Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|080890
Gene name
Locationscaffold_05a:757231..760508
Strand+
Gene length (bp)3277
Transcript length (bp)2586
Coding sequence length (bp)2586
Protein length (aa) 862

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02854 MIF4G MIF4G domain 1.3E-27 302 517
PF02847 MA3 MA3 domain 1.5E-21 620 703

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13971|SGD1_SCHPO Suppressor of glycerol defect protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgd1 PE=3 SV=1 1 769 3.0E-105
sp|Q5C9Z4|NOM1_HUMAN Nucleolar MIF4G domain-containing protein 1 OS=Homo sapiens GN=NOM1 PE=1 SV=1 279 773 3.0E-93
sp|Q3UFM5|NOM1_MOUSE Nucleolar MIF4G domain-containing protein 1 OS=Mus musculus GN=Nom1 PE=1 SV=2 45 781 7.0E-90
sp|Q06132|SGD1_YEAST Suppressor of glycerol defect protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGD1 PE=1 SV=1 5 826 2.0E-78
sp|Q9W020|NOM1_DROME Nucleolar MIF4G domain-containing protein 1 homolog OS=Drosophila melanogaster GN=CG9004 PE=2 SV=1 223 780 7.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13971|SGD1_SCHPO Suppressor of glycerol defect protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgd1 PE=3 SV=1 1 769 3.0E-105
sp|Q5C9Z4|NOM1_HUMAN Nucleolar MIF4G domain-containing protein 1 OS=Homo sapiens GN=NOM1 PE=1 SV=1 279 773 3.0E-93
sp|Q3UFM5|NOM1_MOUSE Nucleolar MIF4G domain-containing protein 1 OS=Mus musculus GN=Nom1 PE=1 SV=2 45 781 7.0E-90
sp|Q06132|SGD1_YEAST Suppressor of glycerol defect protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGD1 PE=1 SV=1 5 826 2.0E-78
sp|Q9W020|NOM1_DROME Nucleolar MIF4G domain-containing protein 1 homolog OS=Drosophila melanogaster GN=CG9004 PE=2 SV=1 223 780 7.0E-74
sp|Q9P6R9|CWC22_SCHPO Pre-mRNA-splicing factor cwf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf22 PE=1 SV=3 280 759 3.0E-14
sp|Q17336|CWC22_CAEEL Pre-mRNA-splicing factor CWC22 homolog OS=Caenorhabditis elegans GN=let-858 PE=2 SV=1 280 759 4.0E-13
sp|A8WT19|CWC22_CAEBR Pre-mRNA-splicing factor CWC22 homolog OS=Caenorhabditis briggsae GN=let-858 PE=3 SV=2 280 759 2.0E-11
sp|Q52KN9|CWC22_XENLA Pre-mRNA-splicing factor CWC22 homolog OS=Xenopus laevis GN=cwc22 PE=2 SV=1 280 759 1.0E-10
sp|P0CM97|CWC22_CRYNB Pre-mRNA-splicing factor CWC22 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC22 PE=3 SV=1 420 756 2.0E-10
sp|P0CM96|CWC22_CRYNJ Pre-mRNA-splicing factor CWC22 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC22 PE=3 SV=1 420 756 2.0E-10
sp|Q9VJ87|CWC22_DROME Pre-mRNA-splicing factor CWC22 homolog OS=Drosophila melanogaster GN=ncm PE=1 SV=3 280 756 3.0E-10
sp|Q8C5N3|CWC22_MOUSE Pre-mRNA-splicing factor CWC22 homolog OS=Mus musculus GN=Cwc22 PE=1 SV=1 244 759 3.0E-09
sp|Q4WKB9|CWC22_ASPFU Pre-mRNA-splicing factor cwc22 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc22 PE=3 SV=1 420 756 2.0E-08
sp|Q08C72|CWC22_DANRE Pre-mRNA-splicing factor CWC22 homolog OS=Danio rerio GN=cwc22 PE=2 SV=1 280 756 3.0E-08
sp|Q9HCG8|CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog OS=Homo sapiens GN=CWC22 PE=1 SV=3 258 759 9.0E-08
sp|Q4PCY0|CWC22_USTMA Pre-mRNA-splicing factor CWC22 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC22 PE=3 SV=2 300 756 1.0E-07
sp|Q5RA93|CWC22_PONAB Pre-mRNA-splicing factor CWC22 homolog OS=Pongo abelii GN=CWC22 PE=2 SV=1 266 759 5.0E-07
sp|Q52B63|CWC22_MAGO7 Pre-mRNA-splicing factor CWC22 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CWC22 PE=3 SV=1 420 756 7.0E-07
sp|Q5BGP1|CWC22_EMENI Pre-mRNA-splicing factor cwc22 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc22 PE=3 SV=2 617 756 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|080890
MNRYKKHSTTRLPSSLLEEIQAKDDGQNEYNKGSSTKKFRVRSSSRKEARKQGRTEQKVKRAQFFSTRKRHAEDG
DLPGSPQQKRARTNDEPRLGQNLEKQVEKAPNDSHRKTNSQDTRKNEDSLREIHQKDHRAAEKRREKNTRAIVPS
RSQAEEREDVYISLLEKKLGYTRTSRKKKNILENDGLDDLLDWAYSLNFPTTTGDAEEEDEDGDVSEDEVNEDNS
SQDSEDSEEEEEEEWTGIPSPHDTGSDKAEGEADAQVEDDSRPAAPEPSAAVTRYIPPHLRKSQNEQDSEAITRL
KKQLKGLLNRMSEQNLASIIDSVEDLYRDNRRHDVTSCITDLVIQGISSHSVLLDSYVVLHAALISSLHKLIGVE
FAAYFVQNVVTNYEHHHSVLQTPDMSEPVISDTPDENQETKGKECSNLMVLLSELYNFQVISSVLVFDLIRQLLN
NTLHEFDVELLLKLMRNSGQQLRHDDPAALKDIIEIVQKKVAGKDDQDLSSRTRFIIETLINLKNNKLKRNASQN
QGGEAVERMKRFLANLSKRKHVLAHDALRVSLEDLHSAESKGKWWLVGAAWGGNPLVEAHDAIANTQVNGQAAPT
TDPANDLLKLARKQGMNTDIRRSIFVVLMSSDDYVDACERLSQLNLTELQQREIVRVLLHCCGNEKTYNPYYVLV
CQHLCRQSHSYRITLQFCLWDFLRDLGEVTVGGVETVKNVRDDGTGFDLKKISNSRMRNVAKAYAWWIAKDTVNL
SILKAVDFTILKPQGRHFLRELLLHVFISSQTVTPLIDAKQLEETRNRSGIEEIFTRAARMENLAMGLVFFMSSA
FSQESLEDERLTKFIKWANKIALDTLRTGVDVIPML*
Coding >Agabi119p4|080890
ATGAATAGGTACAAGAAACACTCCACGACCCGACTGCCTTCTAGCCTGCTGGAAGAGATTCAAGCGAAAGACGAC
GGACAAAATGAATATAACAAAGGCTCTTCGACAAAAAAATTTCGAGTGCGAAGTTCGAGCAGGAAGGAAGCTCGA
AAACAAGGCCGCACAGAACAGAAAGTAAAGAGGGCACAGTTCTTCTCTACCAGAAAACGGCATGCCGAGGATGGC
GATCTTCCGGGCTCACCTCAGCAAAAACGGGCTCGGACGAATGACGAGCCCAGACTCGGACAGAACTTGGAGAAA
CAAGTTGAAAAAGCTCCGAATGATTCTCATCGGAAAACGAATTCGCAGGACACGCGCAAGAATGAAGATAGTCTA
CGCGAAATACATCAAAAGGACCACAGGGCAGCGGAAAAGAGAAGAGAGAAGAATACTCGCGCCATAGTCCCATCC
CGGAGTCAAGCAGAAGAAAGAGAGGATGTATATATCTCACTACTAGAAAAGAAGCTTGGCTATACACGGACCTCG
AGGAAAAAGAAAAATATACTTGAAAATGATGGACTGGACGATCTACTGGACTGGGCCTATTCCTTGAATTTTCCG
ACCACGACCGGTGACGCGGAGGAGGAAGACGAAGATGGAGACGTCAGTGAGGATGAAGTCAATGAGGACAACAGC
TCGCAGGATTCAGAAGACTCGGAAGAGGAAGAGGAAGAAGAGTGGACCGGGATTCCGTCTCCCCATGATACTGGA
TCCGACAAGGCTGAGGGCGAAGCAGATGCCCAGGTCGAGGATGATTCGCGGCCCGCAGCCCCAGAACCTTCAGCT
GCAGTTACTCGTTACATACCACCACACCTTCGAAAGTCCCAAAATGAACAAGATTCGGAGGCCATTACGAGGCTC
AAAAAGCAACTGAAGGGTCTACTCAATCGAATGAGCGAGCAAAATCTCGCTTCAATCATAGACAGCGTCGAAGAT
TTATACCGCGATAATCGCAGACATGACGTGACATCGTGTATAACCGACCTCGTCATTCAGGGCATATCCTCCCAT
TCGGTATTACTGGACTCATATGTGGTCCTTCATGCCGCTCTCATCTCAAGCTTACACAAATTGATTGGGGTAGAA
TTCGCGGCTTATTTTGTGCAAAACGTCGTAACAAACTACGAGCACCACCACTCTGTTCTTCAAACACCTGATATG
AGTGAGCCCGTTATCAGCGACACCCCTGATGAAAACCAAGAGACAAAGGGCAAAGAGTGCTCAAATCTGATGGTA
TTGTTATCTGAGTTATACAATTTTCAAGTCATATCATCGGTCCTTGTGTTCGATCTTATTCGGCAACTTCTCAAC
AACACTCTCCACGAGTTCGATGTTGAGCTGTTGCTCAAACTTATGCGGAACTCCGGTCAGCAGTTGCGGCATGAT
GATCCAGCGGCACTGAAGGATATCATCGAAATCGTTCAAAAGAAGGTCGCGGGGAAGGACGACCAAGATTTGAGT
TCTCGTACACGTTTCATAATAGAAACACTCATCAATCTCAAAAACAATAAGCTCAAGCGAAACGCATCGCAGAAC
CAAGGAGGGGAAGCTGTTGAGCGAATGAAAAGATTCTTGGCTAATCTGTCCAAACGAAAACATGTATTAGCGCAT
GATGCCCTTCGTGTCTCACTCGAAGACCTCCACTCCGCTGAAAGTAAAGGGAAGTGGTGGCTCGTTGGTGCCGCA
TGGGGAGGAAATCCGTTGGTCGAGGCTCATGACGCCATAGCAAATACGCAAGTCAACGGACAGGCTGCGCCCACA
ACTGACCCTGCGAATGACCTATTGAAATTAGCTCGGAAACAGGGAATGAATACGGATATCCGTAGAAGTATATTC
GTTGTTTTGATGAGTAGTGACGATTACGTCGATGCTTGCGAACGACTTTCACAATTGAACTTGACTGAACTACAA
CAACGGGAAATTGTGCGGGTGCTGCTCCACTGTTGCGGAAATGAAAAGACGTACAATCCATACTACGTTTTAGTC
TGCCAACATCTGTGTCGACAGTCGCATTCGTACAGGATCACGCTACAGTTCTGCCTTTGGGATTTCCTGCGAGAC
TTGGGCGAGGTTACTGTTGGCGGAGTAGAGACAGTCAAGAATGTGCGGGATGATGGGACTGGATTCGACCTGAAG
AAGATATCGAATTCGCGGATGCGCAATGTGGCCAAGGCGTACGCTTGGTGGATTGCAAAAGATACTGTGAATCTC
AGTATTCTTAAAGCCGTCGACTTCACCATTCTCAAACCTCAAGGTCGACATTTTCTTCGAGAGCTACTACTGCAC
GTTTTTATCAGTAGCCAGACCGTAACACCACTCATAGACGCCAAACAACTAGAGGAGACGCGGAATAGATCCGGT
ATCGAAGAAATCTTCACGAGAGCTGCGCGGATGGAGAACCTCGCGATGGGCCTGGTCTTTTTCATGTCGAGTGCC
TTTTCTCAGGAGTCGCTTGAAGATGAGAGACTAACCAAGTTTATCAAGTGGGCCAATAAAATAGCGTTGGATACA
TTACGGACTGGCGTAGATGTTATCCCGATGCTGTGA
Transcript >Agabi119p4|080890
ATGAATAGGTACAAGAAACACTCCACGACCCGACTGCCTTCTAGCCTGCTGGAAGAGATTCAAGCGAAAGACGAC
GGACAAAATGAATATAACAAAGGCTCTTCGACAAAAAAATTTCGAGTGCGAAGTTCGAGCAGGAAGGAAGCTCGA
AAACAAGGCCGCACAGAACAGAAAGTAAAGAGGGCACAGTTCTTCTCTACCAGAAAACGGCATGCCGAGGATGGC
GATCTTCCGGGCTCACCTCAGCAAAAACGGGCTCGGACGAATGACGAGCCCAGACTCGGACAGAACTTGGAGAAA
CAAGTTGAAAAAGCTCCGAATGATTCTCATCGGAAAACGAATTCGCAGGACACGCGCAAGAATGAAGATAGTCTA
CGCGAAATACATCAAAAGGACCACAGGGCAGCGGAAAAGAGAAGAGAGAAGAATACTCGCGCCATAGTCCCATCC
CGGAGTCAAGCAGAAGAAAGAGAGGATGTATATATCTCACTACTAGAAAAGAAGCTTGGCTATACACGGACCTCG
AGGAAAAAGAAAAATATACTTGAAAATGATGGACTGGACGATCTACTGGACTGGGCCTATTCCTTGAATTTTCCG
ACCACGACCGGTGACGCGGAGGAGGAAGACGAAGATGGAGACGTCAGTGAGGATGAAGTCAATGAGGACAACAGC
TCGCAGGATTCAGAAGACTCGGAAGAGGAAGAGGAAGAAGAGTGGACCGGGATTCCGTCTCCCCATGATACTGGA
TCCGACAAGGCTGAGGGCGAAGCAGATGCCCAGGTCGAGGATGATTCGCGGCCCGCAGCCCCAGAACCTTCAGCT
GCAGTTACTCGTTACATACCACCACACCTTCGAAAGTCCCAAAATGAACAAGATTCGGAGGCCATTACGAGGCTC
AAAAAGCAACTGAAGGGTCTACTCAATCGAATGAGCGAGCAAAATCTCGCTTCAATCATAGACAGCGTCGAAGAT
TTATACCGCGATAATCGCAGACATGACGTGACATCGTGTATAACCGACCTCGTCATTCAGGGCATATCCTCCCAT
TCGGTATTACTGGACTCATATGTGGTCCTTCATGCCGCTCTCATCTCAAGCTTACACAAATTGATTGGGGTAGAA
TTCGCGGCTTATTTTGTGCAAAACGTCGTAACAAACTACGAGCACCACCACTCTGTTCTTCAAACACCTGATATG
AGTGAGCCCGTTATCAGCGACACCCCTGATGAAAACCAAGAGACAAAGGGCAAAGAGTGCTCAAATCTGATGGTA
TTGTTATCTGAGTTATACAATTTTCAAGTCATATCATCGGTCCTTGTGTTCGATCTTATTCGGCAACTTCTCAAC
AACACTCTCCACGAGTTCGATGTTGAGCTGTTGCTCAAACTTATGCGGAACTCCGGTCAGCAGTTGCGGCATGAT
GATCCAGCGGCACTGAAGGATATCATCGAAATCGTTCAAAAGAAGGTCGCGGGGAAGGACGACCAAGATTTGAGT
TCTCGTACACGTTTCATAATAGAAACACTCATCAATCTCAAAAACAATAAGCTCAAGCGAAACGCATCGCAGAAC
CAAGGAGGGGAAGCTGTTGAGCGAATGAAAAGATTCTTGGCTAATCTGTCCAAACGAAAACATGTATTAGCGCAT
GATGCCCTTCGTGTCTCACTCGAAGACCTCCACTCCGCTGAAAGTAAAGGGAAGTGGTGGCTCGTTGGTGCCGCA
TGGGGAGGAAATCCGTTGGTCGAGGCTCATGACGCCATAGCAAATACGCAAGTCAACGGACAGGCTGCGCCCACA
ACTGACCCTGCGAATGACCTATTGAAATTAGCTCGGAAACAGGGAATGAATACGGATATCCGTAGAAGTATATTC
GTTGTTTTGATGAGTAGTGACGATTACGTCGATGCTTGCGAACGACTTTCACAATTGAACTTGACTGAACTACAA
CAACGGGAAATTGTGCGGGTGCTGCTCCACTGTTGCGGAAATGAAAAGACGTACAATCCATACTACGTTTTAGTC
TGCCAACATCTGTGTCGACAGTCGCATTCGTACAGGATCACGCTACAGTTCTGCCTTTGGGATTTCCTGCGAGAC
TTGGGCGAGGTTACTGTTGGCGGAGTAGAGACAGTCAAGAATGTGCGGGATGATGGGACTGGATTCGACCTGAAG
AAGATATCGAATTCGCGGATGCGCAATGTGGCCAAGGCGTACGCTTGGTGGATTGCAAAAGATACTGTGAATCTC
AGTATTCTTAAAGCCGTCGACTTCACCATTCTCAAACCTCAAGGTCGACATTTTCTTCGAGAGCTACTACTGCAC
GTTTTTATCAGTAGCCAGACCGTAACACCACTCATAGACGCCAAACAACTAGAGGAGACGCGGAATAGATCCGGT
ATCGAAGAAATCTTCACGAGAGCTGCGCGGATGGAGAACCTCGCGATGGGCCTGGTCTTTTTCATGTCGAGTGCC
TTTTCTCAGGAGTCGCTTGAAGATGAGAGACTAACCAAGTTTATCAAGTGGGCCAATAAAATAGCGTTGGATACA
TTACGGACTGGCGTAGATGTTATCCCGATGCTGTGA
Gene >Agabi119p4|080890
ATGAATAGGTACAAGAAACACTCCACGACCCGACTGCCTTCTAGCCTGCTGGAAGAGATTCAAGCGAAAGACGAC
GGTTTGCTCGGCTTTCTTTCATCATTCGAACCTTAATCTAATTCTACATCAGGACAAAATGAATATAACAAAGGC
TCTTCGACAAAAAAATTTCGAGTGCGAAGTTCGAGCAGGAAGGAAGCTCGAAAACAAGGCCGCACAGAACAGAAA
GTAAAGAGGGCACAGTTCTTCTCTACCAGAAAACGGCATGCCGAGGATGGCGATCTTCCGGGCTCACCTCAGCAA
AAACGGGCTCGGACGAATGACGAGCCCAGACTCGGACAGAACTTGGAGAAACAAGTTGAAAAAGCTCCGAATGAT
TCTCATCGGAAAACGAATTCGCAGGACACGCGCAAGAATGAAGATAGTCTACGCGAAATACATCAAAAGGACCAC
AGGGCAGCGGAAAAGAGAAGAGAGAAGAATACTCGCGCCATAGTCCCATCCCGGAGTCAAGCAGAAGAAAGAGAG
GATGTATATATCTCACTACTAGAAAAGAAGCTTGGCTATACACGGACCTCGAGGAAAAAGAAAAATATACTTGAA
AATGATGGACTGGACGGTGAGTACTCCTTGCGTCTGCCTGTTCGGAATAGCCATTTTAATGTCTAATAGATCTAC
TGGACTGGGCCTATTCCTTGAATTTTCCGACCACGGTAAGCTTCACCCAATATTGTCGAGATTAGGATGTTGATA
GAGCTCGTCCAGACCGGTGACGCGGAGGAGGAAGACGAAGATGGAGACGTCAGTGAGGATGAAGTCAATGAGGAC
AACAGCTCGCAGGATTCAGAAGACTCGGAAGAGGAAGAGGAAGAAGAGTGGACCGGGATTCCGTCTCCCCATGAT
ACTGGATCCGACAAGGCTGAGGGCGAAGCAGATGCCCAGGTCGAGGATGATTCGCGGCCCGCAGCCCCAGAACCT
TCAGCTGCAGGCAAGTTACAACCCGTCCGCCCGTTATCATAATTGATAACCTGATATCCTTCCCCCCTCAGTTAC
TCGTTACATACCACCACACCTTCGAAAGTCCCAAAATGAACAAGATTCGGAGGCCATTACGAGGCTCAAAAAGCA
ACTGAAGGGTCTACTCAATCGGTGAGCGGCAATCACACGACCTATCCGCTTATACAAACTTGTCTTCTCAGAATG
AGCGAGCAAAATCTCGCTTCAATCATAGACAGCGTCGAAGATTTATACCGCGATAATCGCAGACATGGTATGCCT
TCTGTTATGGCTGATAAATGTTCTCATTCAAGTGGCGTTTTAGACGTGACATCGTGTATAACCGACCTCGTCATT
CAGGGCATATCCTCCCATTCGGTATTACTGGACTCATATGTGGTCCTTCATGCCGCTCTCATCTCAAGCTTACAC
AAATTGATTGGGGTAGAATTCGGCAAGACAAGTCCACCTACCCCTTGACTCTTCGACTGATCGAAGTTGTAGCGG
CTTATTTTGTGCAAAACGTCGTAACAAACTACGAGCACCACCACTCTGTTCTTCAAACACCTGATATGAGTGAGC
CCGTTATCAGCGACACCCCTGATGAAAACCAAGAGACAAAGGGCAAAGAGTGCTCAAATCTGATGGTATTGTTAT
CTGAGTTATACAATTTTCAAGTCATATCATCGGTCCTTGTGTTCGATCTTATTCGGCAACTTCTCAACAACACTC
TCCACGAGTTCGATGTTGAGCTGTTGCTCAAACTTATGCGGAGTGCGTGGGTGTGAACTACTAATAAATTGGGGT
TGCCACTCATACATGTGTCAGACTCCGGTCAGCAGTTGCGGCATGATGATCCAGCGGCACTGAAGGATATCATCG
AAATCGTTCAAAAGAAGGTCGCGGGGAAGGACGACCAAGATTTGAGGTATGTATGTATGTAAGGTCAAGCTCTAC
CCCTACCCTCAGCCCCTTCATTTATAGTTCTCGTACACGTTTCATAATAGAAACACTCATCAATCTCAAAAACAA
TAAGCTCAAGCGAAACGCATCGCAGAACCAAGGAGGGGAAGCTGTTGAGCGAATGAAAAGATTCTTGGCTAATCT
GTCCAAACGAAAACATGGTCAGTAGAAAACGACGTCATTGTCAGCCTTTATTATGCTCAAATGATTTTGAAAGTA
TTAGCGCATGATGCCCTTCGTGTCTCACTCGAAGACCTCCACTCCGCTGAAAGTAAAGGGAAGTGGTGGCTCGTT
GGTGCCGCATGGGGAGGAAATCCGTTGGTCGAGGCTCATGACGCCATAGCAAATACGCAAGTCAACGGACAGGCT
GCGCCCACAACTGACCCTGCGAATGACCTATTGAAATTAGCTCGGAAACAGGGAATGAATACGGATATCCGTAGA
AGTATATTCGTTGTTTTGATGAGTAGTGACGTGCGTTTAAACTTCGTCAATGGCAAGTATGGAGACTAATTTGAA
ACTTCAGGATTACGTCGATGCTTGCGAACGACTTTCACAATTGAACTTGACTGAACTACAACAACGGGAAATTGT
GCGGGTGCTGCTCCACTGTTGCGGAAATGTGCGGTTGTTATTCTTTTCGTCTGGTAGTCACTATGTTTACCCAAG
AATAGGAAAAGACGTACAATCCATACTACGTTTTAGTCTGCCAACATCTGTGTCGACAGTCGCATTCGTACAGGA
TCACGCTACAGTTCTGCCTTTGGGATTTCCTGCGAGACTTGGGCGAGGTTACTGTTGGCGGAGTAGAGACAGTCA
AGAATGTGCGGGATGATGGGACTGGATTCGACCTGAAGAAGATATCGAATTCGCGGATGCGCAATGTGGCCAAGG
CGTACGCTTGGTGGATTGCAAAAGATACTGTGAATCTCAGTATTCTTAAAGTATGACACGGCTATCTCGAGAAAT
ACTGAATGGCTAATAACATCGTCCACAGGCCGTCGACTTCACCATTCTCAAACCTCAAGGTCGACATTTTCTTCG
AGAGCTACTACTGCACGTTTTTATCAGTAGCCAGACCGTAACACCACTCATAGACGCCAAACAACTAGAGGAGAC
GCGGAATAGATCCGGTATCGAAGAAATCTTCACGAGAGCTGCGCGGATGGAGAACCTCGCGATGGGCCTGGTCTT
TTTCATGTCGAGTGCCTTTTCTCAGGAGTCGCTTGAAGATGAGAGACTAACCAAGTTTATCAAGTGGGCCAATAA
AATAGCGTTGGATACATTACGGACTGGCGTAGATGTTATCCCGATGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail