAGAAGACGGGCACTATACAAATATAATATCTGGAACACT
GGACCGGATATCAATTTTGATCGAATAGCTCACCTGGCGAAGCTGGTTTTTAACACCAAGGGCGTGATGATCGCG
TTTATTGATGGTGGTGAAGTGTGGCATAAATCAGAGTGGGGTTTGAAACTTACGAGCAATCTGCGCTCTACGTCT
CTTACCGGCCACGCCATTTTACAGCGTGGGGATGAACCCATGGTCGTGATGGACGCTCACGTTGATTGGAGGTTT
GCACGGAATCCAATGGTAGCTGGAGGTCCTAAAGTACGTTTCTTTGCGGGGGCACCACTACGGACGCAAGACGGA
TACAATGTTGGAACTTTGGCTCTCATCGATGACACCCCTCGAGACGATTTTTCTCCTCGACAGAGACATACACTC
AAGGAATTTGCGGCTATTGTAGTGCGTGAAATGGAACTCTGGCGTGACAAGATTCAATTGCGGATCCGGGATCGA
ATTCAAAATTCTATGGAACAATTTTCCCGTGAGTGCCTTGAAATCGATGAAGAGTCTCCCACACGGGAACGCAGT
AATTCCGTTGGCGGTTCTTCAATGGATAAAGTGTACGATCGCGCAGCCAAGTTGGTGAAACGTACTCTCGATGTG
GAAGGCGTAATTGTAATGGATGTGTCGCATTGCCAAGTCTTGGAAACGATGAGTGCTGAGGCAAATGTAGCAGTG
ACAATGCACTTTGGGGAGCCAGGTACAGAGATGAGAAAGCAGAAGTTGACGACCGATGAATACCATCGACTCAAT
GTGTTTTTCACGAAATCCCCAGAGGGTAAAATCTCGGAAGGAATCGTTCCTACATGTTTCCGTCCCTTTTTGCCT
ACTCGCATTCAATACGCCTTGACCGTACCAATATACAATATTGACAGACAACTATTTGCACTGATATGTGCCTAT
AATGCATCTGACCAAACAAAACGTTTTCTCGAGGGCCATGAGCTTTCCTACCTTCGTGCCATTGGTGTTATCATA
CTTTCTGCGGTACTCAAACGTCGGATGATTCTGGCCGACAAAGCAAAAAGCTTGTTTATATCAAATATTTCGCAT
GAACTGCGGACACCTTTGCATGGGATTCTGGCCGCTGCTGAGCTTCTCGGAGACACATCTCTTAATCCATCGCAA
CTATCTTATTTACAGACCGTTCAGGCGTGTGGGACGTCACTCGTGGAAACCGTTAACCATGTCCTTGATTTCACC
AAGTTGAGCGGAAACTCGAAGGCTGGTGGAGTTGAACACGCTATTGTACCGTCCAGTGTGGACCTTATGCAGCTG
GTTGAAGAGGCTGTGGATGGTTGCTGGGTTGGCCATAGGGCTCGGACAGCTAATTTGGGCGATTCCGGTATCGGA
AGTGTTTATTCACCACCCAAGGAGGAAAATGGGGATTCGGTCATCACGAAACGAAGACATGTTGAAACCGTCATT
GATATCGGACACAAGAAGGAGGGTTGGAGATTAAGATGTGAGAAGGGAGGCATTCGACGTGTTCTGATGAACTTG
TTTGGGAACAGCCTGAAGTTCACCACGGACGGCTATATTCATGTCATGCTTCATCAACTACCGAGATCTGAGGAT
GATCCACCAAACAAAGTGAGGGTCGAACTGGTTGTCCTTGATTCGGGCAAGGGCATCAGCCAGCATTTTTTGAAG
AATCAACTCTTCCACCCATTTTCACAGGAAAACCCTCTACAAACAGGGACTGGGCTTGGATTGGCGATCGTCAGC
TCCATCGTAACGTCAGAAGTCGTAGGAGGTAAAGTAGATGTCTGGAGTCAGGAGGGCGTGGGCACCGAAATCAAA
GTAACCTTCAACGCTGAAATGGACGATGACGAATCCTACGAGAATGAAAATGAGATCAACTGTATGGAGCCAATC
AAGCCTAAAGGCGAGACTTTTTCAGTGATTTCTTTGGTTGGATTCGACAATCCCCATCGTGGAACTCAGTTGCTC
GAGAGGGTACTGCGCTTGTACTTGGAGAGATGGTGGCACCTAGAAGTTGTTACGGGCGCAGACAATGGCGACGTG
GTGATCGTGAATGAAGATATGTCGCTCGTCTTGTCTGCGACGGAACGCAACGATATTAGCCGTTCATTTATCATC
ATGTCTTGTGCGCGGGGCAGTCCAACTCTCATGCATGTAGCAACCCAATTCGAGCAGATCGGAGGATTTTGCCGT
ATCATCTACAAACCTGGTGGACCATCTCGACTTCGCTCTGTTCTCGACTTAGCCATCCACTACCAAAGGGTCGGT
CGTGCGACTCGTTCCTGGAGTCCATCCGCCGTTGCACCCTCTTCGCAGACGGAAATCAGAACCAAATCATTTGTG
GGGAGCGAGGGGAGTAATGCAAATGAATCCAAGACGCCTGAACCACCATCATACAGGCCCCCTTCCATTTTACCC
CCGTCATCTTCAAATGGATCCACGCGAAATAAAACTAACGACGCGGTGTTGTCACCGAACTCCGCGTTTCCGCCA
ATGAGTGATATAACGCTCAACGCTCAGCAAAGATGTGACCTATCAGAATCACCGGATGTAAGGTCTCCTACGACC
TCAGACTCGTGGGACATACTAGAAAGTCCTGAACGAATGAAACCTCTTGTCGAAATCTCTGCCGGGCAGCGACGG
AGTGGCGAATGTATCTACACCCTCAAAAGACCCGCCCCCGAAGCGAACCCAGAATTCGTCAAAAGGGTGACTTCA
AATCATCCGCTGCAAATTTTGATGCCTTCTGCCAAGGACGCCTCACCATCTCGTATCTCAGAGTTTACAGCCTCG
GCAGTCGTTCACGTTGGTGACTCTGGTACTCTGCTGAAGTCATCTCTTCAATCGGAGCCAGTTCATGATGAGAAG
AAGTTCCGTGTTCTTGTTGTGGAAGATAACGGTATTCTTCGTAACCTCTTAACGAAATGGTTGTCGAACAAAGGG
TACGAATTTCGTCACGCCGTGGACGGCCAGGCCGGTGTATCCGTGTACAACGAAGAAGGGCCCTTTGACGTGATT
CTATTGGATCTCTCCATGCCCGTCCTCGACGGCGTCTCTGCCACCGCCATGATTCGTCGAAAGGAGAGAGAGGAA
GTGGAAGGCCACCGCGCAAGAATCCTTGCACTCACAGGCATGTCTTCTCTCGAAGATAAGCGACGAGCATTCGAA
GCAGGTGTTGATGGATATCTCATCAAACCTGTCGCGTTCAAGATTCTCGACGAGATGTTTCGCAAAATGGGTCTT
ATCTAA
Gene >Agabi119p4|083590
ATGCCCGAACCTTCGCACACGGGATCGAATACTGCTCCATTGCCACCCCAATATCTAGCTAATAATACCCCAGCT
CATCATCATCTACCTACCCCCGAGCCTCGCCTGCCGTTGAGTGTCTTCCTCCAGCGGCCTTCGCGGAAACCATCT
CGCCCGTCAACGGCACCCGCCTTGGACGGTACTCTTATGCTCCCTCTTGGAAGTTCGGCCCCAGCACTATCAGGA
AAGCACAATGACGTCGCGTTCTCAGCCGACCAATGCGGCTTCCCTCTGCCATCGAATGGTATAGTGAGGTATTCC
AATGGCGTTGCCAGACGAAGCGAAGAGCCATTGACTATTTCATCTCCAAGTATCAGTTCTGGTGTGTACAGCTTC
ATTCATTTATACTCAGCCATTTGAGTAATTTTGTATATCCAGGATCACCGCCAACTATTTCACAGGATCCTTCGT
CGCAAGGCTCTTCCCCCGGCCCAAGATCTGCGACCGATAATGCAGATTTAGACTGGCCAACCTTTATTCACATCT
ATGCACAAGGACGTTGGGATCCTCATCGGACACCAAGTCGTCCAAAGCGATACAATGAGGTCAACAGACCCTCAG
CTACGGAAACTTCAAAGTGGAATCACCCTACAATAATATCAGCAGCAGCATCGGATTCTTCTGAGGAAGCTCGCC
CCAACTCCCCCCTGCAGTCTCCCCCCGCGGAATTACCATCCCCATCAGATACCACGAATGAGAGTTTGAAATCTC
AGCAAACGCCTGTCCAATCTTCTACAACTGCCACTTCCACTACTGCCAATTCAAGTTTTCAGGAGCTGCAAGTCC
TCCAGAAGCCCTCCTTCATTCTTCCCAACGCCCCACCCACGCCTCTCAAATTTCATGGCTTTCGGACTAACATTC
CTCTAAGTCTTCCTTCACCCTCCCATCGTATCCGCAATTCGTTTTCAAATGCCCATTCCACACCATACGAAAATC
TCACTACAACTACCGCAGCCGCAAATGCAGAGTTACAGACGACTGTTGCCACTATGCGTTGGGCTGCTTCACGAG
TGGATATCTCGCCTCTTGCGCTCCCCTCGCCTGAACATGAACTTGCCGACCCTATGAGAGGGGTTATGGCTGCCC
TTCCTAACAATCATACCTCAGAAATGAACTCTGATTATGCTATTACACCTGGTGGTACTCGTAAAAGTCGGCTGA
CAGAGTTTTGGGAGGGTACAACTGATGTTGAAGAAGTTGAGAGTCCAAAACGGATCTCTGAAGGATCATACCCAG
AAACGAAAGAAGGCCATTTGTTGCGACTGGTAGACCCAACAATGAATATTGTAGATCGCAATGGCGATTCTACAA
CGGAACAGCGAAGACCGTATTATAGCCTGCTCACGTCCGTGCCGGCTGCGACTGCACCTTCGAGGGGTGCCTATC
ATGGGGGTGATGTTGCCCAAGATGACTACTTTGGTCACGCTGCATTTGAAACGAACACCCAGTCCGAGTATACCA
CAGATCCATCGGTGACAACGGAAGAAGTTGAATCGGAAAGCGAATCTTTCGGGAACTATTCAAATTCCTCCTTAC
AGTCTATTTTACCCGACTTTGTGCCTGCAACCGAGCCTGGTATCTCCTCGGTACCTGCGGTGGCGAAAAGGGCAT
CGTTCACTAGGCAATTTTCTTCGCCGCTGCCAGCTGCGGTCCCATCCAAGGGAACTCGTGCTAATCGTACGGTTT
CAGACGTCAGGCAATCTCGACTCTCAAAAGAGGAAAAAGCTTTTGATGAATTGCAATATCTGGCTCCTCCTTACC
CTGCGGATGAGGTCGAAAGAAGACGGGCACTATACAAGTACGTTTTAAAGTCTGTCAAACCTTCGCAGATTATTT
CATACAAGCTTTAGATATAATATCTGGAACACTGGACCGGATATCAATTTTGATCGAATAGCTCACCTGGCGAAG
CTGGTTTTTAACACCAAGGGCGTGATGATCGCGTTTATTGATGGTGGTGAAGTGTGAGTGTATCTTTTCATTTTT
ACCCCCATGCCGTTGACGTCATACGTCAAAGGTGGCATAAATCAGAGTGTGAGTCTCCTTGACGTATCTAATTGC
GGCTTTCAGCTCAAGAGTTTTATCTCATAAGGGGGTTTGAAACTTACGAGCAATCTGCGCTCTACGTCTCTTACC
GGCCACGCCATTTTACAGCGGTGAGTAATTGGCTTTATCCTTGTTGAGCTTTATTTGACATATGTACCAGTGGGG
ATGAACCCATGGTCGTGATGGACGCTCACGTTGATTGGAGGTTTGCACGGAATGTACGCATTTATAAGCCCTGTT
GCAATCGCATTAGCTGAAACCTTAAATGGCAGCCAATGGTAGCTGGAGGTCCTAAAGTACGTTTCTTTGCGGGGG
CACCACTACGGACGCAAGACGGATACAATGTTGGAACGTACGTCTCTTTGTCCCGTGCATCGGCCTACAAATTGA
AGAATCATGTTGAAGTTTGGCTCTCATCGATGACACCCCTCGAGACGATTTTTCTCCTCGACAGAGACATACACT
CAAGGAATTTGCGGTACGTTCATCATCCAGTATACTTGTTTCTCAACGTTAATTTTTTCATAGGCTATTGTAGTG
CGTGAAATGGAACTCTGGCGTGACAAGGTATGTTGTTTAGACGATGCAAGTTGCGTCGACTCTTAAAATCTGTCT
AAGATTCAATTGCGGATCCGGGATCGAATTCAAAATTCTGTAGGTTGAGTTACCTTCTTCAGGGCTCAGTGGGAT
TCACCAATAATATCTTTGGCATAGATGGAACAATTTTCCCGTGAGTGCCTTGAAATCGATGAAGAGTCTCCCACA
CGGGAACGCAGTAATTCCGTTGGCGGTTCTTCAATGGATAAAGTGTACGATCGCGCAGCCAAGTTGGTGAAACGT
ACTCTCGATGTGGAAGGCGTAATTGTAATGGATGTGTCGCATTGCCAAGTCTTGGAAACGATGAGTGCTGAGGCA
AATGTAGCAGTGACAATGCACTTTGGGGAGCCAGGTACAGAGATGAGAAAGCAGAAGTTGACGACCGATGAATAC
CATCGACTCAATGTGTTTTTCACGAAATCCCCAGAGGGTAAAATCTCGGAAGGAATCGTTCCTACATGTTTCCGT
CCCTTTTTGCCTACTCGCATTCAATACGCCTTGAGTAAGCTAAGTCCCTTCTGTCGCAGCATAACAACGCTGATT
CAAACTGTCTAGCCGTACCAATATACAATATTGACAGACAACTATTTGCACTGATATGTGCCTATAATGCATCTG
ACCAAACAAAACGTTTTGTATGTTGCTCACCACGTCGTCGTTGCATCTCATTAACCATAGGTTCAGCTCGAGGGC
CATGAGCTTTCCTACCTTCGTGCCATTGGTAAAAATAGTTCTATTCTATTACTTAAATCTGTTGCTCACGTTATT
GAAGGTGTTATCATACTTTCTGCGGTACTCAAACGTCGGATGATTCTGGCCGACAAAGCAAAAAGCTTGTTTATA
TCAAAGTATGTAGAGGTATCTTTCTTTGAATATGTATTCACTCGACTTCCACGTAGTATTTCGCATGAACTGCGG
ACACCTTTGCATGGGGTAAACCTTTTCACCACCCTATCTCGCGTTCTTGTCTCATTTCACGTCTATAGATTCTGG
CCGCTGCTGAGCTTCTCGGAGACACATCTCTTAATCCATCGCAACTATCTTATTTACAGACCGTTCAGGCGTGTG
GGACGTCACTCGTGGAAACCGTTAACCATGTCCTTGATTTCACCAAGTTGAGCGGAAACTCGAAGGCTGGTGGAG
TTGAACACGCTATTGTACCGTCCAGGTCCGTGATTTCGAAAAATGAGACCTGCATAGAACTGACGGCTGTCTTTT
TGGTGATACGTTAGTGTGGACCTTATGCAGCTGGTTGAAGAGGCTGTGGATGGTTGCTGGGTTGGCCATAGGGCT
CGGACAGCTAATTTGGGCGATTCCGGTATCGGAAGTGTTTATTCACCACCCAAGGAGGAAAATGGGGATTCGGTC
ATCACGAAACGAAGACATGTTGAAACCGTCATTGATATCGGACACAAGAAGGAGGTGAGTGATTTTTTGATAGTT
TTACCTACTATCCCGCAGTTTTGAATGTTCATCGTAGGGTTGGAGATTAAGATGTGAGAAGGGAGGCATTCGACG
TGTTCTGATGAACTTGTTTGGGAACAGCCTGAAGTTCACCACGGTGAGTTGAATTTCGAGTGTGTAATCTGCATG
TAATCCTCATTTGACTAAGGACGGCTATATTCATGTCATGCTTCATCAACTACCGAGATCTGAGGATGATCCACC
AAACAAAGTGAGGGTCGAACTGGTTGTCCTTGATTCGGGCAAGGTTTGTGATAGACTTTTCCAACCCTTGGCTTT
TGTTGACTCGAACTTCACCGAATATAGGGCATCAGCCAGCATTTTTTGAAGGTGGGAACTGAATTTCCAAATATC
CGGTTATTTTTGCTCATACCAACTTAGAATCAACTCTTCCACCCATTTTCACAGGAAAACCCTCTACAAACAGGG
ACTGGGCTTGGATTGGCGATCGTCAGCTCCATCGTAACGTCAGAAGTCGTAGGAGGTAAAGTAGATGTCTGGAGT
CAGGAGGGCGTGGGCACCGAAATCAAAGTAACCTTCAACGCTGAAATGGACGATGACGAATCCTACGAGAATGAA
AATGAGATCAACTGTATGGAGCCAATCAAGCCTAAAGGCGAGACTTTTTCAGTGATTTCTTTGGTTGGATTCGAC
AATCCCCATCGTGGAACTCAGTTGCTCGAGAGGGTACTGCGCTTGTACTTGGAGAGATGGTGGCACCTAGAAGTT
GTTACGGGCGCAGACAATGGCGACGTGGTGATCGTGAATGAAGATATGTCGCTCGTCTTGTCTGCGACGGAACGC
AACGATATTAGCCGTTCATTTATCATCATGTCTTGTGCGCGGGGCAGTCCAACTCTCATGCATGTAGCAACCCAA
TTCGAGCAGATCGGAGGATTTTGCCGTATCATCTACAAACCTGGTGGACCATCTCGACTTCGCTCTGTTCTCGAC
TTAGCCATCCACTACCAAAGGGTCGGTCGTGCGACTCGTTCCTGGAGTCCATCCGCCGTTGCACCCTCTTCGCAG
ACGGAAATCAGAACCAAATCATTTGTGGGGAGCGAGGGGAGTAATGCAAATGAATCCAAGACGCCTGAACCACCA
TCATACAGGCCCCCTTCCATTTTACCCCCGTCATCTTCAAATGGATCCACGCGAAATAAAACTAACGACGCGGTG
TTGTCACCGAACTCCGCGTTTCCGCCAATGAGTGATATAACGCTCAACGCTCAGCAAAGATGTGACCTATCAGAA
TCACCGGATGTAAGGTCTCCTACGACCTCAGACTCGTGGGACATACTAGAAAGTCCTGAACGAATGAAACCTCTT
GTCGAAATCTCTGCCGGGCAGCGACGGAGTGGCGAATGTATCTACACCCTCAAAAGACCCGCCCCCGAAGCGAAC
CCAGAATTCGTCAAAAGGGTGACTTCAAATCATCCGCTGCAAATTTTGATGCCTTCTGCCAAGGACGCCTCACCA
TCTCGTATCTCAGAGTTTACAGCCTCGGCAGTCGTTCACGTTGGTGACTCTGGTACTCTGCTGAAGTCATCTCTT
CAATCGGAGCCAGTTCATGATGAGAAGAAGTTCCGTGTTCTTGTTGTGGAAGATAACGGTATTCTTCGTAACCTC
TTGTAAATCATCGTTTGCATTCTGATGAGATCCACTTGCTGATTTGTGCGTATGTTGAAGAACGAAATGGTTGTC
GAACAAAGGGTACGAATTTCGTCACGCCGTGGACGGCCAGGCCGGTGTATCCGTGTACAACGAAGAAGGGCCCTT
TGAGTGCGTCGAATTGTCATTCCTCTAAGAGCGTCGCGTCTAATCTTGTGCACAAGCGTGATTCTATTGGATCTC
TCCATGCCCGTCCTCGACGGTGAGTCGATTTTACTGTTGTCTCTTCAGGGCTAACGTTCAACCAGGCGTCTCTGC
CACCGCCATGATTCGTCGAAAGGAGAGAGAGGAAGTGGAAGGCCACCGCGCAAGAATCCTTGCACTCACAGGCAT
GTCTTCTCTCGAAGATAAGCGACGAGCATTCGAAGCAGGTGTTGATGGATAGTAAGTCACCTGCTGTTCCCTCTT
CCTTCAATCAGTCGCTCATCTGATCCAATTCCGGCAGTCTCATCAAACCTGTCGCGTTCAAGATTCTCGACGAGA
TGTTTCGCAAAATGGGTCTTATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail