Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|082770
Gene name
Locationscaffold_05a:1222271..1224779
Strand-
Gene length (bp)2508
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01591 6PF2K 6-phosphofructo-2-kinase 6.3E-70 88 311
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 7.4E-33 314 496

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 91 511 1.0E-143
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 88 524 7.0E-141
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 88 512 3.0E-140
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 88 524 4.0E-140
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 88 520 1.0E-139
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 91 511 1.0E-143
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 88 524 7.0E-141
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 88 512 3.0E-140
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 88 524 4.0E-140
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 88 520 1.0E-139
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 88 524 1.0E-139
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 96 524 2.0E-137
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 96 524 3.0E-137
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 91 512 4.0E-137
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 88 532 4.0E-137
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 96 512 7.0E-137
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 96 512 1.0E-136
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 88 524 1.0E-136
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 91 512 6.0E-136
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 82 512 1.0E-135
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 91 512 1.0E-135
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 59 512 2.0E-135
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 88 529 4.0E-134
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 88 509 4.0E-134
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 84 511 2.0E-130
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 96 504 9.0E-126
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 92 500 2.0E-112
sp|Q9URZ7|YK72_SCHPO Probable fructose-2,6-bisphosphatase C732.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC732.02c PE=3 SV=1 95 511 4.0E-112
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 51 498 2.0E-100
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 83 493 7.0E-96
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 94 498 4.0E-75
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 63 504 1.0E-43
sp|Q9UTK9|YIVH_SCHPO Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase C144.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.17c PE=1 SV=2 94 500 9.0E-41
sp|Q12471|6P22_YEAST 6-phosphofructo-2-kinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK27 PE=1 SV=1 86 276 2.0E-11
sp|D3DFG8|PSPA_HYDTT Phosphoserine phosphatase 1 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspA PE=1 SV=1 314 500 3.0E-09
sp|C0Q8F5|GPMB_SALPC Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi C (strain RKS4594) GN=gpmB PE=3 SV=1 314 469 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003873 6-phosphofructo-2-kinase activity Yes
GO:0006000 fructose metabolic process Yes
GO:0019318 hexose metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044238 primary metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0016301 kinase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0008443 phosphofructokinase activity No
GO:0043168 anion binding No
GO:0071704 organic substance metabolic process No
GO:0019200 carbohydrate kinase activity No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No
GO:0044281 small molecule metabolic process No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0005996 monosaccharide metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|082770
MADPNASPTVPTLRITESLTRVAGVLQDMQNRRGELQAMSPGLPPAAFGAGSPMLKQFDESTVTSRKGSQAATPP
VAVKGIGGKVAKPDYSDNKIVLAMVGLPARGKSYLSNKLQIYLKWLEYDVEVFNVGQLRRTRARQMAQQSGVKEE
HTASWFSHDNQSANESREKLAQDSLEMLIAWLKLGGNVGIHDATNSTRERRAWIEQRVKQEKGLDLIFLESVCDD
PAIIASNVALKVTSGDPDYKDTSPEEAKRDFLRRIEAYQKVYETITEDHLSYLRIVNVGNNVTVSNIHGYLASRI
AFYLMNLHLKPRSIYLSRHGESQFNVEGKIGGDSLLSPRGMQYADALPELITDNIGNAPLTVWTSTLRRTIQTGS
KLPYPKLTWKSLDELDAGVCDAMTYEEIERAYPDDFANRDEDKFNYRYRGGESYRDVVVRLEPVIMELERQENVL
VIGHQAILRCLYAYFHNLPQADLPYIKIPLHTVIKLTPKAYGCDEERYALPIQAVDTHRPKPGTPSLNVQPTVAR
KYFTEVDATKGGKV*
Coding >Agabi119p4|082770
ATGGCTGATCCTAACGCAAGCCCCACGGTCCCCACTCTTAGGATCACTGAAAGTTTGACCCGCGTTGCTGGTGTA
CTGCAAGACATGCAGAATCGTAGAGGGGAATTGCAAGCCATGTCTCCGGGGCTTCCACCCGCTGCTTTTGGTGCT
GGAAGTCCTATGCTGAAGCAATTCGATGAATCGACTGTTACGAGTCGGAAAGGATCTCAGGCTGCTACACCACCA
GTGGCGGTTAAGGGTATTGGAGGGAAAGTTGCTAAGCCTGATTACTCGGATAACAAGATCGTGTTAGCAATGGTT
GGATTACCTGCTAGAGGTAAATCTTACCTCAGTAATAAATTACAGATATACCTCAAGTGGCTCGAATATGATGTC
GAGGTTTTTAATGTAGGCCAATTGCGACGGACAAGGGCTCGGCAAATGGCACAGCAATCGGGTGTCAAGGAGGAA
CACACAGCATCTTGGTTTAGTCACGATAATCAAAGTGCCAATGAGTCCCGAGAAAAATTGGCGCAAGATAGCTTG
GAGATGCTAATTGCCTGGCTGAAGTTGGGTGGAAACGTCGGCATTCATGATGCTACGAATAGTACTCGTGAACGC
AGGGCATGGATCGAGCAAAGAGTGAAACAAGAAAAAGGTCTTGATCTCATATTCCTTGAATCGGTTTGTGATGAT
CCCGCGATTATTGCATCCAATGTCGCTCTCAAGGTGACATCGGGTGATCCCGACTATAAGGATACTTCACCCGAG
GAGGCGAAACGAGATTTCTTACGGCGAATCGAAGCATATCAGAAAGTCTATGAAACCATCACGGAAGATCATTTG
TCTTATTTGCGAATTGTCAATGTTGGAAACAACGTTACAGTCTCGAATATCCACGGATACCTAGCCAGTCGGATT
GCGTTCTATCTTATGAATTTACACCTGAAGCCTCGGAGTATTTATCTTTCGAGACATGGAGAAAGCCAGTTTAAT
GTAGAGGGTAAAATTGGAGGTGATTCCTTGCTTTCACCGCGAGGCATGCAATATGCAGATGCGTTGCCTGAGTTG
ATCACGGATAATATTGGTAATGCCCCGTTGACGGTATGGACGTCGACATTACGACGCACTATTCAGACGGGATCA
AAGTTACCCTATCCGAAATTAACATGGAAATCTTTGGATGAGTTAGACGCAGGTGTTTGCGATGCTATGACTTAC
GAGGAAATTGAGCGAGCTTATCCAGACGATTTTGCAAATCGGGATGAAGACAAATTCAACTACCGGTATCGAGGA
GGAGAGTCTTATCGGGATGTCGTTGTGCGGTTGGAGCCAGTTATCATGGAATTGGAACGTCAGGAGAATGTTCTG
GTCATAGGTCATCAAGCGATTTTGCGTTGTCTCTACGCCTATTTCCACAACTTGCCTCAAGCGGATCTACCTTAT
ATCAAGATACCATTGCACACTGTCATCAAATTGACTCCCAAGGCGTATGGTTGTGACGAAGAGCGATATGCGCTG
CCGATTCAGGCTGTAGACACTCATCGACCAAAACCGGGGACGCCATCTCTGAATGTGCAGCCTACAGTGGCTCGA
AAATATTTTACTGAGGTTGACGCGACCAAAGGTGGCAAAGTGTAG
Transcript >Agabi119p4|082770
ATGGCTGATCCTAACGCAAGCCCCACGGTCCCCACTCTTAGGATCACTGAAAGTTTGACCCGCGTTGCTGGTGTA
CTGCAAGACATGCAGAATCGTAGAGGGGAATTGCAAGCCATGTCTCCGGGGCTTCCACCCGCTGCTTTTGGTGCT
GGAAGTCCTATGCTGAAGCAATTCGATGAATCGACTGTTACGAGTCGGAAAGGATCTCAGGCTGCTACACCACCA
GTGGCGGTTAAGGGTATTGGAGGGAAAGTTGCTAAGCCTGATTACTCGGATAACAAGATCGTGTTAGCAATGGTT
GGATTACCTGCTAGAGGTAAATCTTACCTCAGTAATAAATTACAGATATACCTCAAGTGGCTCGAATATGATGTC
GAGGTTTTTAATGTAGGCCAATTGCGACGGACAAGGGCTCGGCAAATGGCACAGCAATCGGGTGTCAAGGAGGAA
CACACAGCATCTTGGTTTAGTCACGATAATCAAAGTGCCAATGAGTCCCGAGAAAAATTGGCGCAAGATAGCTTG
GAGATGCTAATTGCCTGGCTGAAGTTGGGTGGAAACGTCGGCATTCATGATGCTACGAATAGTACTCGTGAACGC
AGGGCATGGATCGAGCAAAGAGTGAAACAAGAAAAAGGTCTTGATCTCATATTCCTTGAATCGGTTTGTGATGAT
CCCGCGATTATTGCATCCAATGTCGCTCTCAAGGTGACATCGGGTGATCCCGACTATAAGGATACTTCACCCGAG
GAGGCGAAACGAGATTTCTTACGGCGAATCGAAGCATATCAGAAAGTCTATGAAACCATCACGGAAGATCATTTG
TCTTATTTGCGAATTGTCAATGTTGGAAACAACGTTACAGTCTCGAATATCCACGGATACCTAGCCAGTCGGATT
GCGTTCTATCTTATGAATTTACACCTGAAGCCTCGGAGTATTTATCTTTCGAGACATGGAGAAAGCCAGTTTAAT
GTAGAGGGTAAAATTGGAGGTGATTCCTTGCTTTCACCGCGAGGCATGCAATATGCAGATGCGTTGCCTGAGTTG
ATCACGGATAATATTGGTAATGCCCCGTTGACGGTATGGACGTCGACATTACGACGCACTATTCAGACGGGATCA
AAGTTACCCTATCCGAAATTAACATGGAAATCTTTGGATGAGTTAGACGCAGGTGTTTGCGATGCTATGACTTAC
GAGGAAATTGAGCGAGCTTATCCAGACGATTTTGCAAATCGGGATGAAGACAAATTCAACTACCGGTATCGAGGA
GGAGAGTCTTATCGGGATGTCGTTGTGCGGTTGGAGCCAGTTATCATGGAATTGGAACGTCAGGAGAATGTTCTG
GTCATAGGTCATCAAGCGATTTTGCGTTGTCTCTACGCCTATTTCCACAACTTGCCTCAAGCGGATCTACCTTAT
ATCAAGATACCATTGCACACTGTCATCAAATTGACTCCCAAGGCGTATGGTTGTGACGAAGAGCGATATGCGCTG
CCGATTCAGGCTGTAGACACTCATCGACCAAAACCGGGGACGCCATCTCTGAATGTGCAGCCTACAGTGGCTCGA
AAATATTTTACTGAGGTTGACGCGACCAAAGGTGGCAAAGTGTAG
Gene >Agabi119p4|082770
ATGGCTGATCCTAACGCAAGCCCCACGGTCCCCACTCTTAGGATCACTGAAAGTTTGACCCGCGTTGCTGGTGTA
CTGCAAGACATGCAGAATCGTAGAGGGGAATTGCAAGCCATGTCTCCGGGGCTTCCACCCGCTGCTTTTGGTGCT
GGAAGTCCTATGTGAGTTTCGACACTTTTTGCTTTTTTGCTTGCTGACTATCTGTATGCTTTAGGCTGAAGCAAT
TCGATGAATCGACTGTTACGAGTCGGAAAGGATCTCAGGCTGCTACACCACCAGTGGCGGTTAAGGGTATTGGAG
GGAAAGGTGGGGAGGCTTTCTCCTTCTCTGCAGGGTGATCAAGGTTCTAATGCTTCAGATTTGTGTTATCGACAG
TTGCTAAGCCTGATTACTCGGATAACAAGATCGTGTTAGCAATGGTATGTCGAGTGTACTAGGCGATCTTCGAAT
CTGGAGCAAGACGTGTGTATAATGCGATTTTTTATAGGTTGGATTACCTGCTAGAGGTAAATCTTACCTCAGTAA
TAAATTACAGATATACCTCAAGGTGATTGGACGCCTTCATCATGTCTGATAAGTGTCGAGGGCTGATTCTTGATA
TCAGTGGCTCGAATATGATGTCGAGGTATGTGTTGATCCTTCGCGTTTTCAAAAACTTGGGTCGTTATACCTCGA
AAGGTTTTTAATGTAGGCCAATTGCGACGGACAAGGGCTCGGCAAATGGCACAGCAGTACGTAGTCTTTGTTGGT
TTTATAGAATTGTACTAATTCTGTTGGGCTCGTTTAGATCGGGTGTCAAGGAGGAACACACAGCATCTTGGTTTA
GTCACGATAATCAAAGTGCCAATGAGTCCCGAGAAAAATTGGCGCAAGATAGCTTGGAGATGCTAATTGCCTGGC
TGAAGTTGGGTGGAAACGTCGGCATTCATGGTGCGTCTCGTTAGACGGCCGATGTCGCTATGGCTGATATCATAG
CTTACAGATGCTACGAATAGTACTCGTGAACGCAGGTGTGTCATTCACCTTTCCCTGTCTAACACTCAAAATTCA
TTGTCATGCAGGGCATGGATCGAGCAAAGAGTGAAACAAGAAAAAGGTCTTGATCTCATATTCCTTGAATCGGTT
TGTGATGATCCCGCGATTATTGCATCCAATGTCGCTCTCAAGGTGACATCGGGTGATCCCGACTATAAGGATACT
TCACCCGAGGAGGCGAAACGAGATTTCTTACGGCGAATCGAAGCATATCAGAAAGTCTATGAAACCATCACGGAA
GATCATTTGTCTTATTTGCGAATTGTCAATGTTGGAAACAACGTTACAGTCTCGAATATCCACGGATACCTAGCC
AGTCGGATTGCGTTCTATCTTATGAATTTACACCTGAAGCCTCGGAGTATTTATCTTTCGAGAGTGAGTGGTTGT
TCATGAAATATAATCTCCTAACCGGGGGGTTTTTTTTTGTTCAGCATGGAGAAAGCCAGTTTAATGTAGAGGGTA
AAATTGGAGGTGATTCCTTGCTTTCACCGCGAGGCATGCAATATGCAGATGCGTTGCCTGAGTTGATCACGGATA
ATATTGGTAATGCCCCGTTGACGGTAAGCGGTGCTTATCTGCAATCGTAACTAGGGCCTGAAATATTTGTGCTGT
AGGTATGGACGTCGACATTACGACGCACTATTCAGACGGGATCAAAGTTACCCTATCCGAAATTAACATGGAAAT
CTTTGGATGAGTTAGACGCAGGTGCGTGTTGGGTCGCTTACTTGAATTAATTGTAATATTTTTAAACAGGTGTTT
GCGATGCTATGACTTACGAGGTGAGAAAGCTCACTTGTTTGAAGGAGTATATTAACAGAAACTTGCTGCGCAGGA
AATTGAGGTACAGAATACCAGTTTCATATATATGCTTACCACATGATGATGGACTTGTCAAGCGAGCTTATCCAG
ACGATTTTGCAAATCGGGATGAAGACAAATTCAACTACCGGTATCGAGGAGGAGAGTCTTATCGGGATGTCGTTG
TGCGGTTGGAGCCAGTTATCATGGAATTGGAACGTCAGGAGAATGTTCTGGTCATAGGTCATCAAGTGAGTTTTA
GAGTTTCAATGAACGTGTGTGGCTTAACTCATATTACATCAATTGAGGCGATTTTGCGTTGTCTGTGAGTCTGTT
AATGGATGTGCTGTTGGATTGATTATATACCACCGCTAGCTACGCCTATTTCCACAACTTGCCTCAAGCGGATCT
ACCTTATATCAAGATACCATTGCACACTGTCATCAAATTGACTCCCAAGGCGTATGGTTGTGACGAAGAGCGGTG
AGAGATTCCAATGCGATTTTGAGAATCGTTTTCTTACATGGAAAAACTTGCAGATATGCGCTGCCGATTCAGGCT
GTAGACACTCATCGACCAAAACCGGGGACGCCATCTCTGAATGTGCAGCCTACAGTGGCTCGAAAATATTTTACT
GAGGTTGACGCGACCAAAGGTGGCAAAGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail