Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|082870
Gene name
Locationscaffold_05a:1252742..1254321
Strand-
Gene length (bp)1579
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02560 Cyanate_lyase Cyanate lyase C-terminal domain 5.3E-33 250 316
PF13233 Complex1_LYR_2 Complex1_LYR-like 3.9E-19 30 85
PF05347 Complex1_LYR Complex 1 protein (LYR family) 5.9E-11 31 83

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0DN41|CYNS_LACBS Cyanate hydratase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=CYN1 PE=3 SV=1 161 318 1.0E-79
sp|A8NV38|CYNS_COPC7 Cyanate hydratase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CYN1 PE=3 SV=2 172 318 4.0E-73
sp|Q3M8R1|CYNS_ANAVT Cyanate hydratase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=cynS PE=3 SV=1 172 318 1.0E-43
sp|P58703|CYNS_NOSS1 Cyanate hydratase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cynS PE=3 SV=1 172 318 3.0E-43
sp|Q55367|CYNS_SYNY3 Cyanate hydratase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cynS PE=1 SV=1 171 318 5.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0DN41|CYNS_LACBS Cyanate hydratase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=CYN1 PE=3 SV=1 161 318 1.0E-79
sp|A8NV38|CYNS_COPC7 Cyanate hydratase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CYN1 PE=3 SV=2 172 318 4.0E-73
sp|Q3M8R1|CYNS_ANAVT Cyanate hydratase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=cynS PE=3 SV=1 172 318 1.0E-43
sp|P58703|CYNS_NOSS1 Cyanate hydratase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cynS PE=3 SV=1 172 318 3.0E-43
sp|Q55367|CYNS_SYNY3 Cyanate hydratase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cynS PE=1 SV=1 171 318 5.0E-43
sp|Q4PD40|CYNS_USTMA Cyanate hydratase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYN1 PE=3 SV=2 169 318 3.0E-40
sp|B0C8H2|CYNS_ACAM1 Cyanate hydratase OS=Acaryochloris marina (strain MBIC 11017) GN=cynS PE=3 SV=1 175 318 3.0E-40
sp|P0CN02|CYNS_CRYNJ Cyanate hydratase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYN1 PE=3 SV=1 169 316 2.0E-37
sp|P0CN03|CYNS_CRYNB Cyanate hydratase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYN1 PE=3 SV=1 169 316 2.0E-37
sp|Q7U3E2|CYNS_SYNPX Cyanate hydratase OS=Synechococcus sp. (strain WH8102) GN=cynS PE=3 SV=1 175 318 4.0E-37
sp|B2WIX9|CYNS_PYRTR Cyanate hydratase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cyn1 PE=3 SV=2 171 318 5.0E-37
sp|Q5N0J1|CYNS_SYNP6 Cyanate hydratase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cynS PE=3 SV=1 175 318 1.0E-36
sp|Q59948|CYNS_SYNE7 Cyanate hydratase OS=Synechococcus elongatus (strain PCC 7942) GN=cynS PE=1 SV=1 175 318 1.0E-36
sp|Q0I634|CYNS_SYNS3 Cyanate hydratase OS=Synechococcus sp. (strain CC9311) GN=cynS PE=3 SV=1 175 318 2.0E-36
sp|Q46I00|CYNS_PROMT Cyanate hydratase OS=Prochlorococcus marinus (strain NATL2A) GN=cynS PE=3 SV=1 171 318 3.0E-36
sp|A7F1L5|CYNS_SCLS1 Cyanate hydratase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=cyn1 PE=3 SV=1 171 318 3.0E-36
sp|A6S6V7|CYNS_BOTFB Cyanate hydratase OS=Botryotinia fuckeliana (strain B05.10) GN=cyn1 PE=3 SV=1 171 318 3.0E-36
sp|A2BZH4|CYNS_PROM1 Cyanate hydratase OS=Prochlorococcus marinus (strain NATL1A) GN=cynS PE=3 SV=1 171 318 4.0E-36
sp|Q4PCI7|SDHF3_USTMA Succinate dehydrogenase assembly factor 3, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10065 PE=3 SV=2 1 117 3.0E-35
sp|Q871Z4|CYNS_NEUCR Cyanate hydratase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyn1 PE=3 SV=1 167 318 2.0E-34
sp|D1ZHN6|CYNS_SORMK Cyanate hydratase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=CYN1 PE=1 SV=2 167 318 3.0E-34
sp|A5W5F5|CYNS_PSEP1 Cyanate hydratase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cynS PE=3 SV=1 179 318 2.0E-33
sp|Q7V2U0|CYNS_PROMP Cyanate hydratase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=cynS PE=3 SV=1 189 318 3.0E-33
sp|Q47G40|CYNS_DECAR Cyanate hydratase OS=Dechloromonas aromatica (strain RCB) GN=cynS PE=3 SV=1 175 318 5.0E-33
sp|C9S8A7|CYNS_VERA1 Cyanate hydratase OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=CYN1 PE=3 SV=1 171 318 8.0E-33
sp|Q3SHJ2|CYNS_THIDA Cyanate hydratase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=cynS PE=3 SV=1 175 315 8.0E-33
sp|Q4IN52|SDHF3_GIBZE Succinate dehydrogenase assembly factor 3, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_01356 PE=3 SV=1 1 117 4.0E-32
sp|C5FMD4|CYNS_ARTOC Cyanate hydratase OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CYN1 PE=3 SV=1 170 318 9.0E-32
sp|Q0UBT2|CYNS_PHANO Cyanate hydratase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CYN1 PE=3 SV=3 161 318 1.0E-31
sp|B2B4S6|CYNS_PODAN Cyanate hydratase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CYN1 PE=3 SV=1 167 318 1.0E-31
sp|B2UK94|CYNS_RALPJ Cyanate hydratase OS=Ralstonia pickettii (strain 12J) GN=cynS PE=3 SV=1 183 318 2.0E-31
sp|C0S4M2|CYNS_PARBP Cyanate hydratase OS=Paracoccidioides brasiliensis (strain Pb03) GN=CYN1 PE=3 SV=1 165 318 2.0E-31
sp|C8VCM2|CYNS_EMENI Cyanate hydratase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyn1 PE=3 SV=2 171 318 4.0E-31
sp|A1DIL2|CYNS_NEOFI Cyanate hydratase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cyn1 PE=3 SV=1 171 318 4.0E-31
sp|A4R2S1|CYNS_MAGO7 Cyanate hydratase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CYN1 PE=3 SV=2 167 318 5.0E-31
sp|B8MQZ4|CYNS_TALSN Cyanate hydratase OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=cyn1 PE=3 SV=1 172 318 6.0E-31
sp|C1H765|CYNS_PARBA Cyanate hydratase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=CYN1 PE=3 SV=1 165 318 7.0E-31
sp|C1FZ35|CYNS_PARBD Cyanate hydratase OS=Paracoccidioides brasiliensis (strain Pb18) GN=CYN1 PE=3 SV=1 165 318 9.0E-31
sp|C0NWE3|CYNS_AJECG Cyanate hydratase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CYN1 PE=3 SV=1 165 318 1.0E-30
sp|Q1GZA1|CYNS_METFK Cyanate hydratase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=cynS PE=3 SV=1 175 318 1.0E-30
sp|B8NQ08|CYNS_ASPFN Cyanate hydratase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cyn1 PE=3 SV=1 171 318 1.0E-30
sp|Q2UAX9|CYNS_ASPOR Cyanate hydratase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyn1 PE=3 SV=1 171 318 2.0E-30
sp|B6Q2W9|CYNS_TALMQ Cyanate hydratase OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=cyn1 PE=3 SV=1 172 318 4.0E-30
sp|Q12GT8|CYNS_POLSJ Cyanate hydratase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=cynS PE=3 SV=1 175 318 6.0E-30
sp|A6R853|CYNS_AJECN Cyanate hydratase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=CYN1 PE=3 SV=1 165 318 6.0E-30
sp|A4SXJ6|CYNS_POLSQ Cyanate hydratase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=cynS PE=3 SV=1 175 315 7.0E-30
sp|C6HBW5|CYNS_AJECH Cyanate hydratase OS=Ajellomyces capsulatus (strain H143) GN=CYN1 PE=3 SV=1 165 318 8.0E-30
sp|Q0K572|CYNS_CUPNH Cyanate hydratase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cynS PE=3 SV=1 175 315 1.0E-29
sp|A6W1Q1|CYNS_MARMS Cyanate hydratase OS=Marinomonas sp. (strain MWYL1) GN=cynS PE=3 SV=1 175 318 1.0E-29
sp|A2R692|CYNS_ASPNC Cyanate hydratase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cyn1 PE=3 SV=1 172 318 2.0E-29
sp|C4JUN6|CYNS_UNCRE Cyanate hydratase OS=Uncinocarpus reesii (strain UAMH 1704) GN=CYN1 PE=3 SV=1 172 311 3.0E-29
sp|C5PDS9|CYNS_COCP7 Cyanate hydratase OS=Coccidioides posadasii (strain C735) GN=CYN1 PE=3 SV=1 172 311 3.0E-29
sp|Q4JJB1|CYNS_CHAGS Cyanate hydratase OS=Chaetomium globosum GN=CYN1 PE=2 SV=1 167 318 4.0E-29
sp|A1C7Y5|CYNS_ASPCL Cyanate hydratase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cyn1 PE=3 SV=1 171 311 5.0E-29
sp|C7YTF5|CYNS_NECH7 Cyanate hydratase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=CYN1 PE=3 SV=1 167 318 7.0E-29
sp|B6HIM5|CYNS_PENRW Cyanate hydratase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=cyn1 PE=3 SV=1 171 318 7.0E-29
sp|C5CRQ4|CYNS_VARPS Cyanate hydratase OS=Variovorax paradoxus (strain S110) GN=cynS PE=3 SV=1 175 315 1.0E-28
sp|Q0CVK8|CYNS_ASPTN Cyanate hydratase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cyn1 PE=3 SV=1 165 311 1.0E-28
sp|Q21S14|CYNS_RHOFT Cyanate hydratase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=cynS PE=3 SV=1 175 318 2.0E-28
sp|B0XV83|CYNS_ASPFC Cyanate hydratase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cyn1 PE=3 SV=1 171 311 2.0E-28
sp|P0CM00|SDHF3_CRYNJ Succinate dehydrogenase assembly factor 3, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB04080 PE=3 SV=1 1 117 3.0E-28
sp|P0CM01|SDHF3_CRYNB Succinate dehydrogenase assembly factor 3, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBB1660 PE=3 SV=1 1 117 3.0E-28
sp|Q4WZL3|CYNS_ASPFU Cyanate hydratase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyn1 PE=3 SV=1 171 311 3.0E-28
sp|B7N8P7|CYNS_ECOLU Cyanate hydratase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cynS PE=3 SV=1 175 314 4.0E-28
sp|B5Z2P3|CYNS_ECO5E Cyanate hydratase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cynS PE=3 SV=1 175 314 4.0E-28
sp|P58704|CYNS_ECO57 Cyanate hydratase OS=Escherichia coli O157:H7 GN=cynS PE=3 SV=1 175 314 4.0E-28
sp|Q972W5|CYNS_SULTO Cyanate hydratase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cynS PE=3 SV=1 180 318 5.0E-28
sp|P00816|CYNS_ECOLI Cyanate hydratase OS=Escherichia coli (strain K12) GN=cynS PE=1 SV=2 175 314 1.0E-27
sp|B1XBI8|CYNS_ECODH Cyanate hydratase OS=Escherichia coli (strain K12 / DH10B) GN=cynS PE=3 SV=1 175 314 1.0E-27
sp|A2SLJ8|CYNS_METPP Cyanate hydratase OS=Methylibium petroleiphilum (strain PM1) GN=cynS PE=3 SV=1 175 318 1.0E-27
sp|B1LIM5|CYNS_ECOSM Cyanate hydratase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cynS PE=3 SV=1 175 314 1.0E-27
sp|B6HZW6|CYNS_ECOSE Cyanate hydratase OS=Escherichia coli (strain SE11) GN=cynS PE=3 SV=1 175 314 1.0E-27
sp|B7M2Y9|CYNS_ECO8A Cyanate hydratase OS=Escherichia coli O8 (strain IAI1) GN=cynS PE=3 SV=1 175 314 1.0E-27
sp|B7NK15|CYNS_ECO7I Cyanate hydratase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cynS PE=3 SV=1 175 314 1.0E-27
sp|B7L4Z6|CYNS_ECO55 Cyanate hydratase OS=Escherichia coli (strain 55989 / EAEC) GN=cynS PE=3 SV=1 175 314 1.0E-27
sp|A7ZI88|CYNS_ECO24 Cyanate hydratase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cynS PE=3 SV=1 175 314 1.0E-27
sp|Q6BIY6|SDHF3_DEBHA Succinate dehydrogenase assembly factor 3, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G06622g PE=3 SV=1 1 117 1.0E-27
sp|C5BUK2|CYNS_TERTT Cyanate hydratase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cynS PE=3 SV=1 175 318 2.0E-27
sp|A1T8R2|CYNS_MYCVP Cyanate hydratase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cynS PE=3 SV=1 176 316 2.0E-27
sp|A3NDL7|CYNS_BURP6 Cyanate hydratase OS=Burkholderia pseudomallei (strain 668) GN=cynS PE=3 SV=1 175 314 2.0E-27
sp|A1V0I2|CYNS_BURMS Cyanate hydratase OS=Burkholderia mallei (strain SAVP1) GN=cynS PE=3 SV=1 175 314 2.0E-27
sp|Q62H08|CYNS_BURMA Cyanate hydratase OS=Burkholderia mallei (strain ATCC 23344) GN=cynS PE=3 SV=1 175 314 2.0E-27
sp|A2S5L0|CYNS_BURM9 Cyanate hydratase OS=Burkholderia mallei (strain NCTC 10229) GN=cynS PE=3 SV=1 175 314 2.0E-27
sp|A3MRF1|CYNS_BURM7 Cyanate hydratase OS=Burkholderia mallei (strain NCTC 10247) GN=cynS PE=3 SV=1 175 314 2.0E-27
sp|Q63QS4|CYNS_BURPS Cyanate hydratase OS=Burkholderia pseudomallei (strain K96243) GN=cynS PE=3 SV=1 175 314 3.0E-27
sp|A3NZD0|CYNS_BURP0 Cyanate hydratase OS=Burkholderia pseudomallei (strain 1106a) GN=cynS PE=3 SV=1 175 314 3.0E-27
sp|C5JJW0|CYNS_AJEDS Cyanate hydratase OS=Ajellomyces dermatitidis (strain SLH14081) GN=CYN1 PE=3 SV=1 165 311 3.0E-27
sp|C5G6H8|CYNS_AJEDR Cyanate hydratase OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=CYN1 PE=3 SV=1 165 311 3.0E-27
sp|A7ZWY8|CYNS_ECOHS Cyanate hydratase OS=Escherichia coli O9:H4 (strain HS) GN=cynS PE=3 SV=1 175 314 8.0E-27
sp|Q7SF55|SDHF3_NEUCR Succinate dehydrogenase assembly factor 3, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-17 PE=3 SV=1 1 117 9.0E-27
sp|Q6CUY0|SDHF3_KLULA Succinate dehydrogenase assembly factor 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0C01430g PE=3 SV=1 5 117 1.0E-26
sp|A0AXK2|CYNS_BURCH Cyanate hydratase OS=Burkholderia cenocepacia (strain HI2424) GN=cynS PE=3 SV=1 175 314 1.0E-26
sp|B1K759|CYNS_BURCC Cyanate hydratase OS=Burkholderia cenocepacia (strain MC0-3) GN=cynS PE=3 SV=1 175 314 1.0E-26
sp|Q1BL48|CYNS_BURCA Cyanate hydratase OS=Burkholderia cenocepacia (strain AU 1054) GN=cynS PE=3 SV=1 175 314 1.0E-26
sp|Q1I7P9|CYNS_PSEE4 Cyanate hydratase OS=Pseudomonas entomophila (strain L48) GN=cynS PE=3 SV=1 162 314 3.0E-26
sp|Q7NA33|CYNS_PHOLL Cyanate hydratase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cynS PE=3 SV=1 175 314 3.0E-26
sp|Q391E0|CYNS_BURL3 Cyanate hydratase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=cynS PE=3 SV=1 175 314 4.0E-26
sp|Q5BBH7|SDHF3_EMENI Succinate dehydrogenase assembly factor 3, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2103 PE=3 SV=1 3 117 4.0E-26
sp|B4EJC2|CYNS_BURCJ Cyanate hydratase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=cynS PE=3 SV=1 175 314 4.0E-26
sp|B1J0T9|CYNS_ECOLC Cyanate hydratase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cynS PE=3 SV=1 175 314 1.0E-25
sp|P61192|CYNS_MYCPA Cyanate hydratase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cynS PE=3 SV=1 175 315 2.0E-25
sp|A0QL81|CYNS_MYCA1 Cyanate hydratase OS=Mycobacterium avium (strain 104) GN=cynS PE=3 SV=1 175 315 2.0E-25
sp|Q59L89|SDHF3_CANAL Succinate dehydrogenase assembly factor 3, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SDH7 PE=3 SV=1 1 117 5.0E-25
sp|Q2SZA4|CYNS_BURTA Cyanate hydratase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=cynS PE=3 SV=1 175 314 1.0E-24
sp|Q6FMR7|SDHF3_CANGA Succinate dehydrogenase assembly factor 3, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0K05775g PE=3 SV=1 25 117 1.0E-24
sp|A4JRR6|CYNS_BURVG Cyanate hydratase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=cynS PE=3 SV=1 164 314 3.0E-24
sp|A8GBZ7|CYNS_SERP5 Cyanate hydratase OS=Serratia proteamaculans (strain 568) GN=cynS PE=1 SV=1 175 314 7.0E-24
sp|B1JA05|CYNS_PSEPW Cyanate hydratase OS=Pseudomonas putida (strain W619) GN=cynS PE=3 SV=1 179 314 9.0E-24
sp|A9TND9|CYNS_PHYPA Cyanate hydratase OS=Physcomitrella patens subsp. patens GN=CYN PE=3 SV=1 166 315 1.0E-23
sp|Q0B2Y2|CYNS_BURCM Cyanate hydratase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=cynS PE=3 SV=1 164 314 2.0E-23
sp|B1Z5U9|CYNS_BURA4 Cyanate hydratase OS=Burkholderia ambifaria (strain MC40-6) GN=cynS PE=3 SV=1 164 314 2.0E-23
sp|Q48GB5|CYNS_PSE14 Cyanate hydratase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=cynS PE=3 SV=1 175 315 3.0E-23
sp|Q4ZQQ7|CYNS_PSEU2 Cyanate hydratase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=cynS PE=3 SV=1 175 315 4.0E-23
sp|Q885A6|CYNS_PSESM Cyanate hydratase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cynS PE=3 SV=1 175 315 5.0E-23
sp|Q751X1|SDHF3_ASHGO Succinate dehydrogenase assembly factor 3, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AFR704W PE=3 SV=1 26 117 6.0E-23
sp|Q7NWU9|CYNS_CHRVO Cyanate hydratase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cynS PE=3 SV=1 175 314 8.0E-23
sp|Q4KGL6|CYNS_PSEF5 Cyanate hydratase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cynS PE=3 SV=1 167 314 2.0E-22
sp|B9T3R0|CYNS_RICCO Cyanate hydratase OS=Ricinus communis GN=CYN PE=3 SV=1 175 316 2.0E-22
sp|Q4WHK3|SDHF3_ASPFU Succinate dehydrogenase assembly factor 3, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G05090 PE=3 SV=1 33 117 4.0E-22
sp|P0C146|SDHF3_MAGO7 Succinate dehydrogenase assembly factor 3, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_17437 PE=3 SV=2 33 117 5.0E-22
sp|C5WYI7|CYNS_SORBI Cyanate hydratase OS=Sorghum bicolor GN=CYN PE=3 SV=1 175 315 5.0E-22
sp|O22683|CYNS_ARATH Cyanate hydratase OS=Arabidopsis thaliana GN=CYN PE=2 SV=1 170 317 6.0E-22
sp|A6V6B1|CYNS_PSEA7 Cyanate hydratase OS=Pseudomonas aeruginosa (strain PA7) GN=cynS PE=3 SV=1 164 314 8.0E-22
sp|A5BJL8|CYNS_VITVI Cyanate hydratase OS=Vitis vinifera GN=CYN PE=3 SV=1 175 316 8.0E-22
sp|B6TTW1|CYNS_MAIZE Cyanate hydratase OS=Zea mays GN=CYN PE=2 SV=1 175 315 2.0E-21
sp|O66587|CYNS_AQUAE Cyanate hydratase OS=Aquifex aeolicus (strain VF5) GN=cynS PE=3 SV=1 179 318 3.0E-21
sp|Q9I263|CYNS_PSEAE Cyanate hydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cynS PE=3 SV=1 164 314 3.0E-21
sp|B7VA51|CYNS_PSEA8 Cyanate hydratase OS=Pseudomonas aeruginosa (strain LESB58) GN=cynS PE=3 SV=1 164 314 3.0E-21
sp|Q9P7Y2|SDHF3_SCHPO Succinate dehydrogenase assembly factor 3, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP23A10.03c PE=3 SV=1 26 117 3.0E-21
sp|Q02LK0|CYNS_PSEAB Cyanate hydratase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cynS PE=3 SV=1 164 314 4.0E-21
sp|Q04401|SDHF3_YEAST Succinate dehydrogenase assembly factor 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH7 PE=1 SV=1 23 117 4.0E-21
sp|B1ME90|CYNS_MYCA9 Cyanate hydratase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=cynS PE=3 SV=1 180 314 8.0E-21
sp|B7FKW7|CYNS_MEDTR Cyanate hydratase OS=Medicago truncatula GN=CYN PE=2 SV=1 176 318 1.0E-20
sp|B7FRE8|CYNS_PHATC Cyanate hydratase OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=CYN PE=3 SV=1 178 315 6.0E-20
sp|B9HSR7|CYNS_POPTR Cyanate hydratase OS=Populus trichocarpa GN=CYN PE=3 SV=1 175 316 7.0E-20
sp|C6SXE1|CYNS_SOYBN Cyanate hydratase OS=Glycine max GN=CYN PE=2 SV=1 175 318 9.0E-19
sp|Q9FWK4|CYNS_ORYSJ Cyanate hydratase OS=Oryza sativa subsp. japonica GN=CYN PE=2 SV=2 175 316 9.0E-19
sp|A2Z8F9|CYNS_ORYSI Cyanate hydratase OS=Oryza sativa subsp. indica GN=CYN PE=3 SV=1 175 316 9.0E-19
sp|B5YM03|CYNS_THAPS Cyanate hydratase OS=Thalassiosira pseudonana GN=CYN PE=3 SV=1 178 315 1.0E-18
sp|Q8SZ16|SDHF3_DROME Succinate dehydrogenase assembly factor 3, mitochondrial OS=Drosophila melanogaster GN=Sdhaf3 PE=2 SV=1 32 117 5.0E-11
sp|A7S1H9|SDHF3_NEMVE Succinate dehydrogenase assembly factor 3, mitochondrial OS=Nematostella vectensis GN=acn9 PE=3 SV=1 32 116 1.0E-10
sp|Q6TUF2|SDHF3_RAT Succinate dehydrogenase assembly factor 3, mitochondrial OS=Rattus norvegicus GN=Sdhaf3 PE=2 SV=2 32 117 4.0E-09
sp|Q86H49|SDHF3_DICDI Succinate dehydrogenase assembly factor 3, mitochondrial OS=Dictyostelium discoideum GN=acn9 PE=3 SV=1 30 83 9.0E-09
sp|Q8BQU3|SDHF3_MOUSE Succinate dehydrogenase assembly factor 3, mitochondrial OS=Mus musculus GN=Sdhaf3 PE=2 SV=1 32 117 2.0E-08
sp|Q9NRP4|SDHF3_HUMAN Succinate dehydrogenase assembly factor 3, mitochondrial OS=Homo sapiens GN=SDHAF3 PE=1 SV=1 32 117 7.0E-08
sp|Q5XIY4|SDHF3_DANRE Succinate dehydrogenase assembly factor 3, mitochondrial OS=Danio rerio GN=sdhaf3 PE=2 SV=1 32 117 1.0E-06
sp|Q0P574|SDHF3_BOVIN Succinate dehydrogenase assembly factor 3, mitochondrial OS=Bos taurus GN=SDHAF3 PE=2 SV=1 32 81 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009439 cyanate metabolic process Yes
GO:0006807 nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|082870
MRTTLLRLAESATTRPLSPREAAATLLPPIPLYRQLLRSHRNLPPEMRSLGDVYVKSEFRLHKDVTNPAHLIGFL
SQWKMYLDHMPNREGGDFYRGKKLDPTIFEKMSPEQITQLHERIVLYPYPAPLPHMLSIMTMGWGRIHSHQYLLI
CRYPTKWGKKSVPSEISPLAQLPPICSKLLEAKARKGWTFDQVAKVIGKDEVWVAAAFYAQAKFTADELRKVSEA
LDLPSAQALSEIGDHWWPNRGIGPTPPTDPVLYRLYEAVLVYGTPIKAVIHEKFGDGIMSMIDCKINVDRKADPK
GDRVVLTIDGKFLPYARW*
Coding >Agabi119p4|082870
ATGCGGACAACACTTCTCAGGCTAGCAGAAAGCGCGACGACGCGGCCCTTGTCACCGCGGGAGGCGGCTGCAACC
CTCTTGCCCCCAATACCGCTCTACCGTCAGCTACTGCGTTCGCACAGAAATTTGCCGCCGGAAATGCGATCCCTA
GGGGATGTTTATGTCAAGTCTGAATTCCGTCTTCATAAGGACGTTACGAATCCCGCGCATTTAATTGGCTTTTTA
TCCCAATGGAAGATGTATCTAGATCACATGCCTAACCGCGAGGGTGGGGATTTCTACCGAGGAAAGAAATTAGAT
CCCACCATTTTCGAAAAAATGTCACCAGAACAAATCACGCAGCTTCATGAACGGATTGTATTATATCCGTACCCC
GCACCTTTGCCGCATATGCTATCGATCATGACCATGGGATGGGGTCGGATTCACTCCCACCAGTACCTCCTGATA
TGTAGATATCCCACGAAATGGGGCAAGAAGTCCGTTCCATCTGAAATTTCGCCCTTGGCTCAACTCCCTCCAATT
TGTTCAAAGTTGTTGGAGGCAAAGGCTCGCAAGGGTTGGACCTTTGACCAAGTTGCTAAAGTCATTGGGAAAGAC
GAGGTTTGGGTGGCAGCCGCATTCTATGCCCAAGCCAAGTTCACGGCTGATGAGCTCAGGAAAGTTTCGGAAGCC
TTGGACCTTCCCTCTGCTCAGGCGCTTAGCGAAATCGGCGACCACTGGTGGCCAAACCGCGGAATTGGTCCAACG
CCTCCAACCGACCCAGTTCTCTATCGGCTTTACGAAGCTGTACTCGTGTACGGAACTCCCATCAAAGCTGTCATA
CATGAGAAGTTTGGTGATGGCATTATGTCTATGATCGATTGCAAGATCAACGTGGACCGGAAAGCCGATCCCAAA
GGAGACCGTGTGGTGCTGACTATTGATGGTAAATTCTTACCTTATGCTCGTTGGTAG
Transcript >Agabi119p4|082870
ATGCGGACAACACTTCTCAGGCTAGCAGAAAGCGCGACGACGCGGCCCTTGTCACCGCGGGAGGCGGCTGCAACC
CTCTTGCCCCCAATACCGCTCTACCGTCAGCTACTGCGTTCGCACAGAAATTTGCCGCCGGAAATGCGATCCCTA
GGGGATGTTTATGTCAAGTCTGAATTCCGTCTTCATAAGGACGTTACGAATCCCGCGCATTTAATTGGCTTTTTA
TCCCAATGGAAGATGTATCTAGATCACATGCCTAACCGCGAGGGTGGGGATTTCTACCGAGGAAAGAAATTAGAT
CCCACCATTTTCGAAAAAATGTCACCAGAACAAATCACGCAGCTTCATGAACGGATTGTATTATATCCGTACCCC
GCACCTTTGCCGCATATGCTATCGATCATGACCATGGGATGGGGTCGGATTCACTCCCACCAGTACCTCCTGATA
TGTAGATATCCCACGAAATGGGGCAAGAAGTCCGTTCCATCTGAAATTTCGCCCTTGGCTCAACTCCCTCCAATT
TGTTCAAAGTTGTTGGAGGCAAAGGCTCGCAAGGGTTGGACCTTTGACCAAGTTGCTAAAGTCATTGGGAAAGAC
GAGGTTTGGGTGGCAGCCGCATTCTATGCCCAAGCCAAGTTCACGGCTGATGAGCTCAGGAAAGTTTCGGAAGCC
TTGGACCTTCCCTCTGCTCAGGCGCTTAGCGAAATCGGCGACCACTGGTGGCCAAACCGCGGAATTGGTCCAACG
CCTCCAACCGACCCAGTTCTCTATCGGCTTTACGAAGCTGTACTCGTGTACGGAACTCCCATCAAAGCTGTCATA
CATGAGAAGTTTGGTGATGGCATTATGTCTATGATCGATTGCAAGATCAACGTGGACCGGAAAGCCGATCCCAAA
GGAGACCGTGTGGTGCTGACTATTGATGGTAAATTCTTACCTTATGCTCGTTGGTAG
Gene >Agabi119p4|082870
ATGCGGACAACACTTCTCAGGCTAGCAGAAAGCGCGACGACGCGGCCCTTGTCACCGCGGGAGGCGGCTGCAACC
CTCTTGCCCCCAATACCGTGCGTAGCCTTAGAACCATAAAACCTACTTGCTTTCAACTTCCACCTATCAGGCTCT
ACCGTCAGCTACTGCGTTCGCACAGAAATTTGCCGCCGGAAATGCGATCCCTAGGGGATGTTTATGTCAAGTCTG
GTGAGTTCTTCACAATACTTGCATCAAACTCTATGTCGACGACGGTTATTCAGAATTCCGTCTTCATAAGGACGT
TACGAATCCCGCGCATTTAATTGGCTTTTTATCCCAATGGAAGATGTATCTAGATCACATGCCTAACCGCGAGGG
TGGGGATTTCTACCGAGGAAAGAAATTAGATCCCACCATTTTCGAAAAAGTGAGTAGTTTCAGGCCTCGCGCCAA
GCGATTGCTAATGAAGTGATTGATGACCGCCGACAAGATGTCACCAGAACAAATCACGCAGCTTCATGAGTTTTT
GCAAAACACGAAGCAAGTTTGGAAGGGGCAATCATGAATATCTAAAGACGGATTGTGTGAGCCTCTCGCTGGAGT
CTGACGATAGAAAGCTCACGATTGACACCATGTATACCTTGGTCTCTGGAATAGATTATATCCGTACCCCGCACC
TTTGCCGCATATGCTATCGATCATGACCATGGGATGGGGTCGGATTCACTCCCACCAGTACCTCCTGATATGTAG
ATATCCCACGAAATGGGGCAAGAAGTCCGGTATAAAAGGCTCAGTCCACTCACTGTTCACACAGCTCGTTTCTAC
ACCCCGATTATAATGTCTCAAGCAGTTCCATCTGAAATTTCGCCCTTGGCTCAACTCCCTCCAATTTGTTCAAAG
TTGTTGGAGGCAAAGGCTCGCAAGGGTAAGCCAATAGAAGCAGTGACCCAAGTTAATTATGGGAAACCAATACTC
TTTCTTAGGTTGGACCTTTGACCAAGTTGCTAAAGTCATTGGGAAAGACGAGGTTTGGGTGGCAGCCGCATTCTA
TGCCCAAGTATGTCCTGCTCGTCATTTACAAACATTCTCTAACTCTGCACAGGCCAAGTTCACGGCTGATGAGCT
CAGGAAAGTTTCGGAAGCCTTGGACCTTCCCTCTGCTCAGGCGCTTAGCGAAATCGGCGACCACTGGTGGCCAAA
CCGCGGAATTGGTCCAACGCCTCCAACCGACCCAGTTCTCTATCGGCTTTACGAAGTATGCTCCCTCCCTTGCCA
GTCTTTTCATCTTTCTGATTAATCCAGGCTGTACTCGTGTACGGAACTCCCATCAAAGCTGTCATACATGAGAAG
GTGATTGTGCTTTCACATTCTATCATCAAGCTTCCCTAATACCAGGGTTTACCAGTTTGGTGATGGCATTATGTC
TATGATCGATTGCAAGATCAACGTGGACCGGAAAGCCGATCCCAAAGGAGACCGTGTGGTGCTGACTATTGAGTA
TGTGGTCGTAATTTTTGGAAGTATACCTAACTAATCCATCTCACCAAGTGGTAAATTCTTACCTTATGCTCGTTG
GTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail