Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|081300
Gene name
Locationscaffold_05a:856615..857044
Strand+
Gene length (bp)429
Transcript length (bp)267
Coding sequence length (bp)267
Protein length (aa) 89

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05347 Complex1_LYR Complex 1 protein (LYR family) 3.7E-09 8 59

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5XCZ6|LYRM5_SALSA LYR motif-containing protein 5 OS=Salmo salar GN=lyrm5 PE=3 SV=1 3 81 4.0E-13
sp|Q91V16|LYRM5_MOUSE LYR motif-containing protein 5 OS=Mus musculus GN=Lyrm5 PE=1 SV=1 3 84 6.0E-13
sp|A3KNJ8|LYM5B_DANRE LYR motif-containing protein 5B OS=Danio rerio GN=lyrm5b PE=3 SV=1 3 84 3.0E-12
sp|B5FXA0|LYRM5_TAEGU LYR motif-containing protein 5 OS=Taeniopygia guttata GN=LYRM5 PE=3 SV=1 3 81 1.0E-11
sp|Q503U1|LYM5A_DANRE LYR motif-containing protein 5A OS=Danio rerio GN=lyrm5a PE=3 SV=1 4 81 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5XCZ6|LYRM5_SALSA LYR motif-containing protein 5 OS=Salmo salar GN=lyrm5 PE=3 SV=1 3 81 4.0E-13
sp|Q91V16|LYRM5_MOUSE LYR motif-containing protein 5 OS=Mus musculus GN=Lyrm5 PE=1 SV=1 3 84 6.0E-13
sp|A3KNJ8|LYM5B_DANRE LYR motif-containing protein 5B OS=Danio rerio GN=lyrm5b PE=3 SV=1 3 84 3.0E-12
sp|B5FXA0|LYRM5_TAEGU LYR motif-containing protein 5 OS=Taeniopygia guttata GN=LYRM5 PE=3 SV=1 3 81 1.0E-11
sp|Q503U1|LYM5A_DANRE LYR motif-containing protein 5A OS=Danio rerio GN=lyrm5a PE=3 SV=1 4 81 1.0E-11
sp|Q6IPR1|LYRM5_HUMAN LYR motif-containing protein 5 OS=Homo sapiens GN=LYRM5 PE=3 SV=2 20 84 8.0E-09
sp|Q0VCR0|LYRM5_BOVIN LYR motif-containing protein 5 OS=Bos taurus GN=LYRM5 PE=3 SV=1 20 84 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|081300
MAGNLTRQRALALYKELRQLGRDYPDPAYDFNGRVRRLFEKNRNLTDRDEIEKALRMGEYIKKETLALYSLRKYR
HLKRMYPDSMSDP*
Coding >Agabi119p4|081300
ATGGCTGGTAACCTTACCCGCCAAAGGGCACTTGCTTTGTACAAGGAACTCCGTCAACTTGGGCGAGATTATCCA
GATCCTGCTTACGACTTTAACGGAAGAGTGCGGAGACTGTTCGAAAAAAACAGGAACTTGACGGATCGGGATGAG
ATTGAGAAGGCTCTTCGAATGGGAGAGTATATAAAGAAAGAAACCTTGGCACTCTATTCTCTTCGAAAATATAGA
CATCTCAAGAGGATGTATCCAGACTCTATGTCGGATCCCTGA
Transcript >Agabi119p4|081300
ATGGCTGGTAACCTTACCCGCCAAAGGGCACTTGCTTTGTACAAGGAACTCCGTCAACTTGGGCGAGATTATCCA
GATCCTGCTTACGACTTTAACGGAAGAGTGCGGAGACTGTTCGAAAAAAACAGGAACTTGACGGATCGGGATGAG
ATTGAGAAGGCTCTTCGAATGGGAGAGTATATAAAGAAAGAAACCTTGGCACTCTATTCTCTTCGAAAATATAGA
CATCTCAAGAGGATGTATCCAGACTCTATGTCGGATCCCTGA
Gene >Agabi119p4|081300
ATGGCTGGTAACCTTACCCGCCAAAGGGCACTTGCTTTGTACAAGGAACTCCGTCAACTTGGGCGAGATTATCCA
GATCCTGCGTGAGTCTAACATTTGCCCTCAATGCCCACCTAGTCATCAACTCACCTTCGCCCCAAGTTACGACTT
TAACGGAAGAGTGCGGAGACTGTTCGAAAGTATATCCGTGCCCCAGCTAGCTTTATAGCCTCTCGCTTATCACCA
TAAAGAAAACAGGAACTTGACGGATCGGGATGAGATTGAGAAGGCTCTTCGAATGGGAGAGTATATAAAGAAAGG
TGTGTATACGCCCCTATACTCCGTATCTCGGGTATTAAATAGTATTCGAAAGAAACCTTGGCACTCTATTCTCTT
CGAAAATATAGACATCTCAAGAGGATGTATCCAGACTCTATGTCGGATCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail