Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|079050
Gene name
Locationscaffold_05a:173991..176910
Strand+
Gene length (bp)2919
Transcript length (bp)1959
Coding sequence length (bp)1959
Protein length (aa) 653

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02735 Ku Ku70/Ku80 beta-barrel domain 7.6E-34 285 493
PF03731 Ku_N Ku70/Ku80 N-terminal alpha/beta domain 1.7E-22 31 275
PF03730 Ku_C Ku70/Ku80 C-terminal arm 1.3E-12 517 597

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SA95|KU70_NEUCR ATP-dependent DNA helicase II subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-51 PE=3 SV=2 9 652 3.0E-84
sp|Q2MHH3|KU70_ASPSO ATP-dependent DNA helicase II subunit 1 OS=Aspergillus sojae GN=ku70 PE=3 SV=1 22 650 6.0E-84
sp|Q2MHH4|KU70_ASPOR ATP-dependent DNA helicase II subunit 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ku70 PE=3 SV=1 22 650 7.0E-84
sp|Q1DU75|KU70_COCIM ATP-dependent DNA helicase II subunit 1 OS=Coccidioides immitis (strain RS) GN=KU70 PE=3 SV=2 22 650 4.0E-78
sp|Q0U5F2|KU70_PHANO ATP-dependent DNA helicase II subunit 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=KU70 PE=3 SV=1 22 650 4.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SA95|KU70_NEUCR ATP-dependent DNA helicase II subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-51 PE=3 SV=2 9 652 3.0E-84
sp|Q2MHH3|KU70_ASPSO ATP-dependent DNA helicase II subunit 1 OS=Aspergillus sojae GN=ku70 PE=3 SV=1 22 650 6.0E-84
sp|Q2MHH4|KU70_ASPOR ATP-dependent DNA helicase II subunit 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ku70 PE=3 SV=1 22 650 7.0E-84
sp|Q1DU75|KU70_COCIM ATP-dependent DNA helicase II subunit 1 OS=Coccidioides immitis (strain RS) GN=KU70 PE=3 SV=2 22 650 4.0E-78
sp|Q0U5F2|KU70_PHANO ATP-dependent DNA helicase II subunit 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=KU70 PE=3 SV=1 22 650 4.0E-78
sp|P0CO50|KU70_CRYNJ ATP-dependent DNA helicase II subunit 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=KU70 PE=3 SV=1 108 620 4.0E-77
sp|P0CO51|KU70_CRYNB ATP-dependent DNA helicase II subunit 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=KU70 PE=3 SV=1 108 620 4.0E-77
sp|Q5AVC7|KU70_EMENI ATP-dependent DNA helicase II subunit 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ku70 PE=3 SV=1 60 638 2.0E-76
sp|Q2H0I3|KU70_CHAGB ATP-dependent DNA helicase II subunit 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=KU70 PE=3 SV=1 5 652 4.0E-61
sp|Q6CCK2|KU70_YARLI ATP-dependent DNA helicase II subunit 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KU70 PE=3 SV=1 13 638 7.0E-55
sp|Q26228|KU70_RHIAP ATP-dependent DNA helicase 2 subunit 1 OS=Rhipicephalus appendiculatus GN=ku70 PE=2 SV=1 29 642 2.0E-50
sp|O93257|XRCC6_CHICK X-ray repair cross-complementing protein 5 OS=Gallus gallus GN=XRCC6 PE=2 SV=1 24 649 4.0E-49
sp|P23475|XRCC6_MOUSE X-ray repair cross-complementing protein 6 OS=Mus musculus GN=Xrcc6 PE=1 SV=5 28 642 6.0E-48
sp|O94395|KU70_SCHPO ATP-dependent DNA helicase II subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pku70 PE=1 SV=1 13 648 5.0E-46
sp|Q9FQ08|KU70_ARATH ATP-dependent DNA helicase 2 subunit KU70 OS=Arabidopsis thaliana GN=KU70 PE=1 SV=1 14 647 9.0E-43
sp|Q7F1M0|KU70_ORYSJ ATP-dependent DNA helicase 2 subunit KU70 OS=Oryza sativa subsp. japonica GN=KU70 PE=1 SV=1 25 647 8.0E-37
sp|P12956|XRCC6_HUMAN X-ray repair cross-complementing protein 6 OS=Homo sapiens GN=XRCC6 PE=1 SV=2 385 649 4.0E-29
sp|P32807|KU70_YEAST ATP-dependent DNA helicase II subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKU70 PE=1 SV=2 11 559 2.0E-28
sp|Q6CUB4|KU70_KLULA ATP-dependent DNA helicase II subunit 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KU70 PE=3 SV=1 29 560 1.0E-26
sp|Q54MA9|KU70_DICDI ATP-dependent DNA helicase ku70 OS=Dictyostelium discoideum GN=ku70 PE=3 SV=1 28 461 4.0E-21
sp|Q23976|KU70_DROME ATP-dependent DNA helicase 2 subunit 1 OS=Drosophila melanogaster GN=Irbp PE=2 SV=3 13 645 5.0E-21
sp|P12956|XRCC6_HUMAN X-ray repair cross-complementing protein 6 OS=Homo sapiens GN=XRCC6 PE=1 SV=2 28 302 1.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0003678 DNA helicase activity Yes
GO:0003677 DNA binding Yes
GO:0006303 double-strand break repair via nonhomologous end joining Yes
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0097159 organic cyclic compound binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0006950 response to stress No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0090304 nucleic acid metabolic process No
GO:0050896 response to stimulus No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0004386 helicase activity No
GO:0006302 double-strand break repair No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006281 DNA repair No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0006259 DNA metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140097 catalytic activity, acting on DNA No
GO:0009987 cellular process No
GO:0140657 ATP-dependent activity No
GO:0033554 cellular response to stress No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|079050
MPPYDDWNKIDEEDEEEVQDTSFFEGKKDVILFCIDCSESMLELREDSNREGIKTCHLFTALEAAMQIQKRKIIV
GPNDSVGILVYNTTFKSGNGRSSISELKQNTTVYQPVSQLSAPKIQELIHLLDAAREDPEELRKAFPPVTGKLVA
MGDVFTSCNWVLRDQAPKTATKRIFLITDEDDPHSGPGSKQLFTSARTTLEDLIQAGVSVEPFFINTEDKPFDVS
KFYSQILLPTNLDAEEQLGEDPSLLPESISISRVEDLLSQMRIHEAPKRSLFNIPFQLAEGFVIGVQGYGLVTEQ
KKGNYKYFADLGDRMEVAVPRTAYVDEDRQADIEKAKIVYGVGQGKGDEEEEDDSLGVGIKTAKRGQRPFYSAED
IRSFRTLGLEPGIKLLGFKDRDELRFEDNIKHSHFIYPNEMSYSGSRRTFSALLKSMIRKNKVGLALVLMRRNSS
PVFSVLLPQEEQTDENGFTEPPGMHLIHLPFADDIRAAPIEDAFRASNQLKDAARAWIDKLSVKNGTYPPDSYPN
PALAYHNAQLQASAFREEFDVEAFEDMTEPNFEKIHKRAGNLMKEWKLALLNDKTANIGVATAGSKRKADVATND
VDEAEFRSKYQAGTLGKLKVGQLKTFLSAKGQPVSGRKDELLARVATWFDSH*
Coding >Agabi119p4|079050
ATGCCGCCTTACGATGACTGGAATAAGATCGATGAGGAGGATGAGGAAGAAGTTCAAGATACATCTTTCTTTGAA
GGGAAAAAAGACGTGATTTTGTTCTGTATTGACTGCTCTGAATCTATGCTTGAACTACGTGAAGACTCGAATCGT
GAGGGCATCAAGACTTGTCACCTTTTTACTGCGTTAGAGGCTGCCATGCAAATCCAGAAACGGAAGATTATTGTC
GGACCGAATGACTCGGTTGGAATCTTGGTTTACAACACAACGTTCAAGTCAGGGAATGGACGCAGCAGCATATCG
GAGCTGAAGCAAAACACCACCGTTTACCAACCTGTCTCTCAACTAAGTGCACCCAAAATCCAGGAATTGATACAT
CTGTTGGATGCCGCGCGTGAAGACCCTGAGGAGCTCCGAAAGGCATTCCCACCTGTAACTGGGAAACTGGTCGCC
ATGGGAGATGTGTTCACGAGCTGTAATTGGGTTTTACGTGACCAGGCACCCAAGACAGCAACCAAGCGTATTTTC
CTCATCACGGATGAAGATGATCCTCATTCAGGTCCTGGCAGCAAGCAATTGTTCACGTCGGCACGAACAACATTA
GAGGACCTGATTCAAGCTGGCGTCTCGGTCGAACCCTTCTTCATCAACACTGAGGATAAGCCTTTTGATGTGTCC
AAATTCTATTCCCAAATTCTGTTACCTACGAATTTGGACGCGGAAGAGCAATTGGGCGAAGATCCTTCGCTTCTT
CCTGAATCTATCTCTATATCCCGGGTTGAGGACCTGCTAAGCCAGATGCGAATCCATGAAGCTCCGAAAAGATCC
CTTTTTAACATCCCATTTCAACTTGCCGAGGGATTCGTCATTGGTGTCCAAGGATATGGCTTGGTCACTGAACAA
AAAAAAGGTAATTACAAGTATTTTGCCGACTTAGGCGATCGAATGGAGGTTGCTGTTCCACGTACAGCATATGTG
GATGAGGACCGTCAAGCTGATATAGAAAAAGCGAAAATTGTTTACGGCGTGGGTCAAGGAAAGGGCGATGAAGAA
GAGGAAGATGATAGTCTAGGTGTTGGTATCAAGACAGCTAAGCGAGGTCAACGACCGTTTTACAGTGCAGAAGAT
ATTCGTTCTTTCCGGACGTTGGGTCTCGAGCCCGGAATAAAACTTTTAGGATTCAAGGACAGAGATGAGCTTCGG
TTTGAAGACAACATCAAGCACTCGCACTTTATTTACCCAAATGAGATGTCATATTCTGGTAGCAGAAGGACATTC
AGTGCGCTGTTGAAGTCTATGATTCGGAAGAACAAAGTAGGACTGGCACTTGTCCTCATGCGACGGAACAGTTCC
CCCGTATTTTCTGTCCTCCTCCCACAGGAAGAGCAAACTGACGAAAATGGCTTTACCGAACCACCTGGCATGCAC
CTGATTCACTTGCCTTTCGCTGACGACATTCGTGCTGCTCCCATCGAAGATGCTTTCAGAGCATCCAACCAATTG
AAAGATGCGGCCCGTGCTTGGATCGATAAGTTAAGCGTTAAGAACGGAACATATCCGCCCGATTCGTACCCAAAT
CCTGCGCTTGCTTACCACAATGCACAACTCCAAGCCAGTGCATTTAGAGAGGAGTTTGATGTCGAAGCTTTTGAA
GATATGACCGAACCAAACTTTGAAAAGATCCATAAGCGAGCAGGAAACTTAATGAAGGAGTGGAAGTTGGCCTTA
CTTAACGATAAAACCGCAAATATTGGTGTCGCTACTGCGGGTTCCAAGCGCAAGGCGGATGTCGCCACCAATGAT
GTAGACGAGGCCGAATTCCGCAGCAAGTACCAGGCCGGAACCCTCGGGAAGCTGAAAGTAGGTCAACTCAAAACT
TTTTTGAGTGCGAAAGGCCAGCCTGTTTCCGGAAGGAAGGACGAATTGCTGGCCCGGGTCGCAACTTGGTTCGAC
TCTCATTAA
Transcript >Agabi119p4|079050
ATGCCGCCTTACGATGACTGGAATAAGATCGATGAGGAGGATGAGGAAGAAGTTCAAGATACATCTTTCTTTGAA
GGGAAAAAAGACGTGATTTTGTTCTGTATTGACTGCTCTGAATCTATGCTTGAACTACGTGAAGACTCGAATCGT
GAGGGCATCAAGACTTGTCACCTTTTTACTGCGTTAGAGGCTGCCATGCAAATCCAGAAACGGAAGATTATTGTC
GGACCGAATGACTCGGTTGGAATCTTGGTTTACAACACAACGTTCAAGTCAGGGAATGGACGCAGCAGCATATCG
GAGCTGAAGCAAAACACCACCGTTTACCAACCTGTCTCTCAACTAAGTGCACCCAAAATCCAGGAATTGATACAT
CTGTTGGATGCCGCGCGTGAAGACCCTGAGGAGCTCCGAAAGGCATTCCCACCTGTAACTGGGAAACTGGTCGCC
ATGGGAGATGTGTTCACGAGCTGTAATTGGGTTTTACGTGACCAGGCACCCAAGACAGCAACCAAGCGTATTTTC
CTCATCACGGATGAAGATGATCCTCATTCAGGTCCTGGCAGCAAGCAATTGTTCACGTCGGCACGAACAACATTA
GAGGACCTGATTCAAGCTGGCGTCTCGGTCGAACCCTTCTTCATCAACACTGAGGATAAGCCTTTTGATGTGTCC
AAATTCTATTCCCAAATTCTGTTACCTACGAATTTGGACGCGGAAGAGCAATTGGGCGAAGATCCTTCGCTTCTT
CCTGAATCTATCTCTATATCCCGGGTTGAGGACCTGCTAAGCCAGATGCGAATCCATGAAGCTCCGAAAAGATCC
CTTTTTAACATCCCATTTCAACTTGCCGAGGGATTCGTCATTGGTGTCCAAGGATATGGCTTGGTCACTGAACAA
AAAAAAGGTAATTACAAGTATTTTGCCGACTTAGGCGATCGAATGGAGGTTGCTGTTCCACGTACAGCATATGTG
GATGAGGACCGTCAAGCTGATATAGAAAAAGCGAAAATTGTTTACGGCGTGGGTCAAGGAAAGGGCGATGAAGAA
GAGGAAGATGATAGTCTAGGTGTTGGTATCAAGACAGCTAAGCGAGGTCAACGACCGTTTTACAGTGCAGAAGAT
ATTCGTTCTTTCCGGACGTTGGGTCTCGAGCCCGGAATAAAACTTTTAGGATTCAAGGACAGAGATGAGCTTCGG
TTTGAAGACAACATCAAGCACTCGCACTTTATTTACCCAAATGAGATGTCATATTCTGGTAGCAGAAGGACATTC
AGTGCGCTGTTGAAGTCTATGATTCGGAAGAACAAAGTAGGACTGGCACTTGTCCTCATGCGACGGAACAGTTCC
CCCGTATTTTCTGTCCTCCTCCCACAGGAAGAGCAAACTGACGAAAATGGCTTTACCGAACCACCTGGCATGCAC
CTGATTCACTTGCCTTTCGCTGACGACATTCGTGCTGCTCCCATCGAAGATGCTTTCAGAGCATCCAACCAATTG
AAAGATGCGGCCCGTGCTTGGATCGATAAGTTAAGCGTTAAGAACGGAACATATCCGCCCGATTCGTACCCAAAT
CCTGCGCTTGCTTACCACAATGCACAACTCCAAGCCAGTGCATTTAGAGAGGAGTTTGATGTCGAAGCTTTTGAA
GATATGACCGAACCAAACTTTGAAAAGATCCATAAGCGAGCAGGAAACTTAATGAAGGAGTGGAAGTTGGCCTTA
CTTAACGATAAAACCGCAAATATTGGTGTCGCTACTGCGGGTTCCAAGCGCAAGGCGGATGTCGCCACCAATGAT
GTAGACGAGGCCGAATTCCGCAGCAAGTACCAGGCCGGAACCCTCGGGAAGCTGAAAGTAGGTCAACTCAAAACT
TTTTTGAGTGCGAAAGGCCAGCCTGTTTCCGGAAGGAAGGACGAATTGCTGGCCCGGGTCGCAACTTGGTTCGAC
TCTCATTAA
Gene >Agabi119p4|079050
ATGCCGCCTTACGATGACTGGAATAAGATCGATGAGGAGGATGAGGAAGAAGTTCAAGATACATCTGTGAGTCTC
TTTGGGAATTTCGTCTTCAGTCATGTGTTCACTCATATACTATACGTCACCATAGTTCTTTGAAGGGAAAAAAGA
CGTGATTTTGTTCTGTATTGACTGCTCTGAATCTATGCTTGAACTACGTGAAGACTCGAATCGTGAGGGCATCAA
GACTTGTCACCTTTTTACTGCGTTAGAGGCTGCCATGCAAATCCAGAAACGGAAGATTATTGTCGGACCGAATGA
CTCGGTTGGAATCTTGGTTTACAACACAGTGAGGTTTTACGACGACTGCTGGCGGAACGGCAAATGACATGAGTG
CCAAGACGTTCAAGTCAGGGAATGGACGCAGCAGCATATCGGAGCTGAAGCAAAACACCACCGTTTACCAACCTG
TCTCTCAACTAAGTGCACCCAAAATCCAGGAATTGATACATCTGTTGGATGGTTTGTCAGATCTACGTTATCCCC
AGTTCCTTTCGCTAAAACCATTGAGAAGCCGCGCGTGAAGACCCTGAGGAGCTCCGAAAGGCATTCCCACCTGTA
ACTGGGAAACTGGTCGCCATGGGAGATGTGTTCACGAGCTGTAATTGGGTTTTACGTGACCAGTTCAGCTTTATC
TCCCGCCTGTCGCGTCAAATAAATACTGAGAACTGCTCAGGGCACCCAAGACAGCAACCAAGCGTATTTTCCTCA
TCACGGATGAAGATGATCCTCATTCAGGTCCTGGCAGCAAGCAATTGTTCACGTCGGCACGAACAACATTAGAGG
TCTGCTGAACATTTTACCTGACTAAACGCTCCTCATTCCGGTACAGGACCTGATTCAAGCTGGCGTCTCGGTCGA
ACCCTTCTTCATCAACACTGAGGATAAGCCTTTTGATGTGTCCAAATTCTATTCCGTGAGTGGCGCTTTCTGCGA
CGGTAGTGTGTCTACTAAAGGGCGTAAGTAGCAAATTCTGTTACCTACGAATTTGGACGCGGAAGAGCAATTGGG
CGAAGATCCTTCGCTTCTTCCTGAATCTATCTCTATATCCCGGGTTGAGGACCTGCTAAGCCAGATGCGAATCCA
TGAAGCTCCGAAAAGATCCCTTTTTAACATCCCATTTCAACTTGCCGAGGGATTCGTCATTGGTGTCCAAGGGTG
TGTAGTATATTTGAAGTTGACGACTTCGCCACTAACGCTGCTGGCTTAGATATGGCTTGGTCACTGAACAAAAAA
AAGGTAATTACAAGTATTTTGCCGACTTAGGCGATCGAATGGAGGTTGCTGTTCCACGTACAGCATATGTGGATG
AGGTGGGTGGCCGCAGCTCAGCTGAATTGACCCTATTATTGATCACTTCCAATAGGACCGTCAAGCTGATATAGA
AAAAGCGAAAATTGTTTACGGCGTGGGTCAAGGAAAGGGCGATGAAGAAGAGGAAGATGATAGTCTAGGTGTTGG
TATCAAGACAGCTAAGCGAGGTCAACGAGTGAGTCCAAACGTAACGGTCGAGAGGCGGATTTCCCATGATTTGGC
TAGCCGTTTTACAGTGCAGAAGATATTCGTTCTTTCCGGACGTTGGGTCTCGAGCCCGGTAAGGAGGCTCCATGC
CTCGAGACCATCTCATTTGACAATCGAAATCGCAGGAATAAAACTTTTAGGATTCAAGGACAGAGATGAGCTTCG
GTTTGAAGACAACATCAAGCACTCGCACTTTATTTACCCAAATGAGATGGTATGCGGAACGTTTCTTTATGCACC
GTATCTTTGTGGTCTGATTGCTTGTAGTCATATTCTGGTAGCAGAAGGACATTCAGTGCGCTGTTGAAGTCTATG
ATTCGGAAGAACAAAGTAGGACTGGCACTTGTCCTCATGCGACGGAACAGTTCCCCCGTATTTTCTGTCCTCCTC
CCACAGGTTTGTTTCATGTCATCAATATTTTTTTTTCTAAGCCTCTATACTAGGAAGAGCAAACTGACGAAAATG
GCTTTACCGAACCACCTGGCATGCACCTGATTCACTTGCCTTTCGCTGACGACATTCGTGCTGCTCCCATCGAAG
ATGCTTTCAGAGGTACACCAAACATTTTTTTATCCGACTCCAATTGAATGTTTCTCTCGTTCTTTAGCATCCAAC
CAATTGAAAGATGCGGCCCGTGCTTGGATCGATAAGTTAAGCGTTAAGAACGGAACATATCCGCCCGATTCGTAC
CCAAATCCTGGTAATCAGTCACGTTCACGGCCAAATGTATCCTCCTCCATTTGCTCACTTGTCCTATGTTTAGCG
CTTGCTTACCACAATGCACAACTCCAAGCCAGTGCATTTAGAGAGGAGTTTGATGTCGAAGCTTTTGAAGATATG
ACCGAACCAAACTTTGAAAAGATCCATAAGGTAACGAATGTCCTGTGTTATATCACAAGCGTTTCACGCGCCCTC
TCTTCAGCGAGCAGGAAACTTAATGAAGGAGTGGAAGTTGGCCTTACTTAACGATAAAACCGCAAATATTGGTGT
CGCTACTGCGGGTTCCAAGCGCAAGGCGGTTCGTGTCCTGAATCGCGAATTATTGGATATAGGGCTAATTTGAGT
TGCATGTCCAGGATGTCGCCACCAATGATGTAGACGAGGCCGAATTCCGCAGCAAGTACCAGGCCGGAACCCTCG
GGAAGGTAATTTTTCCCTCACCACGTATATCTGTCCTTACTCATCGCATCTTTGATAGCTGAAAGTAGGTCAACT
CAAAGTAAGCGTTATTCCGCCAAGGTAGTGGATCTGCCCCACACTGACGCCATTCAGACTTTTTTGAGTGCGAAA
GGCCAGCCTGTTTCCGGAAGGAAGGACGAATTGCTGGCCCGGGTCGCAACTTGGTTCGACTCTCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail