Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|081470
Gene name
Locationscaffold_05a:902960..907300
Strand+
Gene length (bp)4340
Transcript length (bp)3894
Coding sequence length (bp)3894
Protein length (aa) 1298

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01388 ARID ARID/BRIGHT DNA binding domain 2.8E-12 491 588

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
ARID/BRIGHT

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup5609
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|081470
Agaricus bisporus var bisporus H97 AgabiH97|081470
Agaricus bisporus var burnettii H119p4 Agabi119p4|081470 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|081470
MIPNFSNPALLQQQQQQQQHPQQSQHPQHQQQPDQHAAYQDQNRLWQQQAQFRPRSGMDINQQPQQQQQQQSQQV
QDMFRARHGSQNQPMGPQQPMPQFGLGMSPAQMPNAGAMKPLPSNQQPFSDASAAQSQPSHMQPAGFANMGSMPN
QNPGLNAASIPQRNSNILAMQNGAMGKQLELMLAQSANNAFHPAKLNQQHQQSQQVQQQQQQPSQQQVQSEMFSP
ALSGDALRRPSPSHPPNLPPQMQGSLQGPQQHPVPGVLHPSAMPQRRNQAALQEITERLKAARQNVMSSEAELRA
VMNQLHTQPGEVTQNIQGMQNDLKLKQEILQQLQRQQQAFLHDGAIANNLARLGPNNVPGQSPWGPQNGQSQNFE
NGGGMGRGGAHLQNPHQPGQQPPNGMQPNSALQQAPNNHLMASGGVPRQGPTPNPPGIQPPQQLGSPFPGQMNVP
ANMANKPNFPLGAYMGANPAAAAAAMHQRTLNSLGFPPPLEKSKFNSTLPGFLQKRSIKIDPALLRLNDQQIDLA
NLHALVISEGGYNKVHENGLWDVIGGRMGFVNFPGSDHEPAKSGPVVAQNLAHVYREYLLDLETAYLRTWIANAH
ARMNNPGMQHPGGPGGLPNGMAANGQQPRFSPQLLQYAHMSTAELRHRGVPENVIAMVDQVRPQLQRTLMEQKRF
QQQGAMINEAGQQNGAAAMMLRQQMMKHPMMNGAGGMDARFNPFHAQYPQRNLEMTKNAMEAINRMKEDCKKGPQ
LARFMQANIEIPYDQQAEFNRLLDATYRQAQDLDQKLHLLHVILPSCTQRVIIISNIVATQRQLKSTSQPRYILS
LELLRNLASELQKIVEMFTTAHMQKQYARMQPPGQQHQLAQLGQVPNQPPQPPGMSNHPGPHPHQQPPPSGPNNM
NGTAHSPPGSNNMLNLRHSPMQQPAHQQHPQPSQQQQQQQPMQIPPQQGLQVSQQPQAPSPSHMPSNRGASINLQ
APPHNKKKAQNAPTPNTAPSPAAATSTPAPTNAPTPTAAASSPAAPKSPKGKAKAKQPGRRKMSTAPNPAPTPSS
APVQAPAQAPPEAVQHQPPTTNGSGKRPREEDAPSGNMAPSPAGGSNAVVDQPSPPKRSKLEWGDGSQSEELQQK
KAQVENVKTEEDTSQLLEDIIKIVGGDPVRDNNGFAELSMLLKGYTQPGSADDLASFPSLEPPLMMKDDLEQYFD
FSLGGEDDDSKTPELLSSSSTTDTSPGSNAGNEPTSEGAAAQISNEIKNEESLDFTPLTHLGLWSGVDGGESAYY
QTSDWKWDNTMGTQDPWAISTS*
Coding >Agabi119p4|081470
ATGATTCCCAACTTTAGCAATCCCGCCCTCCTCCAGCAGCAGCAGCAACAACAACAGCACCCCCAGCAATCCCAG
CACCCCCAGCACCAGCAGCAGCCAGACCAACACGCCGCTTATCAAGACCAAAACAGGCTATGGCAGCAGCAAGCT
CAGTTCAGACCTCGTAGTGGCATGGACATCAACCAGCAGCCCCAGCAGCAGCAGCAGCAGCAGTCTCAACAAGTC
CAGGACATGTTCAGAGCTCGCCACGGTTCCCAGAACCAGCCGATGGGTCCTCAGCAGCCCATGCCTCAGTTCGGT
CTCGGCATGTCCCCCGCTCAGATGCCCAACGCTGGTGCTATGAAGCCTCTTCCCTCAAATCAACAACCCTTTTCC
GACGCCTCTGCCGCGCAGTCCCAGCCGTCACACATGCAACCTGCCGGCTTTGCTAACATGGGCTCTATGCCCAAC
CAGAATCCCGGCCTTAATGCCGCTTCTATTCCGCAACGTAATTCCAATATCCTCGCCATGCAAAACGGAGCCATG
GGCAAACAGCTCGAACTCATGCTCGCGCAGTCCGCCAATAATGCTTTTCACCCGGCAAAGCTGAATCAGCAGCAC
CAACAGAGCCAGCAGGTCCAGCAGCAGCAGCAGCAGCCGTCGCAGCAACAAGTACAAAGTGAGATGTTCTCTCCC
GCTCTCTCCGGCGATGCTCTCCGACGTCCCTCCCCTTCCCACCCTCCTAACCTTCCTCCCCAAATGCAAGGCTCT
CTACAGGGCCCCCAGCAACATCCCGTTCCCGGTGTCCTCCATCCTTCCGCAATGCCGCAGCGTCGCAATCAGGCC
GCCCTTCAAGAGATTACTGAGCGGTTAAAAGCCGCTCGTCAGAACGTCATGTCCAGTGAGGCGGAGCTTCGCGCG
GTCATGAACCAGCTTCATACGCAGCCCGGAGAGGTCACCCAGAACATTCAGGGCATGCAAAACGATCTCAAGCTC
AAGCAGGAAATCCTACAACAGCTACAACGGCAGCAGCAAGCCTTTTTGCATGACGGTGCTATTGCCAATAACCTT
GCTCGTCTGGGTCCAAACAATGTCCCCGGCCAGTCGCCATGGGGCCCTCAGAATGGCCAATCTCAGAACTTTGAG
AACGGTGGAGGTATGGGTCGCGGCGGTGCGCATCTTCAGAACCCTCATCAACCGGGCCAACAACCGCCCAACGGC
ATGCAACCCAACTCTGCCCTTCAACAAGCACCCAACAACCACCTCATGGCGTCTGGCGGCGTTCCACGGCAAGGT
CCTACGCCAAATCCACCTGGCATTCAGCCCCCCCAGCAACTGGGTAGCCCTTTCCCAGGCCAAATGAACGTTCCT
GCCAACATGGCCAACAAACCCAATTTCCCATTGGGTGCGTATATGGGCGCCAATCCGGCGGCTGCTGCTGCAGCA
ATGCACCAGCGTACTCTAAACAGTCTTGGATTTCCCCCTCCCCTCGAGAAAAGCAAGTTTAATTCGACGCTGCCC
GGGTTTCTACAGAAACGGAGCATCAAGATCGATCCGGCCTTGTTAAGGCTCAATGATCAACAAATCGATCTCGCC
AATCTTCACGCGCTTGTCATTAGTGAAGGAGGATACAATAAAGTCCATGAGAACGGGCTCTGGGATGTTATTGGC
GGAAGGATGGGTTTTGTCAACTTTCCCGGATCGGATCACGAGCCCGCTAAATCCGGCCCGGTCGTCGCTCAGAAC
CTCGCACATGTGTACCGCGAGTATCTCCTAGATTTGGAAACTGCCTATCTCCGTACTTGGATAGCTAACGCACAT
GCGAGAATGAACAACCCGGGAATGCAACATCCTGGTGGCCCTGGTGGCCTACCGAACGGCATGGCTGCTAATGGA
CAACAACCCAGGTTCAGTCCCCAACTGCTGCAGTATGCGCACATGTCCACAGCTGAACTGCGTCATCGTGGTGTC
CCCGAAAACGTGATCGCTATGGTGGACCAAGTCCGGCCTCAGTTGCAGAGGACGCTTATGGAGCAAAAGAGGTTT
CAACAACAGGGCGCCATGATCAACGAAGCCGGTCAACAGAATGGAGCTGCTGCCATGATGCTACGTCAACAGATG
ATGAAGCACCCCATGATGAACGGTGCTGGTGGCATGGACGCTCGTTTTAATCCATTCCATGCGCAATATCCCCAA
CGTAACCTCGAGATGACCAAGAACGCTATGGAGGCGATTAATCGGATGAAGGAAGACTGTAAAAAGGGTCCGCAA
CTTGCTCGTTTCATGCAAGCAAACATCGAGATACCATATGACCAACAAGCCGAATTTAATAGACTGCTTGACGCC
ACTTATCGTCAAGCACAAGATTTAGACCAAAAACTGCATCTTCTGCATGTGATACTACCCTCATGTACGCAGAGA
GTTATCATTATTTCCAACATTGTCGCAACTCAAAGGCAATTGAAATCGACTTCTCAGCCCCGGTACATCTTGAGC
CTGGAGCTACTTCGGAATCTGGCTTCGGAACTCCAAAAAATTGTAGAAATGTTTACGACCGCACATATGCAGAAA
CAATACGCAAGAATGCAACCGCCCGGGCAACAACATCAACTTGCTCAACTAGGACAAGTTCCTAATCAGCCGCCG
CAACCTCCCGGGATGTCGAACCATCCCGGCCCTCACCCTCATCAACAACCCCCGCCTTCCGGGCCCAACAATATG
AACGGAACGGCGCATTCGCCTCCTGGATCTAATAATATGCTGAATCTTCGTCATTCTCCTATGCAACAACCTGCT
CATCAACAACATCCCCAACCTTCTCAGCAACAACAGCAGCAGCAGCCGATGCAAATACCCCCTCAGCAGGGGCTG
CAAGTTTCTCAACAACCTCAGGCTCCATCTCCTTCGCATATGCCATCAAATAGAGGTGCTTCGATAAACCTGCAA
GCGCCACCCCACAACAAAAAGAAGGCTCAGAATGCGCCGACTCCTAATACGGCTCCCTCTCCCGCCGCTGCTACT
TCAACGCCTGCGCCTACCAATGCGCCTACACCGACCGCTGCCGCTTCTTCCCCTGCGGCGCCCAAGTCGCCCAAG
GGTAAGGCCAAAGCCAAGCAGCCGGGCAGACGAAAGATGTCGACGGCGCCGAATCCCGCTCCCACACCTAGCTCT
GCTCCTGTTCAAGCGCCTGCTCAAGCGCCTCCTGAAGCGGTGCAGCATCAGCCTCCGACTACGAACGGTAGTGGG
AAGCGACCACGTGAGGAGGATGCTCCGAGTGGGAACATGGCACCTAGTCCTGCCGGAGGATCTAATGCAGTTGTT
GATCAACCTTCGCCACCCAAGCGTTCCAAACTGGAATGGGGAGACGGGTCTCAGTCAGAAGAATTGCAGCAGAAG
AAGGCACAGGTTGAGAACGTCAAGACGGAGGAGGATACGAGTCAGCTGTTGGAGGATATTATCAAGATTGTGGGG
GGAGACCCTGTACGGGATAACAACGGGTTTGCAGAACTTTCGATGCTTCTGAAAGGATACACCCAACCTGGTTCT
GCTGATGACCTGGCTTCGTTCCCGTCTCTTGAGCCTCCGTTGATGATGAAAGACGATCTAGAGCAGTACTTTGAC
TTTTCGTTGGGAGGCGAAGATGACGATTCAAAGACACCTGAACTACTGTCTTCATCTTCGACGACTGACACGAGT
CCTGGGTCTAATGCGGGTAATGAGCCTACATCGGAAGGAGCGGCAGCACAGATATCCAACGAAATTAAAAATGAA
GAGTCGCTCGACTTTACGCCTCTTACGCATCTTGGACTATGGAGTGGAGTGGATGGAGGAGAGTCGGCTTATTAT
CAGACCTCCGACTGGAAATGGGATAATACAATGGGAACACAGGATCCTTGGGCAATCTCCACTTCATAA
Transcript >Agabi119p4|081470
ATGATTCCCAACTTTAGCAATCCCGCCCTCCTCCAGCAGCAGCAGCAACAACAACAGCACCCCCAGCAATCCCAG
CACCCCCAGCACCAGCAGCAGCCAGACCAACACGCCGCTTATCAAGACCAAAACAGGCTATGGCAGCAGCAAGCT
CAGTTCAGACCTCGTAGTGGCATGGACATCAACCAGCAGCCCCAGCAGCAGCAGCAGCAGCAGTCTCAACAAGTC
CAGGACATGTTCAGAGCTCGCCACGGTTCCCAGAACCAGCCGATGGGTCCTCAGCAGCCCATGCCTCAGTTCGGT
CTCGGCATGTCCCCCGCTCAGATGCCCAACGCTGGTGCTATGAAGCCTCTTCCCTCAAATCAACAACCCTTTTCC
GACGCCTCTGCCGCGCAGTCCCAGCCGTCACACATGCAACCTGCCGGCTTTGCTAACATGGGCTCTATGCCCAAC
CAGAATCCCGGCCTTAATGCCGCTTCTATTCCGCAACGTAATTCCAATATCCTCGCCATGCAAAACGGAGCCATG
GGCAAACAGCTCGAACTCATGCTCGCGCAGTCCGCCAATAATGCTTTTCACCCGGCAAAGCTGAATCAGCAGCAC
CAACAGAGCCAGCAGGTCCAGCAGCAGCAGCAGCAGCCGTCGCAGCAACAAGTACAAAGTGAGATGTTCTCTCCC
GCTCTCTCCGGCGATGCTCTCCGACGTCCCTCCCCTTCCCACCCTCCTAACCTTCCTCCCCAAATGCAAGGCTCT
CTACAGGGCCCCCAGCAACATCCCGTTCCCGGTGTCCTCCATCCTTCCGCAATGCCGCAGCGTCGCAATCAGGCC
GCCCTTCAAGAGATTACTGAGCGGTTAAAAGCCGCTCGTCAGAACGTCATGTCCAGTGAGGCGGAGCTTCGCGCG
GTCATGAACCAGCTTCATACGCAGCCCGGAGAGGTCACCCAGAACATTCAGGGCATGCAAAACGATCTCAAGCTC
AAGCAGGAAATCCTACAACAGCTACAACGGCAGCAGCAAGCCTTTTTGCATGACGGTGCTATTGCCAATAACCTT
GCTCGTCTGGGTCCAAACAATGTCCCCGGCCAGTCGCCATGGGGCCCTCAGAATGGCCAATCTCAGAACTTTGAG
AACGGTGGAGGTATGGGTCGCGGCGGTGCGCATCTTCAGAACCCTCATCAACCGGGCCAACAACCGCCCAACGGC
ATGCAACCCAACTCTGCCCTTCAACAAGCACCCAACAACCACCTCATGGCGTCTGGCGGCGTTCCACGGCAAGGT
CCTACGCCAAATCCACCTGGCATTCAGCCCCCCCAGCAACTGGGTAGCCCTTTCCCAGGCCAAATGAACGTTCCT
GCCAACATGGCCAACAAACCCAATTTCCCATTGGGTGCGTATATGGGCGCCAATCCGGCGGCTGCTGCTGCAGCA
ATGCACCAGCGTACTCTAAACAGTCTTGGATTTCCCCCTCCCCTCGAGAAAAGCAAGTTTAATTCGACGCTGCCC
GGGTTTCTACAGAAACGGAGCATCAAGATCGATCCGGCCTTGTTAAGGCTCAATGATCAACAAATCGATCTCGCC
AATCTTCACGCGCTTGTCATTAGTGAAGGAGGATACAATAAAGTCCATGAGAACGGGCTCTGGGATGTTATTGGC
GGAAGGATGGGTTTTGTCAACTTTCCCGGATCGGATCACGAGCCCGCTAAATCCGGCCCGGTCGTCGCTCAGAAC
CTCGCACATGTGTACCGCGAGTATCTCCTAGATTTGGAAACTGCCTATCTCCGTACTTGGATAGCTAACGCACAT
GCGAGAATGAACAACCCGGGAATGCAACATCCTGGTGGCCCTGGTGGCCTACCGAACGGCATGGCTGCTAATGGA
CAACAACCCAGGTTCAGTCCCCAACTGCTGCAGTATGCGCACATGTCCACAGCTGAACTGCGTCATCGTGGTGTC
CCCGAAAACGTGATCGCTATGGTGGACCAAGTCCGGCCTCAGTTGCAGAGGACGCTTATGGAGCAAAAGAGGTTT
CAACAACAGGGCGCCATGATCAACGAAGCCGGTCAACAGAATGGAGCTGCTGCCATGATGCTACGTCAACAGATG
ATGAAGCACCCCATGATGAACGGTGCTGGTGGCATGGACGCTCGTTTTAATCCATTCCATGCGCAATATCCCCAA
CGTAACCTCGAGATGACCAAGAACGCTATGGAGGCGATTAATCGGATGAAGGAAGACTGTAAAAAGGGTCCGCAA
CTTGCTCGTTTCATGCAAGCAAACATCGAGATACCATATGACCAACAAGCCGAATTTAATAGACTGCTTGACGCC
ACTTATCGTCAAGCACAAGATTTAGACCAAAAACTGCATCTTCTGCATGTGATACTACCCTCATGTACGCAGAGA
GTTATCATTATTTCCAACATTGTCGCAACTCAAAGGCAATTGAAATCGACTTCTCAGCCCCGGTACATCTTGAGC
CTGGAGCTACTTCGGAATCTGGCTTCGGAACTCCAAAAAATTGTAGAAATGTTTACGACCGCACATATGCAGAAA
CAATACGCAAGAATGCAACCGCCCGGGCAACAACATCAACTTGCTCAACTAGGACAAGTTCCTAATCAGCCGCCG
CAACCTCCCGGGATGTCGAACCATCCCGGCCCTCACCCTCATCAACAACCCCCGCCTTCCGGGCCCAACAATATG
AACGGAACGGCGCATTCGCCTCCTGGATCTAATAATATGCTGAATCTTCGTCATTCTCCTATGCAACAACCTGCT
CATCAACAACATCCCCAACCTTCTCAGCAACAACAGCAGCAGCAGCCGATGCAAATACCCCCTCAGCAGGGGCTG
CAAGTTTCTCAACAACCTCAGGCTCCATCTCCTTCGCATATGCCATCAAATAGAGGTGCTTCGATAAACCTGCAA
GCGCCACCCCACAACAAAAAGAAGGCTCAGAATGCGCCGACTCCTAATACGGCTCCCTCTCCCGCCGCTGCTACT
TCAACGCCTGCGCCTACCAATGCGCCTACACCGACCGCTGCCGCTTCTTCCCCTGCGGCGCCCAAGTCGCCCAAG
GGTAAGGCCAAAGCCAAGCAGCCGGGCAGACGAAAGATGTCGACGGCGCCGAATCCCGCTCCCACACCTAGCTCT
GCTCCTGTTCAAGCGCCTGCTCAAGCGCCTCCTGAAGCGGTGCAGCATCAGCCTCCGACTACGAACGGTAGTGGG
AAGCGACCACGTGAGGAGGATGCTCCGAGTGGGAACATGGCACCTAGTCCTGCCGGAGGATCTAATGCAGTTGTT
GATCAACCTTCGCCACCCAAGCGTTCCAAACTGGAATGGGGAGACGGGTCTCAGTCAGAAGAATTGCAGCAGAAG
AAGGCACAGGTTGAGAACGTCAAGACGGAGGAGGATACGAGTCAGCTGTTGGAGGATATTATCAAGATTGTGGGG
GGAGACCCTGTACGGGATAACAACGGGTTTGCAGAACTTTCGATGCTTCTGAAAGGATACACCCAACCTGGTTCT
GCTGATGACCTGGCTTCGTTCCCGTCTCTTGAGCCTCCGTTGATGATGAAAGACGATCTAGAGCAGTACTTTGAC
TTTTCGTTGGGAGGCGAAGATGACGATTCAAAGACACCTGAACTACTGTCTTCATCTTCGACGACTGACACGAGT
CCTGGGTCTAATGCGGGTAATGAGCCTACATCGGAAGGAGCGGCAGCACAGATATCCAACGAAATTAAAAATGAA
GAGTCGCTCGACTTTACGCCTCTTACGCATCTTGGACTATGGAGTGGAGTGGATGGAGGAGAGTCGGCTTATTAT
CAGACCTCCGACTGGAAATGGGATAATACAATGGGAACACAGGATCCTTGGGCAATCTCCACTTCATAA
Gene >Agabi119p4|081470
ATGATTCCCAACTTTAGCAATCCCGCCCTCCTCCAGCAGCAGCAGCAACAACAACAGCACCCCCAGCAATCCCAG
CACCCCCAGCACCAGCAGCAGCCAGACCAACACGCCGCTTATCAAGACCAAAACAGGCTATGGCAGCAGCAAGCT
CAGTTCAGACCTCGTAGTGGCATGGACATCAACCAGCAGCCCCAGCAGCAGCAGCAGCAGCAGTCTCAACAAGTG
AGCCCTTTCCAACCCCACTTGCCCTCCCCACCCCTCTCTCTCCCACATACCTCTCTCCTTCCCTACCCCGCGGCC
ACTAACCCTTTCCTTGTCGTGGGAGCTTCTTCCTCCTGATGATCATCGTTCTTACCTCATTCACAGGTCCAGGAC
ATGTTCAGAGCTCGCCACGGTTCCCAGAACCAGCCGATGGGTCCTCAGCAGCCCATGCCTCAGTTCGGTCTCGGC
ATGTCCCCCGCTCAGATGCCCAACGCTGGTGCTATGAAGCCTCTTCCCTCAAATCAACAACCCTTTTCCGACGCC
TCTGCCGCGCAGTCCCAGCCGTCACACATGCAACCTGCCGGCTTTGCTAACATGGGCTCTATGCCCAACCAGAAT
CCCGGCCTTAATGCCGCTTCTATTCCGCAACGTAATTCCAATATCCTCGCCATGCAAAACGGAGCCATGGGCAAA
CAGCTCGAACTCATGCTCGCGCAGTCCGCCAATAATGCTTTTCACCCGGCAAAGCTGAATCAGCAGCACCAACAG
AGCCAGCAGGTCCAGCAGCAGCAGCAGCAGCCGTCGCAGCAACAAGTACAAAGTGAGATGTTCTCTCCCGCTCTC
TCCGGCGATGCTCTCCGACGTCCCTCCCCTTCCCACCCTCCTAACCTTCCTCCCCAAATGCAAGGCTCTCTACAG
GGCCCCCAGCAACATCCCGTTCCCGGTGTCCTCCATCCTTCCGCAATGCCGCAGCGTCGCAATCAGGCCGCCCTT
CAAGAGATTACTGAGCGGTTAAAAGCCGCTCGTCAGAACGTCATGTCCAGTGAGGCGGAGCTTCGCGCGGTCATG
AACCAGCTTCATACGCAGCCCGGAGAGGTCACCCAGAACATTCAGGGCATGCAAAACGATCTCAAGCTCAAGCAG
GAAATCCTACAACAGCTACAACGGCAGCAGCAAGCCTTTTTGCATGACGGTGCTATGTACGTGTTGGTCCCTACA
TCGCCCTGTTTTTCATACTAAATTTTCAAAACAGTGCCAATAACCTTGCTCGTCTGGGTCCAAACAATGTCCCCG
GCCAGTCGCCATGGGGCCCTCAGAATGGCCAATCTCAGAACTTTGAGAACGGTGGAGGTATGGGTCGCGGCGGTG
CGCATCTTCAGAACCCTCATCAACCGGGCCAACAACCGCCCAACGGCATGCAACCCAACTCTGCCCTTCAACAAG
CACCCAACAACCACCTCATGGCGTCTGGCGGCGTTCCACGGCAAGGTCCTACGCCAAATCCACCTGGCATTCAGC
CCCCCCAGCAACTGGGTAGCCCTTTCCCAGGCCAAATGAACGTTCCTGCCAACATGGCCAACAAACCCAATTTCC
CATTGGGTGCGTATATGGGCGCCAATCCGGCGGCTGCTGCTGCAGCAATGCACCAGCGTACTCTAAACAGTCTTG
GATTTCCCCCTCCCCTCGAGAAAAGCAAGTTTAATTCGACGCTGCCCGGGTTTCTACAGAAACGGAGCATCAAGA
TCGATCCGGCCTTGTTAAGGCTCAATGATCAACAAATCGATCTCGCCAATCTTCACGCGCTTGTCATTAGTGAAG
GAGGATACAATAAAGTAGGTTTTCATCCCCGCGGGGAACTGTGGTACTGACCGGATGTCATCTCTAGGTCCATGA
GAACGGGCTCTGGGATGTTATTGGCGGAAGGATGGGTTTTGTCAACTTTCCCGGATCGGATCACGAGCCCGCTAA
ATCCGGCCCGGTCGTCGCTCAGAACCTCGCACATGTGTACCGCGAGTATCTCCTAGATTTGGAAACTGCCTATCT
CCGTACTTGGATAGCTAACGCACATGCGAGAATGAACAACCCGGGAATGCAACATCCTGGTGGCCCTGGTGGCCT
ACCGAACGGCATGGCTGCTAATGGACAACAACCCAGGTTCAGTCCCCAACTGCTGCAGTATGCGCACATGTCCAC
AGCTGAACTGCGTCATCGTGGTGTCCCCGAAAACGTGATCGCTATGGTGGACCAAGTCCGGCCTCAGTTGCAGAG
GACGCTTATGGAGCAAAAGAGGTTTCAACAACAGGTGCGCATGAACGCTCGGAATGGGCCTGGAATGGCTGGTGT
ACCCGTTGATGCTAACGGGATGCAACCTCCAAACCAGGGCGCCATGATCAACGAAGCCGGTCAACAGAATGGAGC
TGCTGCCATGATGCTACGTCAACAGATGATGAAGCACCCCATGATGAACGGTGCTGGTGGCATGGACGCTCGTTT
TAATCCATTCCATGCGCAATATCCCCAACGTAACCTCGAGATGACCAAGAACGCTATGGAGGCGATTAATCGGAT
GAAGGAAGACTGTAAAAAGGGTCAGTTCCCACCTTTGTGACTGGTTGCTTGATCCAGCTTGATAACGAGGCCATT
TCCATCTAGGTCCGCAACTTGCTCGTTTCATGCAAGCAAACATCGAGATACCATATGACCAACAAGCCGAATTTA
ATAGACTGCTTGACGCCACTTATCGTCAAGCACAAGATTTAGACCAAAAACTGCATCTTCTGCATGTGATACTAC
CCTCATGTACGCAGAGAGTTATCATTATTGTACGTCTTTTTCCATTTATAGTTTCGTCTGTTTTACTAACGATTC
ACCCAAAGTCCAACATTGTCGCAACTCAAAGGCAATTGAAATCGACTTCTCAGCCCCGGTACATCTTGAGCCTGG
AGCTACTTCGGAATCTGGCTTCGGAACTCCAAAAAATTGTAGAAATGTTTACGACCGCACATATGCAGAAACAAT
ACGCAAGAATGCAACCGCCCGGGCAACAACATCAACTTGCTCAACTAGGACAAGTTCCTAATCAGCCGCCGCAAC
CTCCCGGGATGTCGAACCATCCCGGCCCTCACCCTCATCAACAACCCCCGCCTTCCGGGCCCAACAATATGAACG
GAACGGCGCATTCGCCTCCTGGATCTAATAATATGCTGAATCTTCGTCATTCTCCTATGCAACAACCTGCTCATC
AACAACATCCCCAACCTTCTCAGCAACAACAGCAGCAGCAGCCGATGCAAATACCCCCTCAGCAGGGGCTGCAAG
TTTCTCAACAACCTCAGGCTCCATCTCCTTCGCATATGCCATCAAATAGAGGTGCTTCGATAAACCTGCAAGCGC
CACCCCACAACAAAAAGAAGGCTCAGAATGCGCCGACTCCTAATACGGCTCCCTCTCCCGCCGCTGCTACTTCAA
CGCCTGCGCCTACCAATGCGCCTACACCGACCGCTGCCGCTTCTTCCCCTGCGGCGCCCAAGTCGCCCAAGGGTA
AGGCCAAAGCCAAGCAGCCGGGCAGACGAAAGATGTCGACGGCGCCGAATCCCGCTCCCACACCTAGCTCTGCTC
CTGTTCAAGCGCCTGCTCAAGCGCCTCCTGAAGCGGTGCAGCATCAGCCTCCGACTACGAACGGTAGTGGGAAGC
GACCACGTGAGGAGGATGCTCCGAGTGGGAACATGGCACCTAGTCCTGCCGGAGGATCTAATGCAGTTGTTGATC
AACCTTCGCCACCCAAGCGTTCCAAACTGGAATGGGGAGACGGGTCTCAGTCAGAAGAATTGCAGCAGAAGAAGG
CACAGGTTGAGAACGTCAAGACGGAGGAGGATACGAGTCAGCTGTTGGAGGATATTATCAAGATTGTGGGGGGAG
ACCCTGTACGGGATAACAACGGGTTTGCAGAACTTTCGATGCTTCTGAAAGGATACACCCAACCTGGTTCTGCTG
ATGACCTGGCTTCGTTCCCGTCTCTTGAGCCTCCGTTGATGATGAAAGACGATCTAGAGCAGTACTTTGACTTTT
CGTTGGGAGGCGAAGATGACGATTCAAAGACACCTGAACTACTGTCTTCATCTTCGACGACTGACACGAGTCCTG
GGTCTAATGCGGGTAATGAGCCTACATCGGAAGGAGCGGCAGCACAGATATCCAACGAAATTAAAAATGAAGAGT
CGCTCGACTTTACGCCTCTTACGCATCTTGGACTATGGAGTGGAGTGGATGGAGGAGAGTCGGCTTATTATCAGA
CCTCCGACTGGAAATGGGATAATACAATGGGAACACAGGATCCTTGGGCAATCTCCACTTCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail