Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|081110
Gene name
Locationscaffold_05a:817328..817739
Strand-
Gene length (bp)411
Transcript length (bp)291
Coding sequence length (bp)291
Protein length (aa) 97

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05160 DSS1_SEM1 DSS1/SEM1 family 1.2E-23 12 82

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SA04|SEM1_NEUCR Putative 26S proteasome complex subunit sem-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sem-1 PE=3 SV=1 6 87 2.0E-07
sp|O94742|SEM1_YEAST 26S proteasome complex subunit SEM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEM1 PE=1 SV=1 19 85 1.0E-06
sp|O14140|DSS1_SCHPO mRNA export factor dss1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dss1 PE=1 SV=1 10 82 2.0E-06
sp|P60897|DSS1_MOUSE 26S proteasome complex subunit DSS1 OS=Mus musculus GN=Shfm1 PE=3 SV=1 58 90 3.0E-06
sp|P60896|DSS1_HUMAN 26S proteasome complex subunit DSS1 OS=Homo sapiens GN=SHFM1 PE=1 SV=1 58 90 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SA04|SEM1_NEUCR Putative 26S proteasome complex subunit sem-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sem-1 PE=3 SV=1 6 87 2.0E-07
sp|O94742|SEM1_YEAST 26S proteasome complex subunit SEM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEM1 PE=1 SV=1 19 85 1.0E-06
sp|O14140|DSS1_SCHPO mRNA export factor dss1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dss1 PE=1 SV=1 10 82 2.0E-06
sp|P60897|DSS1_MOUSE 26S proteasome complex subunit DSS1 OS=Mus musculus GN=Shfm1 PE=3 SV=1 58 90 3.0E-06
sp|P60896|DSS1_HUMAN 26S proteasome complex subunit DSS1 OS=Homo sapiens GN=SHFM1 PE=1 SV=1 58 90 3.0E-06
sp|Q3ZBR6|DSS1_BOVIN 26S proteasome complex subunit DSS1 OS=Bos taurus GN=SHFM1 PE=3 SV=1 58 90 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043248 proteasome assembly Yes
GO:0008541 proteasome regulatory particle, lid subcomplex Yes
GO:0006406 mRNA export from nucleus Yes
GO:0065003 protein-containing complex assembly No
GO:0051179 localization No
GO:0022607 cellular component assembly No
GO:0051641 cellular localization No
GO:0032991 protein-containing complex No
GO:0051236 establishment of RNA localization No
GO:0071705 nitrogen compound transport No
GO:0071840 cellular component organization or biogenesis No
GO:0051028 mRNA transport No
GO:0006913 nucleocytoplasmic transport No
GO:0046907 intracellular transport No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0050658 RNA transport No
GO:0051649 establishment of localization in cell No
GO:0071702 organic substance transport No
GO:0015931 nucleobase-containing compound transport No
GO:0006405 RNA export from nucleus No
GO:0051234 establishment of localization No
GO:0051168 nuclear export No
GO:0043933 protein-containing complex organization No
GO:0051169 nuclear transport No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0050657 nucleic acid transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|081110
MSASDSKEQKAENPTLSVLEEDDEFEEFAVADWDDSQTDLAHLGGAAPGAAKSGGDKLWEDNWDDDDVEEDFSIQ
LRSELEKTKKAKEATGESMQT*
Coding >Agabi119p4|081110
ATGTCCGCTTCAGATTCAAAGGAACAGAAAGCAGAGAACCCTACTCTCAGTGTTTTAGAAGAGGATGATGAATTT
GAAGAGTTCGCAGTCGCAGACTGGGATGATTCACAAACAGACTTAGCACACCTTGGAGGTGCTGCACCAGGAGCA
GCTAAATCAGGTGGAGATAAGTTATGGGAAGATAATTGGGATGATGATGATGTTGAAGAAGATTTCAGTATACAA
CTTCGAAGTGAACTGGAGAAGACTAAAAAAGCGAAGGAAGCCACTGGCGAAAGTATGCAAACTTGA
Transcript >Agabi119p4|081110
ATGTCCGCTTCAGATTCAAAGGAACAGAAAGCAGAGAACCCTACTCTCAGTGTTTTAGAAGAGGATGATGAATTT
GAAGAGTTCGCAGTCGCAGACTGGGATGATTCACAAACAGACTTAGCACACCTTGGAGGTGCTGCACCAGGAGCA
GCTAAATCAGGTGGAGATAAGTTATGGGAAGATAATTGGGATGATGATGATGTTGAAGAAGATTTCAGTATACAA
CTTCGAAGTGAACTGGAGAAGACTAAAAAAGCGAAGGAAGCCACTGGCGAAAGTATGCAAACTTGA
Gene >Agabi119p4|081110
ATGTCCGCTTCAGATTCAAAGGAACAGAAAGCAGAGAACCCTACTCTCAGTGTTTTAGAAGAGGATGATGAATTT
GAAGAGTTCGCAGTCGCAGGTGAACACGAGTGAATCCGCGACCTTAAAGACGCTTAAGCTAATACTTTTTGCTCC
ATAGACTGGGATGATTCACAAACAGACTTAGCACACCTTGGAGGTGCTGCACCAGGAGCAGCTAAATCAGGTGGA
GATAAGTTATGGGAAGATAATTGGGATGATGATGATGTTGAAGAAGATTTCAGTATACAACTTCGGTGCGTCTTC
AACATCTTCCATTCGCTTGTGCGCGCGATTAACCGATCATCTTGTTGCAGAAGTGAACTGGAGAAGACTAAAAAA
GCGAAGGAAGCCACTGGCGAAAGTATGCAAACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail