Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|081570
Gene name
Locationscaffold_05a:922968..923491
Strand-
Gene length (bp)523
Transcript length (bp)261
Coding sequence length (bp)261
Protein length (aa) 87

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02297 COX6B Cytochrome oxidase c subunit VIb 2.6E-18 20 79

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94581|COX12_SCHPO Cytochrome c oxidase subunit 6B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox12 PE=3 SV=2 1 84 2.0E-36
sp|Q01519|COX12_YEAST Cytochrome c oxidase subunit 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX12 PE=1 SV=2 13 84 1.0E-30
sp|Q9S7L9|CX6B1_ARATH Cytochrome c oxidase subunit 6b-1 OS=Arabidopsis thaliana GN=COX6B-1 PE=1 SV=1 13 84 1.0E-24
sp|Q9SUD3|CX6B3_ARATH Cytochrome c oxidase subunit 6b-3 OS=Arabidopsis thaliana GN=COX6B-3 PE=2 SV=2 7 84 2.0E-22
sp|Q945L0|CX6B2_ARATH Cytochrome c oxidase subunit 6b-2 OS=Arabidopsis thaliana GN=COX6B-2 PE=2 SV=1 7 84 8.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94581|COX12_SCHPO Cytochrome c oxidase subunit 6B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox12 PE=3 SV=2 1 84 2.0E-36
sp|Q01519|COX12_YEAST Cytochrome c oxidase subunit 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX12 PE=1 SV=2 13 84 1.0E-30
sp|Q9S7L9|CX6B1_ARATH Cytochrome c oxidase subunit 6b-1 OS=Arabidopsis thaliana GN=COX6B-1 PE=1 SV=1 13 84 1.0E-24
sp|Q9SUD3|CX6B3_ARATH Cytochrome c oxidase subunit 6b-3 OS=Arabidopsis thaliana GN=COX6B-3 PE=2 SV=2 7 84 2.0E-22
sp|Q945L0|CX6B2_ARATH Cytochrome c oxidase subunit 6b-2 OS=Arabidopsis thaliana GN=COX6B-2 PE=2 SV=1 7 84 8.0E-22
sp|P00429|CX6B1_BOVIN Cytochrome c oxidase subunit 6B1 OS=Bos taurus GN=COX6B1 PE=1 SV=2 4 84 9.0E-22
sp|P14854|CX6B1_HUMAN Cytochrome c oxidase subunit 6B1 OS=Homo sapiens GN=COX6B1 PE=1 SV=2 4 84 9.0E-22
sp|Q5RCT0|CX6B1_PONAB Cytochrome c oxidase subunit 6B1 OS=Pongo abelii GN=COX6B1 PE=3 SV=3 4 84 1.0E-21
sp|Q7YRK6|CX6B1_TARSY Cytochrome c oxidase subunit 6B1 OS=Tarsius syrichta GN=COX6B1 PE=3 SV=3 4 84 3.0E-21
sp|Q53CG4|CX6B1_MACMU Cytochrome c oxidase subunit 6B1 OS=Macaca mulatta GN=COX6B1 PE=3 SV=3 6 84 4.0E-20
sp|Q4R374|CX6B1_MACFA Cytochrome c oxidase subunit 6B1 OS=Macaca fascicularis GN=COX6B1 PE=3 SV=3 6 84 4.0E-20
sp|P56391|CX6B1_MOUSE Cytochrome c oxidase subunit 6B1 OS=Mus musculus GN=Cox6b1 PE=1 SV=2 4 84 2.0E-19
sp|Q6YFP9|CX6B2_BOVIN Cytochrome c oxidase subunit 6B2 OS=Bos taurus GN=COX6B2 PE=2 SV=1 15 84 2.0E-18
sp|Q80ZN9|CX6B2_MOUSE Cytochrome c oxidase subunit 6B2 OS=Mus musculus GN=Cox6b2 PE=1 SV=1 15 84 2.0E-18
sp|Q6YFQ2|CX6B2_HUMAN Cytochrome c oxidase subunit 6B2 OS=Homo sapiens GN=COX6B2 PE=1 SV=1 15 84 7.0E-17
sp|Q6YFQ1|CX6B2_RAT Cytochrome c oxidase subunit 6B2 OS=Rattus norvegicus GN=Cox6b2 PE=2 SV=1 15 84 7.0E-17
sp|Q54P95|COX6B_DICDI Probable cytochrome c oxidase subunit 6B OS=Dictyostelium discoideum GN=DDB_G0284693 PE=3 SV=1 13 80 2.0E-15
sp|Q9LPJ2|CX6BL_ARATH Putative cytochrome c oxidase subunit 6b-like OS=Arabidopsis thaliana GN=At1g32710 PE=3 SV=2 16 70 1.0E-08
sp|Q5JTJ3|COA6_HUMAN Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens GN=COA6 PE=1 SV=1 7 85 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0045277 respiratory chain complex IV Yes
GO:0005739 mitochondrion Yes
GO:0098796 membrane protein complex No
GO:0043229 intracellular organelle No
GO:0043226 organelle No
GO:0032991 protein-containing complex No
GO:0098803 respiratory chain complex No
GO:0043227 membrane-bounded organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0070069 cytochrome complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|081570
MSDSSDLSSKYTLQTVGFDARFPNTNQTRNCFQNYTDYFKCVAAKGEDFAPCKQFKKAYNSLCPNDWISKWDEAR
ENGTFQASLEP*
Coding >Agabi119p4|081570
ATGTCGGACTCTTCTGATCTCTCAAGCAAATACACCCTGCAGACCGTGGGCTTTGACGCCCGCTTCCCCAACACC
AACCAGACCAGAAATTGCTTCCAGAACTACACGGACTATTTCAAATGTGTTGCTGCCAAGGGTGAAGACTTTGCT
CCTTGCAAACAGTTCAAGAAGGCATACAACTCGCTGTGCCCCAATGACTGGATCTCTAAGTGGGATGAAGCACGC
GAAAATGGCACATTCCAAGCATCTCTAGAACCATGA
Transcript >Agabi119p4|081570
ATGTCGGACTCTTCTGATCTCTCAAGCAAATACACCCTGCAGACCGTGGGCTTTGACGCCCGCTTCCCCAACACC
AACCAGACCAGAAATTGCTTCCAGAACTACACGGACTATTTCAAATGTGTTGCTGCCAAGGGTGAAGACTTTGCT
CCTTGCAAACAGTTCAAGAAGGCATACAACTCGCTGTGCCCCAATGACTGGATCTCTAAGTGGGATGAAGCACGC
GAAAATGGCACATTCCAAGCATCTCTAGAACCATGA
Gene >Agabi119p4|081570
ATGTCGGACTCTTCTGATCTCTCAAGGTTAGTGTTCTCTCCTGTGAGATCCAGTATTGTTCATGCATTTTTTCCC
TAGCAAATACACCCTGCAGACCGTGGGCTTTGACGGTACTTACTTTATCGGCTTGCTCAATTTGTACTCAGTCTG
AATGTCTCCTCAGCCCGCTTCCCCAACACCAACCAGACCAGAAATTGGTGCGCGAGATAGAAATTTGATTATTCT
CCTCCCCTCTTACATGTATCCCCCAGCTTCCAGAACTACACGGACTATTTCAAATGTGTTGCTGCCAAGGGTGAA
GACTTTGCTCCTTGCAAACAGTTCAAGAAGGCATACAACTCGCTGTGCCCCAGTATGTTCTACCTTTTTTGTCGG
TAATCTATATGACATACTGACTTTGTTGCAGATGACTGGGTATGAACAGGTTCTTCACCGTTTTGACTTGCGACT
GACAACTACTCAGATCTCTAAGTGGGATGAAGCACGCGAAAATGGCACATTCCAAGCATCTCTAGAACCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail