© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|080610 |
| Gene name | |
| Location | scaffold_05a:668217..670183 |
| Strand | - |
| Gene length (bp) | 1966 |
| Transcript length (bp) | 1659 |
| Coding sequence length (bp) | 1659 |
| Protein length (aa) | 553 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00067 | p450 | Cytochrome P450 | 1.0E-71 | 66 | 542 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P49602|CP51_USTMA | Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 | 52 | 540 | 0.0E+00 |
| sp|Q09736|CP51_SCHPO | Lanosterol 14-alpha demethylase erg11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg11 PE=1 SV=1 | 35 | 551 | 2.0E-163 |
| sp|P14263|CP51_CANTR | Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 | 38 | 551 | 2.0E-155 |
| sp|P10613|CP51_CANAL | Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 | 47 | 552 | 9.0E-155 |
| sp|O14442|CP51_UNCNE | Eburicol 14-alpha-demethylase OS=Uncinula necator GN=CYP51 PE=2 SV=2 | 25 | 551 | 8.0E-154 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P49602|CP51_USTMA | Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 | 52 | 540 | 0.0E+00 |
| sp|Q09736|CP51_SCHPO | Lanosterol 14-alpha demethylase erg11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg11 PE=1 SV=1 | 35 | 551 | 2.0E-163 |
| sp|P14263|CP51_CANTR | Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 | 38 | 551 | 2.0E-155 |
| sp|P10613|CP51_CANAL | Lanosterol 14-alpha demethylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG11 PE=3 SV=2 | 47 | 552 | 9.0E-155 |
| sp|O14442|CP51_UNCNE | Eburicol 14-alpha-demethylase OS=Uncinula necator GN=CYP51 PE=2 SV=2 | 25 | 551 | 8.0E-154 |
| sp|P50859|CP51_CANGA | Lanosterol 14-alpha demethylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG11 PE=3 SV=1 | 25 | 551 | 8.0E-154 |
| sp|P10614|CP51_YEAST | Lanosterol 14-alpha demethylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG11 PE=1 SV=1 | 53 | 551 | 1.0E-152 |
| sp|Q759W0|CP51_ASHGO | Lanosterol 14-alpha demethylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG11 PE=3 SV=1 | 29 | 551 | 3.0E-152 |
| sp|Q9UVC3|CP51_CUNEL | Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 | 44 | 552 | 8.0E-148 |
| sp|Q12664|CP51_PENIT | Eburicol 14-alpha-demethylase OS=Penicillium italicum GN=CYP51 PE=3 SV=1 | 43 | 551 | 1.0E-146 |
| sp|Q02315|CP51_PICKU | Lanosterol 14-alpha demethylase (Fragment) OS=Pichia kudriavzevii GN=CYP51 PE=3 SV=1 | 70 | 500 | 1.0E-126 |
| sp|Q64654|CP51A_RAT | Lanosterol 14-alpha demethylase OS=Rattus norvegicus GN=Cyp51a1 PE=2 SV=1 | 11 | 552 | 2.0E-106 |
| sp|O46420|CP51A_PIG | Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 | 60 | 552 | 2.0E-105 |
| sp|Q5RE72|CP51A_PONAB | Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 | 31 | 552 | 6.0E-105 |
| sp|Q8K0C4|CP51A_MOUSE | Lanosterol 14-alpha demethylase OS=Mus musculus GN=Cyp51a1 PE=1 SV=1 | 60 | 552 | 2.0E-104 |
| sp|Q4R8S6|CP51A_MACFA | Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 | 60 | 552 | 3.0E-104 |
| sp|Q16850|CP51A_HUMAN | Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 | 31 | 552 | 4.0E-104 |
| sp|Q4PJW3|CP51A_BOVIN | Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 | 60 | 552 | 3.0E-101 |
| sp|Q1ZXH9|CP51_DICDI | Probable lanosterol 14-alpha demethylase OS=Dictyostelium discoideum GN=cyp51 PE=3 SV=1 | 38 | 552 | 9.0E-85 |
| sp|Q9SAA9|CP511_ARATH | Sterol 14-demethylase OS=Arabidopsis thaliana GN=CYP51G1 PE=1 SV=1 | 43 | 552 | 1.0E-75 |
| sp|P93846|CP51_SORBI | Obtusifoliol 14-alpha demethylase OS=Sorghum bicolor GN=CYP51 PE=1 SV=1 | 38 | 552 | 2.0E-70 |
| sp|P93596|CP51_WHEAT | Obtusifoliol 14-alpha demethylase (Fragment) OS=Triticum aestivum GN=CYP51 PE=2 SV=1 | 63 | 552 | 9.0E-67 |
| sp|P9WPP9|CP51_MYCTU | Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp51 PE=1 SV=1 | 79 | 551 | 1.0E-60 |
| sp|P9WPP8|CP51_MYCTO | Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp51 PE=3 SV=1 | 79 | 551 | 1.0E-60 |
| sp|P0A513|CP51_MYCBO | Lanosterol 14-alpha demethylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp51 PE=3 SV=1 | 79 | 551 | 1.0E-60 |
| sp|Q5IZM4|CP51_MYCVP | Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 | 79 | 551 | 5.0E-58 |
| sp|Q7Z1V1|CP51_TRYCC | Sterol 14-alpha demethylase OS=Trypanosoma cruzi (strain CL Brener) GN=CYP51 PE=1 SV=1 | 59 | 552 | 7.0E-56 |
| sp|O35074|PTGIS_MOUSE | Prostacyclin synthase OS=Mus musculus GN=Ptgis PE=1 SV=1 | 62 | 525 | 3.0E-23 |
| sp|Q949P1|ABAH1_ARATH | Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 | 63 | 514 | 1.0E-22 |
| sp|Q9FH76|ABAH3_ARATH | Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 | 40 | 514 | 2.0E-22 |
| sp|Q0J185|ABAH3_ORYSJ | Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1 | 63 | 518 | 3.0E-22 |
| sp|A2Z212|ABAH3_ORYSI | Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1 | 63 | 518 | 3.0E-22 |
| sp|Q9LJK2|ABAH4_ARATH | Abscisic acid 8'-hydroxylase 4 OS=Arabidopsis thaliana GN=CYP707A4 PE=2 SV=2 | 40 | 521 | 9.0E-22 |
| sp|Q62969|PTGIS_RAT | Prostacyclin synthase OS=Rattus norvegicus GN=Ptgis PE=2 SV=1 | 62 | 551 | 2.0E-21 |
| sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 40 | 526 | 6.0E-21 |
| sp|Q9JKJ9|CP39A_MOUSE | 24-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus GN=Cyp39a1 PE=1 SV=1 | 42 | 551 | 7.0E-21 |
| sp|O23051|KAO1_ARATH | Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 | 63 | 543 | 8.0E-21 |
| sp|Q9PUB4|CP26A_CHICK | Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 | 70 | 525 | 1.0E-20 |
| sp|P51869|CP4F4_RAT | Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 | 268 | 537 | 1.0E-20 |
| sp|P78329|CP4F2_HUMAN | Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 | 263 | 532 | 4.0E-20 |
| sp|Q9VLZ7|C4D21_DROME | Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 | 251 | 523 | 7.0E-20 |
| sp|Q59990|CP120_SYNY3 | Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 | 70 | 545 | 8.0E-20 |
| sp|Q9HCS2|CP4FC_HUMAN | Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 | 263 | 532 | 2.0E-19 |
| sp|Q08477|CP4F3_HUMAN | Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 | 263 | 532 | 3.0E-19 |
| sp|B5BSX1|BAMO_GLYUR | Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 | 206 | 524 | 5.0E-19 |
| sp|P18125|CP7A1_RAT | Cholesterol 7-alpha-monooxygenase OS=Rattus norvegicus GN=Cyp7a1 PE=1 SV=1 | 33 | 524 | 6.0E-19 |
| sp|P98187|CP4F8_HUMAN | Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 | 263 | 531 | 1.0E-18 |
| sp|Q9SD85|F3PH_ARATH | Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 | 36 | 525 | 1.0E-18 |
| sp|Q9C5Y2|KAO2_ARATH | Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 | 168 | 524 | 2.0E-18 |
| sp|D5JBX1|GAO_BARSP | Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 | 36 | 502 | 2.0E-18 |
| sp|Q6ZDE3|ABAH2_ORYSJ | Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. japonica GN=CYP707A6 PE=2 SV=1 | 58 | 518 | 3.0E-18 |
| sp|Q9K498|EIZFM_STRCO | Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 | 62 | 518 | 4.0E-18 |
| sp|Q9NYL5|CP39A_HUMAN | 24-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP39A1 PE=2 SV=2 | 56 | 551 | 6.0E-18 |
| sp|O43174|CP26A_HUMAN | Cytochrome P450 26A1 OS=Homo sapiens GN=CYP26A1 PE=2 SV=2 | 71 | 525 | 7.0E-18 |
| sp|Q9HBI6|CP4FB_HUMAN | Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 | 272 | 532 | 8.0E-18 |
| sp|P22680|CP7A1_HUMAN | Cholesterol 7-alpha-monooxygenase OS=Homo sapiens GN=CYP7A1 PE=1 SV=2 | 36 | 525 | 9.0E-18 |
| sp|Q16647|PTGIS_HUMAN | Prostacyclin synthase OS=Homo sapiens GN=PTGIS PE=1 SV=1 | 58 | 525 | 2.0E-17 |
| sp|Q05JG2|ABAH1_ORYSJ | Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP707A5 PE=2 SV=1 | 63 | 510 | 2.0E-17 |
| sp|Q09J79|ABAH1_ORYSI | Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. indica GN=CYP707A5 PE=2 SV=1 | 63 | 510 | 2.0E-17 |
| sp|P79739|CP26A_DANRE | Cytochrome P450 26A1 OS=Danio rerio GN=cyp26a1 PE=2 SV=1 | 29 | 520 | 3.0E-17 |
| sp|O81077|ABAH2_ARATH | Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1 | 70 | 514 | 3.0E-17 |
| sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 70 | 523 | 3.0E-17 |
| sp|Q9EP75|CP4FE_MOUSE | Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 | 263 | 537 | 3.0E-17 |
| sp|Q12573|CP52W_CANAP | Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 | 262 | 506 | 3.0E-17 |
| sp|O55127|CP26A_MOUSE | Cytochrome P450 26A1 OS=Mus musculus GN=Cyp26a1 PE=2 SV=1 | 70 | 525 | 3.0E-17 |
| sp|Q64505|CP7A1_MOUSE | Cholesterol 7-alpha-monooxygenase OS=Mus musculus GN=Cyp7a1 PE=2 SV=2 | 33 | 525 | 4.0E-17 |
| sp|O65790|C81F1_ARATH | Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 | 35 | 517 | 4.0E-17 |
| sp|Q09J78|ABAH2_ORYSI | Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. indica GN=CYP707A6 PE=2 SV=1 | 58 | 518 | 5.0E-17 |
| sp|P51870|CP4F5_RAT | Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 | 263 | 537 | 5.0E-17 |
| sp|Q50EK0|C16B2_PICSI | Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1 | 63 | 525 | 6.0E-17 |
| sp|P33274|CP4F1_RAT | Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 | 263 | 537 | 7.0E-17 |
| sp|Q9T0K2|C71AK_ARATH | Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 | 142 | 531 | 7.0E-17 |
| sp|Q43255|C71C2_MAIZE | indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 | 206 | 522 | 8.0E-17 |
| sp|Q43147|C85A1_SOLLC | Cytochrome P450 85A1 OS=Solanum lycopersicum GN=CYP85A1 PE=2 SV=1 | 55 | 528 | 9.0E-17 |
| sp|D5JBW9|GAO_SAUCO | Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 | 36 | 532 | 1.0E-16 |
| sp|Q50EK1|C16B1_PICSI | Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 | 63 | 525 | 2.0E-16 |
| sp|P51871|CP4F6_RAT | Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 | 263 | 537 | 2.0E-16 |
| sp|P9WPM7|CP136_MYCTU | Putative cytochrome P450 136 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp136 PE=1 SV=1 | 58 | 513 | 2.0E-16 |
| sp|P9WPM6|CP136_MYCTO | Putative cytochrome P450 136 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp136 PE=3 SV=1 | 58 | 513 | 2.0E-16 |
| sp|Q6XQ14|C71E7_MANES | 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 | 70 | 541 | 3.0E-16 |
| sp|Q7KWN2|C525A_DICDI | Probable cytochrome P450 525A1 OS=Dictyostelium discoideum GN=cyp525A1 PE=3 SV=1 | 309 | 552 | 3.0E-16 |
| sp|P51542|CP7A1_RABIT | Cholesterol 7-alpha-monooxygenase OS=Oryctolagus cuniculus GN=CYP7A1 PE=1 SV=1 | 33 | 524 | 4.0E-16 |
| sp|Q69F95|C85A_PHAVU | Cytochrome P450 85A OS=Phaseolus vulgaris GN=BA13 PE=3 SV=2 | 36 | 528 | 4.0E-16 |
| sp|P24463|CP3AC_CANLF | Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 | 270 | 524 | 5.0E-16 |
| sp|Q8W4T9|T13H_TAXCU | Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=CYP725A2 PE=1 SV=1 | 43 | 519 | 5.0E-16 |
| sp|Q12586|CP52I_CANMA | Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 | 200 | 522 | 5.0E-16 |
| sp|P43083|CP52V_CANAP | Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 | 262 | 506 | 5.0E-16 |
| sp|D5JBX0|GAO_HELAN | Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 | 36 | 532 | 6.0E-16 |
| sp|O46054|C4AE1_DROME | Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 | 238 | 523 | 6.0E-16 |
| sp|Q9YH64|CP1A1_PLAFE | Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 | 36 | 531 | 6.0E-16 |
| sp|O46491|CP7A1_PIG | Cholesterol 7-alpha-monooxygenase OS=Sus scrofa GN=CYP7A1 PE=3 SV=1 | 33 | 525 | 6.0E-16 |
| sp|P46634|CP7A1_CRIGR | Cholesterol 7-alpha-monooxygenase OS=Cricetulus griseus GN=CYP7A1 PE=3 SV=1 | 33 | 525 | 8.0E-16 |
| sp|D5JBW8|GAO_CICIN | Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 | 36 | 532 | 1.0E-15 |
| sp|E1B2Z9|C7AV8_CICIN | Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 | 36 | 502 | 2.0E-15 |
| sp|Q60991|CP7B1_MOUSE | 25-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus GN=Cyp7b1 PE=2 SV=2 | 68 | 529 | 2.0E-15 |
| sp|Q29626|PTGIS_BOVIN | Prostacyclin synthase OS=Bos taurus GN=PTGIS PE=1 SV=1 | 62 | 525 | 2.0E-15 |
| sp|Q9AXM6|T10H_TAXCU | Taxane 10-beta-hydroxylase OS=Taxus cuspidata GN=CYP725A1 PE=1 SV=1 | 70 | 521 | 3.0E-15 |
| sp|Q9Y757|CP52L_DEBHN | Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 | 203 | 515 | 3.0E-15 |
| sp|Q92100|CP1A1_PLEPL | Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 | 70 | 531 | 3.0E-15 |
| sp|D5J9U8|GAO_LACSA | Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 | 36 | 532 | 3.0E-15 |
| sp|P10611|CP4A4_RABIT | Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 | 63 | 526 | 4.0E-15 |
| sp|I3V6B1|C80BX_PAPSO | (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 | 36 | 502 | 4.0E-15 |
| sp|Q3MID2|CP4F3_RAT | Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 | 268 | 537 | 5.0E-15 |
| sp|Q9SBQ9|F3PH_PETHY | Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 | 237 | 530 | 5.0E-15 |
| sp|Q99N16|CP4F3_MOUSE | Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 | 268 | 537 | 5.0E-15 |
| sp|Q6NT55|CP4FN_HUMAN | Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 | 294 | 527 | 5.0E-15 |
| sp|P58046|C71AF_ARATH | Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 | 142 | 526 | 5.0E-15 |
| sp|Q9XHC6|C93E1_SOYBN | Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 | 45 | 519 | 7.0E-15 |
| sp|F8S1I0|C7BL2_LACSA | Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 | 33 | 525 | 7.0E-15 |
| sp|H2DH22|C7A10_PANGI | Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 | 20 | 523 | 7.0E-15 |
| sp|P29980|CPXN_NOSS1 | Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 | 77 | 525 | 8.0E-15 |
| sp|O42457|CP1A1_SPAAU | Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1 | 36 | 531 | 8.0E-15 |
| sp|P14779|CPXB_BACME | Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 | 243 | 524 | 8.0E-15 |
| sp|P00185|CP1A1_RAT | Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 | 70 | 525 | 9.0E-15 |
| sp|Q9JMA7|CP341_MOUSE | Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 | 247 | 524 | 9.0E-15 |
| sp|P9WPM1|CP139_MYCTU | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 | 104 | 534 | 9.0E-15 |
| sp|P9WPM0|CP139_MYCTO | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 | 104 | 534 | 9.0E-15 |
| sp|P63720|CP139_MYCBO | Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 | 104 | 534 | 9.0E-15 |
| sp|Q12589|CP52K_CANMA | Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 | 200 | 522 | 1.0E-14 |
| sp|Q54DT2|C516A_DICDI | Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 | 70 | 518 | 1.0E-14 |
| sp|O88962|CP8B1_MOUSE | 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Mus musculus GN=Cyp8b1 PE=1 SV=1 | 33 | 525 | 2.0E-14 |
| sp|Q6R7M4|C15A1_DIPPU | Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 | 35 | 523 | 2.0E-14 |
| sp|O70537|CP3AV_MESAU | Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 | 253 | 524 | 2.0E-14 |
| sp|Q8VWZ7|C76B6_CATRO | Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 | 70 | 522 | 2.0E-14 |
| sp|O75881|CP7B1_HUMAN | 25-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP7B1 PE=1 SV=2 | 58 | 537 | 2.0E-14 |
| sp|O93323|CP26A_XENLA | Cytochrome P450 26A1 OS=Xenopus laevis GN=cyp26a1 PE=2 SV=1 | 70 | 525 | 3.0E-14 |
| sp|Q02318|CP27A_HUMAN | Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 | 309 | 519 | 3.0E-14 |
| sp|Q50EK6|C72B1_PINTA | Abietadienol/abietadienal oxidase OS=Pinus taeda GN=CYP720B1 PE=1 SV=1 | 63 | 518 | 3.0E-14 |
| sp|Q82IY3|PTLI_STRAW | Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 | 156 | 529 | 3.0E-14 |
| sp|P33270|CP6A2_DROME | Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 | 238 | 517 | 3.0E-14 |
| sp|O81970|C71A9_SOYBN | Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 | 70 | 506 | 3.0E-14 |
| sp|Q9V771|C6A23_DROME | Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 | 250 | 519 | 4.0E-14 |
| sp|P00184|CP1A1_MOUSE | Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 | 70 | 525 | 4.0E-14 |
| sp|P9WPM3|CP138_MYCTU | Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp138 PE=1 SV=1 | 64 | 524 | 4.0E-14 |
| sp|P9WPM2|CP138_MYCTO | Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp138 PE=3 SV=1 | 64 | 524 | 4.0E-14 |
| sp|P63718|CP138_MYCBO | Putative cytochrome P450 138 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp138 PE=3 SV=1 | 64 | 524 | 4.0E-14 |
| sp|O42563|CP3AR_ONCMY | Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 | 70 | 552 | 4.0E-14 |
| sp|O42430|CP1A1_LIMLI | Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 | 70 | 531 | 4.0E-14 |
| sp|G3GBK0|C7BL3_CICIN | Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 | 70 | 525 | 4.0E-14 |
| sp|Q92116|CP1A1_STECH | Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 | 70 | 531 | 4.0E-14 |
| sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 275 | 520 | 5.0E-14 |
| sp|Q42569|C90A1_ARATH | Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CYP90A1 PE=2 SV=1 | 70 | 514 | 5.0E-14 |
| sp|Q94IA6|C90D1_ARATH | 3-epi-6-deoxocathasterone 23-monooxygenase OS=Arabidopsis thaliana GN=CYP90D1 PE=2 SV=1 | 64 | 540 | 5.0E-14 |
| sp|Q04552|CP6B1_PAPPO | Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 | 230 | 509 | 5.0E-14 |
| sp|Q12581|CP52X_CANMA | Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 | 267 | 506 | 6.0E-14 |
| sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 275 | 520 | 6.0E-14 |
| sp|Q9V4U9|C6A13_DROME | Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 | 252 | 519 | 7.0E-14 |
| sp|P37122|C76A2_SOLME | Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 | 246 | 525 | 7.0E-14 |
| sp|P05176|CP1A1_RABIT | Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 | 71 | 525 | 7.0E-14 |
| sp|H2DH16|C7A47_PANGI | Dammarenediol 12-hydroxylase OS=Panax ginseng GN=PPDS PE=1 SV=2 | 59 | 508 | 7.0E-14 |
| sp|H1A988|C7254_GLYUR | 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 | 152 | 539 | 9.0E-14 |
| sp|Q7XU38|C87A3_ORYSJ | Cytochrome P450 87A3 OS=Oryza sativa subsp. japonica GN=CYP87A3 PE=2 SV=3 | 70 | 518 | 9.0E-14 |
| sp|O48923|C71DA_SOYBN | Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 | 142 | 525 | 1.0E-13 |
| sp|Q9VL92|CP4E3_DROME | Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 | 306 | 523 | 1.0E-13 |
| sp|P30609|CP52G_CANTR | Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 | 205 | 538 | 1.0E-13 |
| sp|O35132|CP27B_RAT | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 | 322 | 530 | 1.0E-13 |
| sp|Q6EIG3|CP26B_DANRE | Cytochrome P450 26B1 OS=Danio rerio GN=cyp26b1 PE=1 SV=1 | 39 | 510 | 2.0E-13 |
| sp|Q9LUC6|C7A14_ARATH | Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 | 126 | 539 | 2.0E-13 |
| sp|P48416|CP10_LYMST | Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 | 242 | 552 | 2.0E-13 |
| sp|P24462|CP3A7_HUMAN | Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 | 240 | 524 | 2.0E-13 |
| sp|Q9T0K0|C71AJ_ARATH | Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 | 142 | 531 | 2.0E-13 |
| sp|Q9V4T5|CP4E1_DROME | Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 | 29 | 545 | 2.0E-13 |
| sp|Q9Y8G7|C505_FUSOX | Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 | 270 | 547 | 2.0E-13 |
| sp|Q12588|CP52J_CANMA | Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 | 200 | 533 | 2.0E-13 |
| sp|Q50LE0|C85A3_SOLLC | Cytochrome P450 85A3 OS=Solanum lycopersicum GN=CYP85A3 PE=2 SV=1 | 57 | 518 | 3.0E-13 |
| sp|P16141|CP52D_CANMA | Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 | 11 | 506 | 3.0E-13 |
| sp|Q9W683|CP1A1_LIZSA | Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 | 70 | 531 | 3.0E-13 |
| sp|I7CT85|C7A53_PANGI | Protopanaxadiol 6-hydroxylase OS=Panax ginseng PE=1 SV=1 | 56 | 521 | 3.0E-13 |
| sp|Q9FI39|THAD_ARATH | Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 | 301 | 522 | 3.0E-13 |
| sp|P30608|CP52F_CANTR | Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 | 293 | 522 | 3.0E-13 |
| sp|Q8N118|CP4X1_HUMAN | Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 | 136 | 526 | 4.0E-13 |
| sp|Q4G0S4|C27C1_HUMAN | Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 | 310 | 524 | 4.0E-13 |
| sp|P24464|CP4AC_RAT | Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 | 154 | 526 | 4.0E-13 |
| sp|Q86W10|CP4Z1_HUMAN | Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 | 156 | 526 | 4.0E-13 |
| sp|P30607|CP52B_CANTR | Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 | 205 | 532 | 5.0E-13 |
| sp|Q64459|CP3AB_MOUSE | Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 | 247 | 524 | 5.0E-13 |
| sp|P58051|C71BE_ARATH | Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 | 262 | 517 | 5.0E-13 |
| sp|O42231|CP1A1_LIZAU | Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 | 70 | 531 | 5.0E-13 |
| sp|Q27902|CP6B4_PAPGL | Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 | 211 | 542 | 7.0E-13 |
| sp|O15528|CP27B_HUMAN | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 | 275 | 524 | 7.0E-13 |
| sp|P17178|CP27A_RAT | Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 | 310 | 523 | 7.0E-13 |
| sp|O88833|CP4AA_MOUSE | Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 | 1 | 526 | 8.0E-13 |
| sp|P24458|CP52E_CANMA | Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 | 107 | 529 | 8.0E-13 |
| sp|O46051|C4D14_DROME | Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 | 230 | 523 | 9.0E-13 |
| sp|Q5Z5S6|C7019_ORYSJ | Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 | 305 | 522 | 9.0E-13 |
| sp|Q9LMM1|C86A4_ARATH | Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 | 271 | 539 | 1.0E-12 |
| sp|Q947B7|MFS_MENPI | (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 | 271 | 517 | 1.0E-12 |
| sp|Q29496|CP3AO_SHEEP | Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 | 240 | 524 | 1.0E-12 |
| sp|O44221|CP4E5_DROMT | Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 | 222 | 545 | 1.0E-12 |
| sp|Q9PVE8|C330_FUNHE | Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 | 240 | 544 | 1.0E-12 |
| sp|Q8AXY5|C356_FUNHE | Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 | 70 | 544 | 1.0E-12 |
| sp|Q9W011|C4D20_DROME | Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 | 296 | 523 | 1.0E-12 |
| sp|P9WPM9|C135B_MYCTU | Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135B1 PE=1 SV=1 | 205 | 523 | 1.0E-12 |
| sp|P9WPM8|C135B_MYCTO | Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135B1 PE=3 SV=1 | 205 | 523 | 1.0E-12 |
| sp|P63716|C135B_MYCBO | Putative cytochrome P450 135B1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp135B1 PE=3 SV=1 | 205 | 523 | 1.0E-12 |
| sp|P93149|C93B1_GLYEC | Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 | 63 | 521 | 2.0E-12 |
| sp|Q9V770|C6A17_DROME | Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 | 252 | 519 | 2.0E-12 |
| sp|Q64148|CP3AA_MESAU | Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 | 276 | 543 | 2.0E-12 |
| sp|P11707|CP3A6_RABIT | Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 | 253 | 527 | 2.0E-12 |
| sp|Q9DBG1|CP27A_MOUSE | Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 | 270 | 525 | 2.0E-12 |
| sp|Q9V4U7|C6A14_DROME | Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 | 251 | 525 | 2.0E-12 |
| sp|Q8GSQ1|C85A1_ORYSJ | Cytochrome P450 85A1 OS=Oryza sativa subsp. japonica GN=CYP85A1 PE=1 SV=1 | 58 | 549 | 2.0E-12 |
| sp|Q9FVS9|C96AF_ARATH | Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 | 263 | 525 | 2.0E-12 |
| sp|Q9FG65|C81D1_ARATH | Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 | 32 | 517 | 2.0E-12 |
| sp|P08516|CP4AA_RAT | Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 | 54 | 526 | 2.0E-12 |
| sp|P14580|CP4A6_RABIT | Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 | 63 | 552 | 2.0E-12 |
| sp|C0SPF7|C15C1_BOMMO | Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 | 242 | 527 | 2.0E-12 |
| sp|O35084|CP27B_MOUSE | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 | 322 | 530 | 3.0E-12 |
| sp|O08336|CYPB_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 | 264 | 523 | 3.0E-12 |
| sp|Q9V7G5|C4AA1_DROME | Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 | 270 | 523 | 3.0E-12 |
| sp|Q64409|CP3AH_CAVPO | Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 | 274 | 543 | 3.0E-12 |
| sp|P17177|CP27A_RABIT | Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 | 309 | 525 | 3.0E-12 |
| sp|P16496|CP52C_CANMA | Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 | 107 | 529 | 3.0E-12 |
| sp|I7C6E8|C7A52_PANGI | Beta-amyrin 28-oxidase OS=Panax ginseng PE=2 SV=1 | 63 | 521 | 3.0E-12 |
| sp|O13820|ERG5_SCHPO | Cytochrome P450 61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg5 PE=1 SV=3 | 308 | 541 | 4.0E-12 |
| sp|O18993|CP3AL_CALJA | Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 | 280 | 524 | 4.0E-12 |
| sp|P08684|CP3A4_HUMAN | Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 | 240 | 524 | 4.0E-12 |
| sp|Q08D50|CP26B_XENTR | Cytochrome P450 26B1 OS=Xenopus tropicalis GN=cyp26b1 PE=2 SV=1 | 39 | 513 | 5.0E-12 |
| sp|P79102|CP3AS_BOVIN | Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 | 253 | 543 | 5.0E-12 |
| sp|Q92095|CP1A1_OPSTA | Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 | 70 | 531 | 5.0E-12 |
| sp|Q9VYY4|C4G15_DROME | Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 | 299 | 534 | 6.0E-12 |
| sp|Q7Z449|CP2U1_HUMAN | Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 | 257 | 538 | 6.0E-12 |
| sp|P49264|C71B1_THLAR | Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 | 70 | 545 | 6.0E-12 |
| sp|Q98T91|C340_ORYLA | Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 | 272 | 534 | 6.0E-12 |
| sp|Q6WKZ0|C7D94_MENGR | Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 | 144 | 525 | 6.0E-12 |
| sp|Q95036|CP6B5_PAPGL | Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 | 309 | 518 | 6.0E-12 |
| sp|Q9HB55|CP343_HUMAN | Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 | 280 | 529 | 6.0E-12 |
| sp|Q50EK3|C04C1_PINTA | Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 | 207 | 539 | 6.0E-12 |
| sp|O61387|CP6B7_HELAM | Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 | 248 | 535 | 7.0E-12 |
| sp|Q27664|CP6B2_HELAM | Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 | 253 | 535 | 7.0E-12 |
| sp|P04798|CP1A1_HUMAN | Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 | 26 | 525 | 7.0E-12 |
| sp|P79760|CP1A4_CHICK | Cytochrome P450 1A4 OS=Gallus gallus GN=CYP1A4 PE=2 SV=1 | 70 | 525 | 8.0E-12 |
| sp|O64635|C76C4_ARATH | Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 | 294 | 540 | 9.0E-12 |
| sp|P20815|CP3A5_HUMAN | Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 | 240 | 524 | 9.0E-12 |
| sp|P51538|CP3A9_RAT | Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 | 253 | 510 | 1.0E-11 |
| sp|P04800|CP3A1_RAT | Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 | 274 | 524 | 1.0E-11 |
| sp|I3PFJ5|C76AD_BETVU | Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 | 314 | 506 | 1.0E-11 |
| sp|Q92113|CP17A_SQUAC | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 | 33 | 510 | 1.0E-11 |
| sp|D1MI46|C76BA_SWEMU | Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 | 258 | 522 | 1.0E-11 |
| sp|Q02928|CP4AB_HUMAN | Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 | 154 | 526 | 1.0E-11 |
| sp|Q9VE00|C12A4_DROME | Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 | 312 | 543 | 1.0E-11 |
| sp|Q06367|CP1A1_CAVPO | Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 | 30 | 523 | 1.0E-11 |
| sp|Q9AXH9|KAO1_HORVU | Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 | 168 | 546 | 1.0E-11 |
| sp|O18635|C12A2_MUSDO | Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 | 312 | 543 | 1.0E-11 |
| sp|Q9XHE7|C71DD_MENPI | Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 | 93 | 525 | 1.0E-11 |
| sp|Q7KR10|CCD1D_DROME | Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 | 312 | 542 | 1.0E-11 |
| sp|P20817|CP4AE_RAT | Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 | 279 | 526 | 1.0E-11 |
| sp|A2RRT9|CP4V2_RAT | Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 | 294 | 527 | 2.0E-11 |
| sp|Q9V776|CP317_DROME | Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 | 254 | 505 | 2.0E-11 |
| sp|P9WPM5|CP137_MYCTU | Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 | 259 | 549 | 2.0E-11 |
| sp|P9WPM4|CP137_MYCTO | Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 | 259 | 549 | 2.0E-11 |
| sp|P82712|CCD1P_DROME | Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 | 312 | 542 | 2.0E-11 |
| sp|C0SJS4|C71AJ_APIGR | Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 | 71 | 525 | 2.0E-11 |
| sp|Q9FMY1|C86B1_ARATH | Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 | 257 | 525 | 2.0E-11 |
| sp|Q9FIB0|C78A7_ARATH | Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 | 309 | 527 | 2.0E-11 |
| sp|P98183|C71DC_CATRO | Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 | 165 | 522 | 2.0E-11 |
| sp|Q9LTM0|C71BN_ARATH | Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 | 230 | 513 | 2.0E-11 |
| sp|O48956|C98A1_SORBI | Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 | 263 | 548 | 2.0E-11 |
| sp|Q93ZB2|KO1_ARATH | Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 | 233 | 535 | 2.0E-11 |
| sp|Q27756|CP6B3_PAPPO | Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 | 231 | 514 | 2.0E-11 |
| sp|Q64464|CP3AD_MOUSE | Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 | 238 | 524 | 2.0E-11 |
| sp|P37117|C71A4_SOLME | Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 | 70 | 506 | 2.0E-11 |
| sp|F4JW83|C84A4_ARATH | Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 | 268 | 506 | 2.0E-11 |
| sp|P05183|CP3A2_RAT | Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 | 276 | 524 | 2.0E-11 |
| sp|Q5TCH4|CP4AM_HUMAN | Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 | 154 | 526 | 3.0E-11 |
| sp|Q964T1|CP4CU_BLAGE | Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 | 306 | 524 | 3.0E-11 |
| sp|Q8K4D6|CP4X1_RAT | Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 | 306 | 519 | 3.0E-11 |
| sp|Q6A152|CP4X1_MOUSE | Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 | 270 | 526 | 3.0E-11 |
| sp|P9WPN1|C135A_MYCTU | Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135A1 PE=1 SV=1 | 86 | 523 | 3.0E-11 |
| sp|P9WPN0|C135A_MYCTO | Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135A1 PE=3 SV=1 | 86 | 523 | 3.0E-11 |
| sp|P93147|C81E1_GLYEC | Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 | 33 | 525 | 3.0E-11 |
| sp|Q9V419|C28A5_DROME | Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 | 274 | 526 | 3.0E-11 |
| sp|Q9VXY0|CP4S3_DROME | Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 | 33 | 534 | 3.0E-11 |
| sp|P00191|CP21A_BOVIN | Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 | 247 | 523 | 3.0E-11 |
| sp|Q95078|CP18A_DROME | Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 | 70 | 530 | 3.0E-11 |
| sp|O08394|CYPD_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 | 275 | 526 | 3.0E-11 |
| sp|P14579|CP4A5_RABIT | Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 | 154 | 552 | 3.0E-11 |
| sp|Q9LUC5|C7A15_ARATH | Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 | 126 | 539 | 3.0E-11 |
| sp|P15129|CP4B1_RAT | Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 | 128 | 529 | 4.0E-11 |
| sp|Q9VE01|C12A5_DROME | Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 | 289 | 543 | 4.0E-11 |
| sp|P47195|C80A1_BERST | Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 | 263 | 518 | 4.0E-11 |
| sp|Q9M066|C90C1_ARATH | 3-epi-6-deoxocathasterone 23-monooxygenase OS=Arabidopsis thaliana GN=ROT3 PE=2 SV=3 | 64 | 521 | 4.0E-11 |
| sp|P37120|C75A2_SOLME | Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 | 269 | 525 | 4.0E-11 |
| sp|P29981|CP4C1_BLADI | Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 | 299 | 524 | 4.0E-11 |
| sp|O48921|C97B2_SOYBN | Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 | 306 | 530 | 4.0E-11 |
| sp|Q9LMX7|C78A5_ARATH | Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 | 271 | 517 | 4.0E-11 |
| sp|P79716|CP1A1_DICLA | Cytochrome P450 1A1 OS=Dicentrarchus labrax GN=cyp1a1 PE=2 SV=1 | 70 | 531 | 4.0E-11 |
| sp|Q6WG30|T5H_TAXCU | Taxadiene 5-alpha hydroxylase OS=Taxus cuspidata PE=1 SV=2 | 70 | 519 | 4.0E-11 |
| sp|Q6ZWL3|CP4V2_HUMAN | Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 | 306 | 531 | 4.0E-11 |
| sp|Q91WL5|CP4CA_MOUSE | Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 | 50 | 526 | 4.0E-11 |
| sp|Q29510|CP2CU_RABIT | Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 | 93 | 524 | 4.0E-11 |
| sp|Q64481|CP3AG_MOUSE | Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 | 247 | 543 | 4.0E-11 |
| sp|Q95031|CP6B6_HELAM | Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 | 250 | 535 | 4.0E-11 |
| sp|Q9STK8|C71AP_ARATH | Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 | 33 | 534 | 5.0E-11 |
| sp|P58048|C71B8_ARATH | Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 | 260 | 513 | 5.0E-11 |
| sp|Q5RCN6|CP4V2_PONAB | Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 | 306 | 531 | 5.0E-11 |
| sp|Q8HYN1|CP17A_PANTR | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 | 253 | 525 | 5.0E-11 |
| sp|P08682|CP2E1_RABIT | Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 | 33 | 524 | 6.0E-11 |
| sp|O65782|C83B1_ARATH | Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 | 58 | 540 | 6.0E-11 |
| sp|Q9DBW0|CP4V2_MOUSE | Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 | 294 | 531 | 6.0E-11 |
| sp|C0SJS2|C71AJ_PASSA | Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 | 42 | 506 | 6.0E-11 |
| sp|Q9GJX5|CP4AL_PIG | Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 | 153 | 526 | 6.0E-11 |
| sp|P05093|CP17A_HUMAN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 | 253 | 525 | 7.0E-11 |
| sp|Q9LHA1|C8D11_ARATH | Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 | 271 | 517 | 7.0E-11 |
| sp|Q9V5L3|C49A1_DROME | Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 | 308 | 519 | 7.0E-11 |
| sp|O04164|C71A6_NEPRA | Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 | 294 | 517 | 8.0E-11 |
| sp|P79401|CP3AT_PIG | Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 | 274 | 524 | 8.0E-11 |
| sp|Q9LIP5|C71BW_ARATH | Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 | 56 | 543 | 8.0E-11 |
| sp|Q9CX98|CP2U1_MOUSE | Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 | 86 | 538 | 9.0E-11 |
| sp|Q9VB31|C6A18_DROME | Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 | 254 | 517 | 9.0E-11 |
| sp|O16805|CP4D1_DROSI | Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 | 299 | 523 | 9.0E-11 |
| sp|P33269|CP4D1_DROME | Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 | 250 | 523 | 9.0E-11 |
| sp|Q6GUR1|CP1A1_MACMU | Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 | 63 | 525 | 9.0E-11 |
| sp|O22203|C98A3_ARATH | Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 | 305 | 520 | 9.0E-11 |
| sp|O64989|C90B1_ARATH | Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CYP90B1 PE=1 SV=2 | 63 | 526 | 9.0E-11 |
| sp|Q9NR63|CP26B_HUMAN | Cytochrome P450 26B1 OS=Homo sapiens GN=CYP26B1 PE=1 SV=1 | 39 | 513 | 1.0E-10 |
| sp|P33268|CP3A8_MACFA | Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 | 280 | 524 | 1.0E-10 |
| sp|E1BHJ4|CP26B_BOVIN | Cytochrome P450 26B1 OS=Bos taurus GN=CYP26B1 PE=3 SV=1 | 39 | 513 | 1.0E-10 |
| sp|Q3LFU0|CP1A1_BALAC | Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 | 63 | 525 | 1.0E-10 |
| sp|Q9VCW1|CP6D4_DROME | Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 | 324 | 551 | 1.0E-10 |
| sp|Q5UQ90|YL532_MIMIV | Cytochrome P450-like protein L532 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L532 PE=1 SV=1 | 135 | 527 | 1.0E-10 |
| sp|Q92039|CP1A1_CHACA | Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 | 70 | 531 | 1.0E-10 |
| sp|Q9XHE8|C71DI_MENSP | Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 | 36 | 525 | 1.0E-10 |
| sp|Q6WKZ1|C71DI_MENGR | Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 | 36 | 525 | 1.0E-10 |
| sp|O64637|C76C2_ARATH | Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 | 291 | 525 | 1.0E-10 |
| sp|H1A981|C7263_MEDTR | 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 | 324 | 539 | 1.0E-10 |
| sp|P10634|CP2DQ_RAT | Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 | 89 | 544 | 1.0E-10 |
| sp|Q9V3S0|CP4G1_DROME | Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 | 322 | 520 | 2.0E-10 |
| sp|Q43250|C71C1_MAIZE | 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 | 205 | 525 | 2.0E-10 |
| sp|B9G934|C14C3_ORYSJ | Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 | 247 | 518 | 2.0E-10 |
| sp|Q9FMA5|C85A1_ARATH | Cytochrome P450 85A1 OS=Arabidopsis thaliana GN=CYP85A1 PE=2 SV=1 | 38 | 518 | 2.0E-10 |
| sp|Q9CA60|C98A9_ARATH | Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 | 87 | 517 | 2.0E-10 |
| sp|Q9SWR5|C93C1_SOYBN | 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 | 245 | 525 | 2.0E-10 |
| sp|Q9SXS3|C93C2_GLYEC | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 | 218 | 525 | 2.0E-10 |
| sp|Q94FM7|C71DK_TOBAC | 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 | 70 | 525 | 2.0E-10 |
| sp|P20678|CP2H2_CHICK | Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 | 82 | 524 | 2.0E-10 |
| sp|Q9XHE6|C71DF_MENPI | Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 | 33 | 525 | 2.0E-10 |
| sp|P54781|ERG5_YEAST | Cytochrome P450 61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG5 PE=1 SV=1 | 308 | 517 | 2.0E-10 |
| sp|Q7X7X4|C99A2_ORYSJ | Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 | 290 | 522 | 2.0E-10 |
| sp|Q9LJY7|C75AK_ARATH | Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 | 274 | 525 | 2.0E-10 |
| sp|Q6WKY9|C7D95_MENGR | Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 | 36 | 525 | 2.0E-10 |
| sp|Q6WNQ8|C81E8_MEDTR | Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 | 38 | 517 | 3.0E-10 |
| sp|P48419|C75A3_PETHY | Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 | 269 | 525 | 3.0E-10 |
| sp|P08686|CP21A_HUMAN | Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 | 249 | 523 | 3.0E-10 |
| sp|O64638|C76C3_ARATH | Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 | 263 | 525 | 3.0E-10 |
| sp|Q9VVN6|CP312_DROME | Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 | 157 | 520 | 3.0E-10 |
| sp|Q811W2|CP26B_MOUSE | Cytochrome P450 26B1 OS=Mus musculus GN=Cyp26b1 PE=1 SV=1 | 39 | 513 | 3.0E-10 |
| sp|P58050|C71BD_ARATH | Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 | 309 | 519 | 3.0E-10 |
| sp|P37118|C71A2_SOLME | Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 | 70 | 506 | 3.0E-10 |
| sp|Q9CAD6|C86A7_ARATH | Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 | 265 | 539 | 4.0E-10 |
| sp|Q43246|C88A1_MAIZE | Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 | 243 | 546 | 4.0E-10 |
| sp|P05177|CP1A2_HUMAN | Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 | 22 | 525 | 4.0E-10 |
| sp|P48418|C75A1_PETHY | Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 | 263 | 525 | 4.0E-10 |
| sp|O64636|C76C1_ARATH | Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 | 70 | 527 | 4.0E-10 |
| sp|Q6IV13|C7D95_MENSP | Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 | 79 | 525 | 4.0E-10 |
| sp|O48928|C77A3_SOYBN | Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 | 51 | 522 | 4.0E-10 |
| sp|Q6V0L0|CP26C_HUMAN | Cytochrome P450 26C1 OS=Homo sapiens GN=CYP26C1 PE=2 SV=2 | 71 | 519 | 4.0E-10 |
| sp|Q9V979|CP6U1_DROME | Probable cytochrome P450 6u1 OS=Drosophila melanogaster GN=Cyp6u1 PE=2 SV=3 | 310 | 542 | 5.0E-10 |
| sp|P20816|CP4A2_RAT | Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 | 279 | 526 | 5.0E-10 |
| sp|Q9LUC8|C7A13_ARATH | Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 | 145 | 538 | 5.0E-10 |
| sp|Q27593|CP6A8_DROME | Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 | 272 | 523 | 5.0E-10 |
| sp|Q1PS23|AMO_ARTAN | Amorpha-4,11-diene 12-monooxygenase OS=Artemisia annua GN=CYP71AV1 PE=1 SV=1 | 36 | 525 | 6.0E-10 |
| sp|H2DH21|C7A29_PANGI | Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 | 146 | 539 | 6.0E-10 |
| sp|O22307|C71DB_LOTJA | Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 | 70 | 527 | 6.0E-10 |
| sp|O48922|C98A2_SOYBN | Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 | 33 | 520 | 6.0E-10 |
| sp|G4XV71|C93C2_GLYUR | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 | 218 | 525 | 7.0E-10 |
| sp|Q9ZUX1|C94C1_ARATH | Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 | 146 | 525 | 7.0E-10 |
| sp|Q9CA61|C98A8_ARATH | Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 | 33 | 520 | 7.0E-10 |
| sp|Q42600|C84A1_ARATH | Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 | 309 | 544 | 7.0E-10 |
| sp|G3V7X8|CP26B_RAT | Cytochrome P450 26B1 OS=Rattus norvegicus GN=Cyp26b1 PE=2 SV=1 | 39 | 513 | 8.0E-10 |
| sp|Q9LIP6|C71BV_ARATH | Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 | 38 | 543 | 8.0E-10 |
| sp|Q9VFJ0|CA131_DROME | Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 | 203 | 528 | 8.0E-10 |
| sp|Q50EK5|C72B2_PINTA | Cytochrome P450 720B2 OS=Pinus taeda GN=CYP720B2 PE=2 SV=1 | 63 | 537 | 9.0E-10 |
| sp|Q9VS79|CP4D8_DROME | Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 | 306 | 523 | 9.0E-10 |
| sp|Q9LTM6|C71BH_ARATH | Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 | 269 | 502 | 1.0E-09 |
| sp|A6YIH8|C7D55_HYOMU | Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 | 70 | 525 | 1.0E-09 |
| sp|Q8CIM7|CP2DQ_MOUSE | Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 | 87 | 543 | 1.0E-09 |
| sp|Q6QNI4|C71AJ_AMMMJ | Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 | 71 | 525 | 1.0E-09 |
| sp|Q2LCM1|CP21A_CANLU | Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 | 247 | 523 | 1.0E-09 |
| sp|Q8WNW0|CP21A_CANLF | Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 | 247 | 523 | 1.0E-09 |
| sp|H2DH20|C7D13_PANGI | Cytochrome P450 CYP71D313 OS=Panax ginseng PE=2 SV=1 | 70 | 525 | 1.0E-09 |
| sp|Q8L7D5|THAH_ARATH | Cytochrome P450 708A2 OS=Arabidopsis thaliana GN=CYP708A2 PE=2 SV=3 | 70 | 526 | 1.0E-09 |
| sp|Q964R0|CP6K1_BLAGE | Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 | 322 | 524 | 1.0E-09 |
| sp|Q93Z79|C14A1_ARATH | Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 | 264 | 532 | 1.0E-09 |
| sp|Q9T093|C70B3_ARATH | Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 | 257 | 533 | 1.0E-09 |
| sp|Q9GLD2|CP17A_PAPHU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 | 253 | 525 | 2.0E-09 |
| sp|C0SJS3|ANGS_PASSA | Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 | 70 | 525 | 2.0E-09 |
| sp|P24457|CP2DB_MOUSE | Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 | 37 | 543 | 2.0E-09 |
| sp|Q43078|C97B1_PEA | Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 | 306 | 509 | 2.0E-09 |
| sp|Q0IIF9|CP2U1_BOVIN | Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 | 257 | 527 | 2.0E-09 |
| sp|Q9V8M2|C12B2_DROME | Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 | 309 | 539 | 2.0E-09 |
| sp|O35728|CP4AE_MOUSE | Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 | 120 | 526 | 3.0E-09 |
| sp|Q05047|C72A1_CATRO | Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 | 257 | 550 | 3.0E-09 |
| sp|Q5RBQ1|CP1A2_PONAB | Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 | 22 | 525 | 3.0E-09 |
| sp|Q6WNR0|C81E7_MEDTR | Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 | 33 | 524 | 3.0E-09 |
| sp|P0DKI7|STORR_PAPSO | Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 | 276 | 524 | 3.0E-09 |
| sp|P30610|CP52H_CANTR | Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 | 200 | 515 | 3.0E-09 |
| sp|Q27520|C13A1_CAEEL | Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 | 308 | 519 | 3.0E-09 |
| sp|D4AY62|A1131_ARTBC | Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 | 268 | 522 | 3.0E-09 |
| sp|Q42716|C71A8_MENPI | Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 | 165 | 525 | 3.0E-09 |
| sp|H2DH19|C7D31_PANGI | Cytochrome P450 CYP71D312 OS=Panax ginseng PE=2 SV=1 | 143 | 525 | 4.0E-09 |
| sp|P15128|CP4B1_RABIT | Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 | 268 | 528 | 4.0E-09 |
| sp|Q9SMP5|C94B3_ARATH | Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 | 257 | 523 | 4.0E-09 |
| sp|Q42799|C93A2_SOYBN | Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 | 214 | 542 | 4.0E-09 |
| sp|O18596|C4D10_DROMT | Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 | 226 | 524 | 4.0E-09 |
| sp|Q1ZXL2|C518B_DICDI | Probable cytochrome P450 518B1 OS=Dictyostelium discoideum GN=cyp518B1 PE=3 SV=1 | 294 | 524 | 5.0E-09 |
| sp|Q9WVK8|CP46A_MOUSE | Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 | 283 | 525 | 5.0E-09 |
| sp|Q9SRQ1|C89A9_ARATH | Cytochrome P450 89A9 OS=Arabidopsis thaliana GN=CYP89A9 PE=2 SV=1 | 308 | 551 | 6.0E-09 |
| sp|Q92045|CP11A_DASAM | Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 | 319 | 543 | 6.0E-09 |
| sp|P37123|C77A1_SOLME | Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 | 63 | 522 | 6.0E-09 |
| sp|Q9STK7|C71AQ_ARATH | Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 | 70 | 525 | 6.0E-09 |
| sp|O48786|C734A_ARATH | Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 | 84 | 550 | 6.0E-09 |
| sp|Q9ASR3|C7091_ARATH | Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 | 269 | 520 | 6.0E-09 |
| sp|Q9ZNR0|C78A6_ARATH | Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 | 271 | 507 | 6.0E-09 |
| sp|Q5KQT6|CP1A2_FELCA | Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 | 26 | 525 | 6.0E-09 |
| sp|O04790|C75A7_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 | 269 | 547 | 6.0E-09 |
| sp|Q27594|CP6A9_DROME | Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 | 310 | 509 | 6.0E-09 |
| sp|P13527|CP6A1_MUSDO | Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 | 313 | 523 | 7.0E-09 |
| sp|O65786|C71B4_ARATH | Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 | 142 | 513 | 7.0E-09 |
| sp|P51589|CP2J2_HUMAN | Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 | 206 | 524 | 7.0E-09 |
| sp|Q07217|CP11A_ONCMY | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 | 276 | 543 | 7.0E-09 |
| sp|Q9LTM7|C71BG_ARATH | Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 | 290 | 513 | 7.0E-09 |
| sp|Q9VFP1|CP6D5_DROME | Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 | 315 | 527 | 7.0E-09 |
| sp|P11715|CP17A_RAT | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 | 217 | 523 | 8.0E-09 |
| sp|Q9SHG5|C72C1_ARATH | Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 | 279 | 525 | 8.0E-09 |
| sp|Q5KQH7|C14D1_ORYSJ | Cytochrome P450 714D1 OS=Oryza sativa subsp. japonica GN=CYP714D1 PE=1 SV=1 | 282 | 539 | 8.0E-09 |
| sp|P27786|CP17A_MOUSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 | 210 | 523 | 8.0E-09 |
| sp|Q43068|C82A1_PEA | Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 | 312 | 523 | 9.0E-09 |
| sp|P51590|CP2J3_RAT | Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 | 270 | 524 | 9.0E-09 |
| sp|Q9LNJ4|C70A2_ARATH | Cytochrome P450 703A2 OS=Arabidopsis thaliana GN=CYP703A2 PE=2 SV=1 | 265 | 502 | 1.0E-08 |
| sp|O73853|CP17A_ICTPU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 | 35 | 551 | 1.0E-08 |
| sp|Q54ZM4|C518A_DICDI | Probable cytochrome P450 518A1 OS=Dictyostelium discoideum GN=cyp518A1 PE=3 SV=1 | 294 | 517 | 1.0E-08 |
| sp|B9X287|C7346_ORYSJ | Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 | 325 | 551 | 1.0E-08 |
| sp|Q96581|C75A4_GENTR | Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 | 262 | 547 | 1.0E-08 |
| sp|Q27514|C13A5_CAEEL | Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 | 308 | 549 | 1.0E-08 |
| sp|Q9LIP4|C71BX_ARATH | Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 | 58 | 517 | 1.0E-08 |
| sp|P70687|CP17A_MESAU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 | 61 | 525 | 1.0E-08 |
| sp|Q6GUQ4|CP2E1_MACMU | Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 | 87 | 524 | 1.0E-08 |
| sp|Q6VVX0|CP2R1_HUMAN | Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 | 257 | 551 | 2.0E-08 |
| sp|P48422|C86A1_ARATH | Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 | 294 | 539 | 2.0E-08 |
| sp|Q9QYG5|CP2DK_MESAU | Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 | 89 | 543 | 2.0E-08 |
| sp|O65012|C78A4_PINRA | Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 | 226 | 522 | 2.0E-08 |
| sp|Q9LSF8|C82G1_ARATH | Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 | 283 | 523 | 2.0E-08 |
| sp|Q9V773|C6A20_DROME | Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 | 252 | 510 | 2.0E-08 |
| sp|P33266|CP2E1_MACFA | Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 | 87 | 524 | 2.0E-08 |
| sp|Q9V774|C6A21_DROME | Probable cytochrome P450 6a21 OS=Drosophila melanogaster GN=Cyp6a21 PE=2 SV=1 | 254 | 509 | 2.0E-08 |
| sp|Q92110|CP1A1_ONCMY | Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 | 36 | 531 | 2.0E-08 |
| sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 294 | 527 | 2.0E-08 |
| sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 294 | 524 | 2.0E-08 |
| sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 294 | 524 | 2.0E-08 |
| sp|Q0DBF4|C7018_ORYSJ | Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 | 309 | 525 | 2.0E-08 |
| sp|B9GBJ9|C14C1_ORYSJ | Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 | 206 | 518 | 2.0E-08 |
| sp|Q64462|CP4B1_MOUSE | Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 | 274 | 529 | 2.0E-08 |
| sp|P15540|CP21A_PIG | Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 | 295 | 523 | 3.0E-08 |
| sp|O23365|C97B3_ARATH | Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 | 306 | 530 | 3.0E-08 |
| sp|Q09653|C13AA_CAEEL | Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 | 308 | 519 | 3.0E-08 |
| sp|O81974|C71D8_SOYBN | Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 | 315 | 520 | 3.0E-08 |
| sp|Q9Y6A2|CP46A_HUMAN | Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 | 140 | 525 | 3.0E-08 |
| sp|P47787|THAS_PIG | Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 | 314 | 530 | 3.0E-08 |
| sp|Q9GQM9|CP6L1_BLAGE | Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 | 294 | 524 | 3.0E-08 |
| sp|P24465|C71A1_PERAE | Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 | 307 | 506 | 3.0E-08 |
| sp|Q07973|CP24A_HUMAN | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 | 309 | 524 | 3.0E-08 |
| sp|Q9FUY7|C79F2_ARATH | Hexahomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F2 PE=1 SV=2 | 294 | 527 | 3.0E-08 |
| sp|O48958|C71E1_SORBI | 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 | 264 | 517 | 3.0E-08 |
| sp|P56655|CP238_MOUSE | Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 | 287 | 540 | 3.0E-08 |
| sp|Q42798|C93A1_SOYBN | 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 | 165 | 542 | 3.0E-08 |
| sp|Q27517|C13A3_CAEEL | Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 | 301 | 525 | 3.0E-08 |
| sp|Q9V6H1|CP9H1_DROME | Probable cytochrome P450 9h1 OS=Drosophila melanogaster GN=Cyp9h1 PE=3 SV=1 | 253 | 523 | 4.0E-08 |
| sp|Q96418|C75A5_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 | 269 | 547 | 4.0E-08 |
| sp|Q9VGB4|CP132_DROME | Probable cytochrome P450 313a2 OS=Drosophila melanogaster GN=Cyp313a2 PE=3 SV=3 | 321 | 550 | 4.0E-08 |
| sp|O54749|CP2J5_MOUSE | Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 | 36 | 524 | 4.0E-08 |
| sp|Q93VK5|LUT5_ARATH | Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 | 307 | 525 | 4.0E-08 |
| sp|Q6YTF5|C76M5_ORYSJ | Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 | 287 | 525 | 4.0E-08 |
| sp|P58049|C71BB_ARATH | Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 | 262 | 513 | 4.0E-08 |
| sp|Q92109|CP1A3_ONCMY | Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 | 240 | 531 | 5.0E-08 |
| sp|Q1ZXF5|C5084_DICDI | Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 | 275 | 517 | 6.0E-08 |
| sp|Q01361|CP2DE_BOVIN | Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 | 70 | 525 | 7.0E-08 |
| sp|Q9STL1|C71AM_ARATH | Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 | 59 | 549 | 7.0E-08 |
| sp|Q6TBX7|LUT1_ARATH | Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 | 283 | 525 | 9.0E-08 |
| sp|Q6VVW9|CP2R1_MOUSE | Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 | 257 | 551 | 9.0E-08 |
| sp|P30611|CP52N_CANTR | Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 | 296 | 552 | 1.0E-07 |
| sp|Q09128|CP24A_RAT | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 | 310 | 551 | 1.0E-07 |
| sp|Q9V675|CP6G2_DROME | Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 | 320 | 534 | 1.0E-07 |
| sp|Q9LTM3|C71BK_ARATH | Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 | 260 | 502 | 1.0E-07 |
| sp|Q8SPK1|CP4AO_PIG | Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 | 281 | 526 | 1.0E-07 |
| sp|O54750|CP2J6_MOUSE | Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 | 260 | 519 | 1.0E-07 |
| sp|F4IK45|C70B2_ARATH | Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 | 100 | 525 | 1.0E-07 |
| sp|Q9SCN2|C71BU_ARATH | Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 | 143 | 513 | 1.0E-07 |
| sp|P79690|CP191_CARAU | Brain aromatase OS=Carassius auratus GN=cyp19a1 PE=2 SV=1 | 67 | 518 | 1.0E-07 |
| sp|O44220|C12B1_DROAC | Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 | 72 | 551 | 1.0E-07 |
| sp|Q92104|CP11B_LITCT | Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 | 322 | 549 | 1.0E-07 |
| sp|P0DKI2|C76AN_BETVU | Inactive cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=3 SV=1 | 314 | 393 | 1.0E-07 |
| sp|P05179|CP2C7_RAT | Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 | 303 | 524 | 1.0E-07 |
| sp|P56592|CP1A2_CANLF | Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 | 63 | 525 | 2.0E-07 |
| sp|Q9V676|CP6T3_DROME | Probable cytochrome P450 6t3 OS=Drosophila melanogaster GN=Cyp6t3 PE=3 SV=1 | 322 | 520 | 2.0E-07 |
| sp|Q9FXW4|C80B2_COPJA | Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 | 71 | 527 | 2.0E-07 |
| sp|O81973|C93A3_SOYBN | Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 | 242 | 542 | 2.0E-07 |
| sp|Q9LUC9|C7A11_ARATH | Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 | 197 | 539 | 2.0E-07 |
| sp|Q8SPK0|CP4AP_PIG | Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 | 154 | 526 | 2.0E-07 |
| sp|Q59205|CPXU_BRADU | Cytochrome P450 BJ-4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cyp117 PE=3 SV=2 | 254 | 427 | 2.0E-07 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005506 | iron ion binding | Yes |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
| GO:0004497 | monooxygenase activity | Yes |
| GO:0020037 | heme binding | Yes |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0016491 | oxidoreductase activity | No |
| GO:0043169 | cation binding | No |
| GO:0043167 | ion binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0046872 | metal ion binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0046906 | tetrapyrrole binding | No |
| GO:0005488 | binding | No |
| GO:0046914 | transition metal ion binding | No |
| GO:0003674 | molecular_function | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 25 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 33 | 55 | 22 |
| 2 | 65 | 87 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|080610 MSYAANGTTPILDAWSGYVAYAQTQLTPWSSRMTILSIATIPVLVVVLNVLSQLLQFRKSSEPPVVFHWLPFIGS AIGYGTDPLNFFNRCRDKYGDVFTFVLFGRRVTVALGSKGNNFILGGKSIVFNAEDAYTHLTTPVFGKDVVYDIP NDLFMEQKKFVKVGLSSENLRAYVGMIEEEVEEYLGSDSAFSAFQSNDANEWGHFDVLKVMSGITILTASRTLQG KEVRAGLDKTFAEIFNDLDGGFTPLNFLFPNLPLASYKKRDVAHKKISDFFSSIVKGRRAETNPDHEYDMIASLM NQKYRDGRQLKDHEIAHIMIALLMAGQHTSSATGSWVLCHLARRPDVCDALYKEQVKNFSNPDGSFRSMTHEELR QLPILDSVIRETLRLHPPIHSVMRHVRDDMPVPATLAAPGKDTTYVIPKGHYVLASPLVSQLDRTIWKDAETWEP LRWSDPEGIAAQANKLYEDVQGEKIDYGFGAVSKGTESPYQPFGAGKHRCIGEQFAYLQLGTIITTFIRHMELKM DKLPEHNYQTLITLPKAPREVYYRRRK* |
| Coding | >Agabi119p4|080610 ATGTCGTACGCCGCCAACGGCACGACGCCCATCCTGGACGCTTGGTCTGGCTATGTCGCCTATGCTCAGACACAA CTCACCCCATGGAGCTCGAGGATGACCATACTCTCCATAGCGACTATCCCGGTGTTGGTTGTCGTGCTCAACGTA TTGAGCCAGCTGCTCCAATTTCGCAAGTCCAGTGAACCGCCTGTCGTTTTCCACTGGCTTCCATTTATTGGCTCG GCCATTGGCTATGGCACCGACCCACTCAACTTTTTCAACCGGTGCCGTGATAAGTACGGCGATGTGTTCACCTTC GTTCTCTTCGGTCGTCGCGTGACTGTCGCCCTTGGTAGCAAGGGTAACAACTTTATTTTGGGTGGTAAATCGATC GTATTCAACGCCGAGGATGCATATACACATCTTACGACTCCCGTATTCGGGAAGGACGTCGTCTACGACATTCCT AACGACCTTTTCATGGAGCAAAAGAAATTCGTCAAGGTCGGACTATCCTCTGAAAACCTCCGCGCCTATGTTGGT ATGATTGAAGAAGAAGTAGAAGAATACCTCGGGTCGGATTCAGCCTTTTCCGCCTTCCAGTCCAACGATGCCAAC GAGTGGGGACATTTTGATGTACTCAAAGTAATGTCTGGGATCACTATTTTGACGGCGTCGCGGACCCTTCAAGGC AAGGAAGTGCGTGCAGGTTTAGATAAGACGTTCGCCGAAATTTTCAACGATCTCGATGGTGGCTTCACCCCACTG AATTTCCTCTTCCCCAACTTGCCACTAGCAAGTTACAAAAAGAGGGACGTTGCGCACAAGAAAATAAGTGATTTC TTCTCGAGCATCGTCAAAGGCAGGAGAGCTGAAACGAATCCTGATCATGAATATGACATGATTGCTTCCCTGATG AATCAGAAATACCGTGATGGACGCCAATTAAAAGATCATGAGATAGCCCACATTATGATCGCCCTTCTCATGGCC GGTCAACATACTAGTTCTGCCACTGGTTCTTGGGTCCTTTGCCACCTCGCCAGGCGTCCGGATGTCTGCGATGCT CTTTATAAAGAACAGGTTAAAAATTTCTCGAATCCTGACGGTTCGTTCCGCTCGATGACTCATGAAGAACTTCGA CAACTTCCCATCCTGGACTCCGTTATTCGGGAAACTCTTCGTTTACATCCCCCAATCCACAGCGTTATGCGCCAC GTCCGTGATGATATGCCCGTCCCCGCTACCCTCGCTGCACCAGGAAAAGACACCACCTATGTTATCCCGAAAGGC CACTATGTTCTTGCATCACCGCTTGTCAGCCAGCTCGATCGTACAATCTGGAAAGATGCTGAAACATGGGAGCCT TTGCGATGGAGTGACCCTGAAGGTATTGCGGCACAGGCTAACAAGTTGTACGAAGACGTTCAAGGAGAGAAAATT GATTATGGATTTGGTGCGGTCAGTAAAGGCACTGAGAGTCCATATCAACCTTTTGGTGCTGGAAAGCACAGGTGC ATTGGAGAGCAATTTGCGTATTTACAGTTGGGGACCATAATCACGACCTTTATAAGACATATGGAGCTCAAGATG GACAAACTTCCTGAACATAATTACCAGACTTTGATCACACTACCCAAGGCTCCGCGTGAGGTCTACTATAGGAGG AGGAAGTAG |
| Transcript | >Agabi119p4|080610 ATGTCGTACGCCGCCAACGGCACGACGCCCATCCTGGACGCTTGGTCTGGCTATGTCGCCTATGCTCAGACACAA CTCACCCCATGGAGCTCGAGGATGACCATACTCTCCATAGCGACTATCCCGGTGTTGGTTGTCGTGCTCAACGTA TTGAGCCAGCTGCTCCAATTTCGCAAGTCCAGTGAACCGCCTGTCGTTTTCCACTGGCTTCCATTTATTGGCTCG GCCATTGGCTATGGCACCGACCCACTCAACTTTTTCAACCGGTGCCGTGATAAGTACGGCGATGTGTTCACCTTC GTTCTCTTCGGTCGTCGCGTGACTGTCGCCCTTGGTAGCAAGGGTAACAACTTTATTTTGGGTGGTAAATCGATC GTATTCAACGCCGAGGATGCATATACACATCTTACGACTCCCGTATTCGGGAAGGACGTCGTCTACGACATTCCT AACGACCTTTTCATGGAGCAAAAGAAATTCGTCAAGGTCGGACTATCCTCTGAAAACCTCCGCGCCTATGTTGGT ATGATTGAAGAAGAAGTAGAAGAATACCTCGGGTCGGATTCAGCCTTTTCCGCCTTCCAGTCCAACGATGCCAAC GAGTGGGGACATTTTGATGTACTCAAAGTAATGTCTGGGATCACTATTTTGACGGCGTCGCGGACCCTTCAAGGC AAGGAAGTGCGTGCAGGTTTAGATAAGACGTTCGCCGAAATTTTCAACGATCTCGATGGTGGCTTCACCCCACTG AATTTCCTCTTCCCCAACTTGCCACTAGCAAGTTACAAAAAGAGGGACGTTGCGCACAAGAAAATAAGTGATTTC TTCTCGAGCATCGTCAAAGGCAGGAGAGCTGAAACGAATCCTGATCATGAATATGACATGATTGCTTCCCTGATG AATCAGAAATACCGTGATGGACGCCAATTAAAAGATCATGAGATAGCCCACATTATGATCGCCCTTCTCATGGCC GGTCAACATACTAGTTCTGCCACTGGTTCTTGGGTCCTTTGCCACCTCGCCAGGCGTCCGGATGTCTGCGATGCT CTTTATAAAGAACAGGTTAAAAATTTCTCGAATCCTGACGGTTCGTTCCGCTCGATGACTCATGAAGAACTTCGA CAACTTCCCATCCTGGACTCCGTTATTCGGGAAACTCTTCGTTTACATCCCCCAATCCACAGCGTTATGCGCCAC GTCCGTGATGATATGCCCGTCCCCGCTACCCTCGCTGCACCAGGAAAAGACACCACCTATGTTATCCCGAAAGGC CACTATGTTCTTGCATCACCGCTTGTCAGCCAGCTCGATCGTACAATCTGGAAAGATGCTGAAACATGGGAGCCT TTGCGATGGAGTGACCCTGAAGGTATTGCGGCACAGGCTAACAAGTTGTACGAAGACGTTCAAGGAGAGAAAATT GATTATGGATTTGGTGCGGTCAGTAAAGGCACTGAGAGTCCATATCAACCTTTTGGTGCTGGAAAGCACAGGTGC ATTGGAGAGCAATTTGCGTATTTACAGTTGGGGACCATAATCACGACCTTTATAAGACATATGGAGCTCAAGATG GACAAACTTCCTGAACATAATTACCAGACTTTGATCACACTACCCAAGGCTCCGCGTGAGGTCTACTATAGGAGG AGGAAGTAG |
| Gene | >Agabi119p4|080610 ATGTCGTACGCCGCCAACGGCACGACGCCCATCCTGGACGCTTGGTCTGGCTATGTCGCCTATGCTCAGACACAA CTCACCCCATGGAGCTCGAGGATGACCATACTCTCCATAGCGACTATCCCGGTGTTGGTTGTCGTGCTCAACGTA TTGAGCCAGCTGGTGCGTCGCTTCTTGTCCCTTGATACATACGCGGCTTGTTGATTGTGTCCTCAGCTCCAATTT CGCAAGTCCAGTGAACCGCCTGTCGTTTTCCACTGGCTTCCATTTATTGGCTCGGCCATTGGCTATGGCACCGAC CCACTCAACTTTTTCAACCGGTGCCGTGATAAGGTGTGTACCAGTCTTTCATCGAAAAGAAACCGTCGTTTGACA GATGCCAATAGTACGGCGATGTGTTCACCTTCGTTCTCTTCGGTCGTCGCGTGACTGTCGCCCTTGGTAGCAAGG GTAACAACTTTATTTTGGGTGGTAAATCGATCGTATTCAACGCCGAGGATGCATATACAGTGCGTTTCTCTTCAT CCAAGTCACACCAGCGACTTATTTCTCATTGCAGCATCTTACGACTCCCGTATTCGGGAAGGACGTCGTCTACGA CATTCCTAACGACCTTTTCATGGAGCAAAAGAAATTCGTCAAGGTCGGACTATCCTCTGAAAACCTCCGCGCCTA TGTTGGTATGATTGAAGAAGAAGTAGAAGAATACCTCGGGTCGGATTCAGCCTTTTCCGCCTTCCAGTCCAACGA TGCCAACGAGTGGGGACATTTTGATGTACTCAAAGTAATGTCTGGGATCACTATTTTGACGGCGTCGCGGACCCT TCAAGGCAAGGAAGTGCGTGCAGGTTTAGATAAGACGTTCGCCGAAATTTTCAACGATCTCGATGGTGGCTTCAC CCCACTGAATTTCCTCTTCCCCAACTTGCCACTAGCAAGTTACAAAAAGAGGGACGTTGCGCACAAGAAAATAAG TGATTTCTTCTCGAGCATCGTCAAAGGCAGGAGAGCTGAAACGAATCCTGATGTGAGTGGTGCTGGCTTCCATCT CACACCACGCTGACGTGCAATATTAGCATGAATATGACATGATTGCTTCCCTGATGAATCAGAAATACCGTGATG GACGCCAATTAAAAGATCATGAGATAGCCCACATTATGATCGCCCTTCTCATGGCCGGTCAACATACTAGTTCTG CCACTGGTTCTTGGGTCCTTTGCCACCTCGCCAGGCGTCCGGATGTCTGGTATGTATACCTCATCATCTATTTAT AAGCAGTTACTTACCGCGTTTCAGCGATGCTCTTTATAAAGAACAGGTTAAAAATTTCTCGAATCCTGACGGTTC GTTCCGCTCGATGACTCATGAAGAACTTCGACAACTTCCCATCCTGGACTCCGTTATTCGGGAAACTCTTCGTTT ACATCCCCCAATCCACAGCGTTATGCGCCACGTCCGTGATGATATGCCCGTCCCCGCTACCCTCGCTGCACCAGG AAAAGACACCACCTATGTTATCCCGAAAGGCCACTATGTTCTTGCATCACCGCTTGTCAGCCAGCTCGATCGTAC AATCTGGAAAGATGCTGAAACATGGGAGCCTTTGCGATGGAGTGACCCTGAAGGTATTGCGGCACAGGCTAACAA GTTGTACGAAGACGTTCAAGGAGAGAAAATTGATTATGGATTTGGTGCGGTCAGTAAAGGCACTGAGAGTCCATA TCAACCTTTTGGTGCTGGAAAGCACAGGTGCATTGGAGAGCAATTTGCGTATTTACAGTTGGGGACCATAATCAC GACCTTTATAAGACATATGGAGCTCAAGATGGACAAACTTCCTGAACATAATTACCAGGTATGTTTTTTTTGCCC TTGTTTTCGAGATGAAGCTGACGGGTTATCGCAGACTTTGATCACACTACCCAAGGCTCCGCGTGAGGTCTACTA TAGGAGGAGGAAGTAG |