Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|081150
Gene name
Locationscaffold_05a:824364..826888
Strand+
Gene length (bp)2524
Transcript length (bp)2244
Coding sequence length (bp)2244
Protein length (aa) 748

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03666 NPR3 Nitrogen Permease regulator of amino acid transport activity 3 8.6E-17 126 185
PF03666 NPR3 Nitrogen Permease regulator of amino acid transport activity 3 7.3E-73 204 556

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5D9Y9|NPR3_PICGU Nitrogen permease regulator 3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NPR3 PE=3 SV=2 125 745 8.0E-26
sp|Q6BQU8|NPR3_DEBHA Nitrogen permease regulator 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NPR3 PE=3 SV=2 122 745 1.0E-25
sp|A3LYV8|NPR3_PICST Nitrogen permease regulator 3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NPR3 PE=3 SV=2 4 745 8.0E-25
sp|Q5A319|NPR3_CANAL Nitrogen permease regulator 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NPR3 PE=3 SV=1 4 745 6.0E-24
sp|Q9HGM7|NPRL3_SCHPO Nitrogen permease regulator 3-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.04 PE=3 SV=1 73 587 4.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5D9Y9|NPR3_PICGU Nitrogen permease regulator 3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NPR3 PE=3 SV=2 125 745 8.0E-26
sp|Q6BQU8|NPR3_DEBHA Nitrogen permease regulator 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NPR3 PE=3 SV=2 122 745 1.0E-25
sp|A3LYV8|NPR3_PICST Nitrogen permease regulator 3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NPR3 PE=3 SV=2 4 745 8.0E-25
sp|Q5A319|NPR3_CANAL Nitrogen permease regulator 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NPR3 PE=3 SV=1 4 745 6.0E-24
sp|Q9HGM7|NPRL3_SCHPO Nitrogen permease regulator 3-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.04 PE=3 SV=1 73 587 4.0E-23
sp|Q1DHE5|NPR3_COCIM Nitrogen permease regulator 3 OS=Coccidioides immitis (strain RS) GN=NPR3 PE=3 SV=1 5 536 4.0E-18
sp|Q2UBT9|NPR3_ASPOR Nitrogen permease regulator 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=npr3 PE=3 SV=1 129 586 2.0E-17
sp|A1D3A0|NPR3_NEOFI Nitrogen permease regulator 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=npr3 PE=3 SV=1 125 565 3.0E-17
sp|Q4WTC7|NPR3_ASPFU Nitrogen permease regulator 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=npr3 PE=3 SV=2 125 565 9.0E-17
sp|C8VSE7|NPR3_EMENI Nitrogen permease regulator 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=npr3 PE=3 SV=1 125 565 7.0E-16
sp|A1CQD6|NPR3_ASPCL Nitrogen permease regulator 3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=npr3 PE=3 SV=1 125 718 9.0E-14
sp|Q0CQ46|NPR3_ASPTN Nitrogen permease regulator 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=npr3 PE=3 SV=1 210 576 2.0E-12
sp|Q12980|NPRL3_HUMAN Nitrogen permease regulator 3-like protein OS=Homo sapiens GN=NPRL3 PE=1 SV=1 131 745 2.0E-12
sp|Q8VIJ8|NPRL3_MOUSE Nitrogen permease regulator 3-like protein OS=Mus musculus GN=Nprl3 PE=1 SV=1 131 745 1.0E-11
sp|Q6FVA1|NPR3_CANGA Nitrogen permease regulator 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NPR3 PE=3 SV=1 116 328 1.0E-11
sp|Q0TZN8|NPR3_PHANO Nitrogen permease regulator 3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NPR3 PE=3 SV=1 2 572 2.0E-11
sp|Q750J0|NPR3_ASHGO Nitrogen permease regulator 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NPR3 PE=3 SV=3 114 328 8.0E-11
sp|P38742|NPR3_YEAST Nitrogen permease regulator 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPR3 PE=1 SV=1 489 745 3.0E-08
sp|A5E0E7|NPR3_LODEL Nitrogen permease regulator 3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NPR3 PE=3 SV=1 125 570 3.0E-08
sp|Q6FVA1|NPR3_CANGA Nitrogen permease regulator 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NPR3 PE=3 SV=1 489 745 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0032007 negative regulation of TOR signaling Yes
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:1902531 regulation of intracellular signal transduction No
GO:1902532 negative regulation of intracellular signal transduction No
GO:0023057 negative regulation of signaling No
GO:0010646 regulation of cell communication No
GO:0048583 regulation of response to stimulus No
GO:0050794 regulation of cellular process No
GO:0048585 negative regulation of response to stimulus No
GO:0032006 regulation of TOR signaling No
GO:0065007 biological regulation No
GO:0009966 regulation of signal transduction No
GO:0009968 negative regulation of signal transduction No
GO:0023051 regulation of signaling No
GO:0010648 negative regulation of cell communication No
GO:0048519 negative regulation of biological process No
GO:0048523 negative regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|081150
MAESLLAILLVTKSAKGPALVYRWPPLPTGHPRLSRSRPDDGSWPSRIDNPWCASHAPEVLLGHAFAPNDQSWVD
DPEYRWQRPVRARSPSNQNNSSSHSPVDGSFSPPDPAPKPGEFHEYSHAFGYEVDFLAGLLLPHPSTCHQKFELL
VDDLAFVGHPVCVNWEGKWEFKEDKMEKELRGKESGIMSLSLKDMPGGISTTTDGQTGVDHLQIFHVVLVCDIPD
PSSSDSGNLFKYFDIIYEQIAFTLTAVLFQEQVLHKYVQEECDKLGALRDLSLSDREPYDVFATRCLEVSSMATT
IKDLYEAIKTSRIARLRINNFPLELQLPPHLDTLLHNEDETEMNYFNPSEEDDSPGWGAEMSFGWHLPPLAPWKT
LLLLDEPMRGEDGDALLDLKGPFPSTEDRCIAEGLVKFLETVTVTLSLADVANLLDWDLEGQIYPIVRWLVYSRR
AKIIDTIHPGLKNVFTVPSKFDVPLSDLTTEFAQIFNHPAIPPLPRILSLVSYSISKQTENHFYACFVKSKEMIP
PFHDVVIWMLKRDLLITLHLRIRVVATPDLKLRVQMQKERALARKKSHSRGRRRSFRVLKDDLDPQELGLRGFSN
PGVSWLSLSPKSSSAQRLPSMDSACSEISELAVEDEEDEYAYEGYRGLDSDWNEDMNDFGLDGDGDMNSSSIIHD
PARATALQKKWLSAMSDGKDPSVAKRFEQINQYFDGKRSGDEILYRAEISRRQLRETLHHYEEYLQTFLHPS*
Coding >Agabi119p4|081150
ATGGCAGAGTCCCTCTTGGCTATCCTGCTCGTCACCAAGTCTGCCAAAGGTCCAGCTCTAGTCTACCGATGGCCA
CCACTTCCCACCGGCCACCCCAGGCTTAGCCGATCCCGGCCAGACGATGGTTCATGGCCATCGAGAATAGACAAT
CCCTGGTGCGCTTCTCATGCACCGGAGGTACTACTAGGTCACGCTTTTGCTCCCAACGACCAGTCCTGGGTCGAT
GATCCCGAATACCGTTGGCAAAGACCCGTACGTGCAAGATCGCCGTCCAACCAAAACAACTCCTCATCTCATTCG
CCTGTGGATGGCTCATTTTCTCCACCTGATCCTGCACCAAAACCCGGTGAATTCCATGAATATAGCCACGCTTTT
GGATACGAGGTCGACTTCCTTGCAGGTTTACTTTTGCCACATCCATCGACGTGTCACCAAAAGTTTGAGCTGTTG
GTAGATGATTTGGCTTTTGTGGGGCACCCGGTCTGTGTTAATTGGGAAGGCAAATGGGAGTTCAAAGAAGACAAG
ATGGAGAAAGAGTTGCGGGGAAAGGAATCAGGCATTATGTCATTATCGTTGAAGGATATGCCGGGGGGTATTTCG
ACTACTACAGATGGACAAACCGGAGTGGATCATTTGCAGATTTTCCATGTCGTTCTCGTTTGCGATATTCCTGAC
CCTTCGTCCTCGGACTCTGGAAACCTCTTCAAGTATTTTGACATCATTTATGAACAAATTGCGTTTACTTTGACG
GCGGTTTTATTCCAAGAGCAAGTGCTGCATAAATATGTGCAGGAGGAATGCGACAAGTTGGGTGCCCTCCGGGAC
TTGTCGTTGTCAGACAGAGAACCATATGACGTTTTTGCCACTCGGTGCCTCGAAGTGTCATCAATGGCCACTACC
ATTAAAGATCTTTATGAAGCCATCAAAACTTCTCGAATAGCTCGGCTCAGAATCAACAATTTCCCTCTCGAATTA
CAATTACCTCCACACCTTGATACTCTACTTCATAACGAGGATGAAACAGAGATGAACTATTTCAATCCATCTGAG
GAAGATGATTCCCCCGGCTGGGGTGCAGAAATGAGTTTTGGTTGGCATTTACCGCCATTAGCACCTTGGAAGACT
TTGCTTTTGTTAGATGAACCAATGCGAGGCGAAGATGGTGATGCTTTGCTTGACCTCAAGGGACCTTTTCCCAGC
ACTGAGGACCGCTGTATTGCGGAAGGCTTGGTCAAGTTTCTAGAAACGGTAACCGTGACCCTCTCGTTGGCAGAC
GTAGCGAATTTACTTGATTGGGACCTTGAGGGACAAATTTACCCGATTGTGCGCTGGCTCGTGTACAGTCGACGA
GCGAAAATAATTGACACGATCCATCCTGGACTGAAGAATGTGTTCACTGTGCCCTCAAAGTTTGACGTCCCGCTT
TCAGATCTCACAACCGAATTCGCCCAGATATTCAATCACCCTGCTATACCTCCCTTGCCAAGAATACTGTCCTTG
GTATCTTATTCAATATCGAAACAGACGGAGAACCATTTTTATGCCTGTTTTGTCAAATCCAAGGAAATGATTCCT
CCGTTTCACGACGTCGTCATCTGGATGCTCAAACGAGATCTTTTGATAACGCTCCACCTCCGAATTCGTGTCGTA
GCAACGCCTGATCTTAAACTTCGAGTTCAGATGCAGAAAGAAAGGGCACTTGCACGAAAGAAATCCCATTCTCGA
GGTAGACGCAGGAGTTTTCGTGTCCTCAAAGATGATTTGGATCCGCAAGAATTGGGACTTAGAGGATTTTCAAAT
CCTGGAGTTTCATGGCTTTCGTTGTCGCCGAAATCATCATCTGCTCAACGGTTACCGTCTATGGATTCGGCGTGT
AGTGAGATAAGTGAATTGGCGGTTGAGGATGAAGAGGATGAGTATGCGTATGAAGGGTATCGAGGTTTGGATAGT
GATTGGAATGAGGATATGAATGATTTTGGTTTGGATGGGGATGGGGATATGAATAGTTCGAGTATTATTCATGAT
CCTGCTCGAGCGACGGCTTTGCAGAAGAAGTGGTTGTCGGCGATGTCGGATGGGAAGGATCCTTCTGTGGCGAAA
CGTTTCGAACAGATAAACCAGTATTTCGATGGAAAACGGTCGGGAGATGAAATTTTATACAGGGCTGAAATCTCG
AGAAGACAATTGAGAGAGACTTTACATCATTATGAAGAATATCTACAAACGTTCCTTCATCCATCATGA
Transcript >Agabi119p4|081150
ATGGCAGAGTCCCTCTTGGCTATCCTGCTCGTCACCAAGTCTGCCAAAGGTCCAGCTCTAGTCTACCGATGGCCA
CCACTTCCCACCGGCCACCCCAGGCTTAGCCGATCCCGGCCAGACGATGGTTCATGGCCATCGAGAATAGACAAT
CCCTGGTGCGCTTCTCATGCACCGGAGGTACTACTAGGTCACGCTTTTGCTCCCAACGACCAGTCCTGGGTCGAT
GATCCCGAATACCGTTGGCAAAGACCCGTACGTGCAAGATCGCCGTCCAACCAAAACAACTCCTCATCTCATTCG
CCTGTGGATGGCTCATTTTCTCCACCTGATCCTGCACCAAAACCCGGTGAATTCCATGAATATAGCCACGCTTTT
GGATACGAGGTCGACTTCCTTGCAGGTTTACTTTTGCCACATCCATCGACGTGTCACCAAAAGTTTGAGCTGTTG
GTAGATGATTTGGCTTTTGTGGGGCACCCGGTCTGTGTTAATTGGGAAGGCAAATGGGAGTTCAAAGAAGACAAG
ATGGAGAAAGAGTTGCGGGGAAAGGAATCAGGCATTATGTCATTATCGTTGAAGGATATGCCGGGGGGTATTTCG
ACTACTACAGATGGACAAACCGGAGTGGATCATTTGCAGATTTTCCATGTCGTTCTCGTTTGCGATATTCCTGAC
CCTTCGTCCTCGGACTCTGGAAACCTCTTCAAGTATTTTGACATCATTTATGAACAAATTGCGTTTACTTTGACG
GCGGTTTTATTCCAAGAGCAAGTGCTGCATAAATATGTGCAGGAGGAATGCGACAAGTTGGGTGCCCTCCGGGAC
TTGTCGTTGTCAGACAGAGAACCATATGACGTTTTTGCCACTCGGTGCCTCGAAGTGTCATCAATGGCCACTACC
ATTAAAGATCTTTATGAAGCCATCAAAACTTCTCGAATAGCTCGGCTCAGAATCAACAATTTCCCTCTCGAATTA
CAATTACCTCCACACCTTGATACTCTACTTCATAACGAGGATGAAACAGAGATGAACTATTTCAATCCATCTGAG
GAAGATGATTCCCCCGGCTGGGGTGCAGAAATGAGTTTTGGTTGGCATTTACCGCCATTAGCACCTTGGAAGACT
TTGCTTTTGTTAGATGAACCAATGCGAGGCGAAGATGGTGATGCTTTGCTTGACCTCAAGGGACCTTTTCCCAGC
ACTGAGGACCGCTGTATTGCGGAAGGCTTGGTCAAGTTTCTAGAAACGGTAACCGTGACCCTCTCGTTGGCAGAC
GTAGCGAATTTACTTGATTGGGACCTTGAGGGACAAATTTACCCGATTGTGCGCTGGCTCGTGTACAGTCGACGA
GCGAAAATAATTGACACGATCCATCCTGGACTGAAGAATGTGTTCACTGTGCCCTCAAAGTTTGACGTCCCGCTT
TCAGATCTCACAACCGAATTCGCCCAGATATTCAATCACCCTGCTATACCTCCCTTGCCAAGAATACTGTCCTTG
GTATCTTATTCAATATCGAAACAGACGGAGAACCATTTTTATGCCTGTTTTGTCAAATCCAAGGAAATGATTCCT
CCGTTTCACGACGTCGTCATCTGGATGCTCAAACGAGATCTTTTGATAACGCTCCACCTCCGAATTCGTGTCGTA
GCAACGCCTGATCTTAAACTTCGAGTTCAGATGCAGAAAGAAAGGGCACTTGCACGAAAGAAATCCCATTCTCGA
GGTAGACGCAGGAGTTTTCGTGTCCTCAAAGATGATTTGGATCCGCAAGAATTGGGACTTAGAGGATTTTCAAAT
CCTGGAGTTTCATGGCTTTCGTTGTCGCCGAAATCATCATCTGCTCAACGGTTACCGTCTATGGATTCGGCGTGT
AGTGAGATAAGTGAATTGGCGGTTGAGGATGAAGAGGATGAGTATGCGTATGAAGGGTATCGAGGTTTGGATAGT
GATTGGAATGAGGATATGAATGATTTTGGTTTGGATGGGGATGGGGATATGAATAGTTCGAGTATTATTCATGAT
CCTGCTCGAGCGACGGCTTTGCAGAAGAAGTGGTTGTCGGCGATGTCGGATGGGAAGGATCCTTCTGTGGCGAAA
CGTTTCGAACAGATAAACCAGTATTTCGATGGAAAACGGTCGGGAGATGAAATTTTATACAGGGCTGAAATCTCG
AGAAGACAATTGAGAGAGACTTTACATCATTATGAAGAATATCTACAAACGTTCCTTCATCCATCATGA
Gene >Agabi119p4|081150
ATGGCAGAGTCCCTCTTGGCTATCCTGCTCGTCACCAAGTCTGCCAAAGGTCCAGCTCTAGTCTACCGATGGCCA
CCACTTCCCACCGGCCACCCCAGGCTTAGCCGATCCCGGCCAGACGATGGTTCATGGCCATCGAGAATAGACAAT
CCCTGGTGCGCTTCTCATGCACCGGAGGTACTACTAGGTCACGCTTTTGCTCCCAACGACCAGTCCTGGGTCGAT
GATCCCGAATACCGTTGGCAAAGACCCGTACGTGCAAGATCGCCGTCCAACCAAAACAACTCCTCATCTCATTCG
CCTGTGGATGGCTCATTTTCTCCACCTGATCCTGCACCAAAACCCGGTGAATTCCATGAATATAGCCACGCTTTT
GGATACGAGGTCGACTTCCTTGCAGGTTTACTTTTGCCACATCCATCGACGTGTCACCAAAAGTTTGAGCTGTTG
GTAGATGATTTGGCTTTTGTGGGGCACCCGGTCTGTGTTAATTGGGAAGGCAAATGGGAGTTCAAAGAAGACAAG
ATGGAGAAAGAGTTGCGGGGAAAGGAATCAGGCATTATGTCATTATCGTTGAAGGATATGCCGGGGGGTATTTCG
ACTACTACAGATGGACAAACCGGAGTGGATCATTTGCAGATTTTCCATGTCGTTCTCGTTTGCGATATTCCTGAC
CCTTCGTCCTCGGACTCTGGAAACCTCTTCAAGTATTTTGACATCATTTATGAACAAATTGCGTTTACTTTGACG
GCGGTTTTATTCCAAGAGCAAGTGCTGCATAAATATGTGCAGGAGGAATGCGACAAGTTGGGTGCCCTCCGGGAC
TTGTCGTTGTCAGACAGTTGGTTAAATCTATTTGTTTCGGCAATGTTGATATACTCAAAGTCGTCCTAGGAGAAC
CATATGACGTTTTTGCCACTCGGTGCCTCGAAGTGTCATCAATGGCCACTACCATTAAAGATCTTTATGAAGCCA
TCAAAACTTCTCGAATAGCTCGGCTCAGAATCAACAATTTCCCTCTCGAATTACAATTACCTCCACACCTTGATA
CTCTACTTCATAACGAGGATGAAACAGAGATGAACTATTTCAATCCATCTGAGGAAGATGATTCCCCCGGCTGGG
GTGCAGAAATGAGTTTTGGTTGGCATTTACCGCCATTAGCACCTTGGAAGACTTTGCTTTTGTTAGATGAACCAA
TGCGAGGCGAAGATGGTGATGCTTTGCTTGACCTCAAGGGACCTTTTCCCAGCACTGAGGACCGCTGTATTGCGG
AAGGCTTGGTCAAGTTTCTAGAAACGGTAACCGTGACCCTCTCGTAAGTCAGCCTTTACCTTTTTGTCATTACCG
AAATATCTCATTTTTTATATCTTAGGTTGGCAGACGTAGCGAATTTACTTGATTGGGACCTTGAGGGACAAATTT
ACCCGATTGTGCGCTGGCTCGTGTACAGTCGACGAGCGAAAATAATTGACACGATCCATCCTGGACTGAAGAATG
TGTTCACTGTGCCCTCAAAGTTTGACGTCCCGTAAGTTTATTTTTCGAACACATTTCGACGCTCTGTTAACCCAC
TCCCCGCTCGCAGGCTTTCAGATCTCACAACCGAATTCGCCCAGATATTCAATCACCCTGCTATACCTCCCTTGC
CAAGAATACTGTCCTTGGTATCTTATTCAATATCGAAACAGACGGAGAACCATTTTTATGCCTGTTTTGTCAAAT
CCAAGGAAATGATTCCTCCGTTTCACGACGTCGTCATCTGGATGCTCAAACGAGATCTTTTGATAACGCTCCACC
TCCGAATTCGTGTCGTAGCAACGCCTGATCTTAAACTTCGAGTTCAGATGCAGAAAGAAAGGGCACTTGCACGAA
AGAAATCCCATTCTCGAGGTAGACGCAGGAGTTTTCGTGTCCTCAAAGATGATTTGGATCCGCAAGAATTGGGAC
TTAGAGGATTTTCAAATCCTGGAGTTTCATGGCTTTCGTTGTCGCCGAAATCATCATCTGCTCAACGGTTACCGT
CTATGGATTCGGCGTGTAGTGAGATAAGTGAATTGGCGGTTGAGGATGAAGAGGATGAGTATGCGTATGAAGGGT
ATCGAGGTTTGGATAGTGATTGGAATGAGGATATGAATGATTTTGGTTTGGATGGGGATGGGGATATGAATAGTT
CGAGTATTATTCATGATCCTGCTCGAGCGACGGCTTTGCAGAAGAAGTGGTTGTCGGCGATGTCGGATGGGAAGG
ATCCTTCTGTGGCGAAACGTTTCGAACAGTATGTTGCATTTTTTTCTCTGGTATAAATGATAATATCTGACTCGA
AACAAATAGGATAAACCAGTATTTCGATGGAAAACGGTCGGGAGATGAAATTTTATACAGGGCTGAAATCTCGAG
AAGACAATTGAGAGAGACTTTACATCATTATGAAGAATATGTGAGTTGTTATCTTTGACTTCGTTCACTACTGTC
CTCACTGACGATGGATGAACAGCTACAAACGTTCCTTCATCCATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail