Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|078990
Gene name
Locationscaffold_05a:152878..153670
Strand+
Gene length (bp)792
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit 4.9E-25 56 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74882|SDH3_SCHPO Succinate dehydrogenase cytochrome B subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh3 PE=3 SV=1 1 175 7.0E-38
sp|P33421|SDH3_YEAST Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH3 PE=1 SV=1 47 175 8.0E-23
sp|Q04487|SHH3_YEAST Mitochondrial inner membrane protein SHH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHH3 PE=3 SV=1 22 175 1.0E-18
sp|P41955|C560_CAEBR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis briggsae GN=mev-1 PE=2 SV=1 16 170 2.0E-18
sp|P41956|C560_CAEEL Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis elegans GN=mev-1 PE=2 SV=1 16 177 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74882|SDH3_SCHPO Succinate dehydrogenase cytochrome B subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh3 PE=3 SV=1 1 175 7.0E-38
sp|P33421|SDH3_YEAST Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH3 PE=1 SV=1 47 175 8.0E-23
sp|Q04487|SHH3_YEAST Mitochondrial inner membrane protein SHH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHH3 PE=3 SV=1 22 175 1.0E-18
sp|P41955|C560_CAEBR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis briggsae GN=mev-1 PE=2 SV=1 16 170 2.0E-18
sp|P41956|C560_CAEEL Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis elegans GN=mev-1 PE=2 SV=1 16 177 3.0E-18
sp|P70097|C560_CRIGR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Cricetulus griseus GN=SDHC PE=2 SV=1 22 175 3.0E-18
sp|D0VWV4|C560_PIG Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Sus scrofa GN=SDHC PE=1 SV=2 58 175 4.0E-16
sp|P35720|C560_BOVIN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Bos taurus GN=SDHC PE=1 SV=2 57 175 2.0E-15
sp|P41085|DHSC_RICPR Succinate dehydrogenase cytochrome b556 subunit OS=Rickettsia prowazekii (strain Madrid E) GN=sdhC PE=3 SV=1 54 175 9.0E-15
sp|Q92J99|DHSC_RICCN Succinate dehydrogenase cytochrome b556 subunit OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sdhC PE=3 SV=1 54 175 1.0E-14
sp|Q68XP1|DHSC_RICTY Succinate dehydrogenase cytochrome b556 subunit OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sdhC PE=3 SV=1 54 175 2.0E-14
sp|Q8T2T5|C560_DICDI Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Dictyostelium discoideum GN=sdhC PE=3 SV=1 59 177 3.0E-14
sp|Q1RHB5|DHSC_RICBR Succinate dehydrogenase cytochrome b556 subunit OS=Rickettsia bellii (strain RML369-C) GN=sdhC PE=3 SV=1 54 175 1.0E-13
sp|Q99643|C560_HUMAN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Homo sapiens GN=SDHC PE=1 SV=1 58 161 2.0E-13
sp|Q9CZB0|C560_MOUSE Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Mus musculus GN=Sdhc PE=1 SV=1 58 161 2.0E-13
sp|P80481|C560_RECAM Succinate dehydrogenase cytochrome b560 subunit OS=Reclinomonas americana GN=SDH3 PE=3 SV=1 46 173 7.0E-13
sp|Q4UKC1|DHSC_RICFE Succinate dehydrogenase cytochrome b556 subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sdhC PE=3 SV=1 54 175 3.0E-12
sp|P35721|C560_MARPO Succinate dehydrogenase cytochrome b560 subunit OS=Marchantia polymorpha GN=SDH3 PE=3 SV=1 55 169 9.0E-12
sp|P80478|C560_PORPU Succinate dehydrogenase cytochrome b560 subunit OS=Porphyra purpurea GN=SDH3 PE=3 SV=1 56 148 8.0E-09
sp|Q59659|DHSC_PARDE Succinate dehydrogenase cytochrome b556 subunit OS=Paracoccus denitrificans GN=sdhC PE=3 SV=1 53 179 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 78 100 22
2 156 178 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|078990
MMSTKALGIGPALRRTALIPRHGNSMLLTRYMMSKRAIQTESLPPSANDNILNKQRLQRPSSPHFTIYQPQLTWL
GSIANRVTGAALSTLLYGFALAYLVAPTTFDSTHIIELVHQLPESFKYVVKLGLAAPFSFHAINGLRHLAWDTGK
FLSVKGAYMTGYAVLGASAVSTVYLTFFM*
Coding >Agabi119p4|078990
ATGATGTCTACGAAAGCCCTTGGTATAGGTCCTGCGCTCAGACGCACAGCCCTAATCCCCCGTCATGGAAATTCA
ATGCTTCTAACCCGTTACATGATGAGCAAACGGGCGATTCAAACGGAATCTCTTCCACCCTCAGCTAACGACAAT
ATCCTCAACAAACAACGCCTCCAACGTCCCAGCAGCCCCCATTTCACAATCTATCAACCCCAATTAACATGGTTG
GGGTCCATCGCCAATCGTGTCACAGGTGCTGCCCTCAGCACACTTTTATACGGTTTCGCGCTCGCCTATCTCGTG
GCACCAACCACATTCGATAGCACGCATATAATTGAACTCGTTCATCAACTCCCTGAAAGCTTCAAATATGTGGTC
AAGCTTGGGTTGGCCGCTCCGTTCAGTTTCCACGCGATTAATGGGTTGAGACATTTGGCTTGGGATACCGGCAAA
TTTTTGAGCGTGAAAGGGGCTTATATGACGGGATACGCAGTTCTTGGTGCTTCAGCTGTGTCGACTGTATATCTA
ACATTCTTCATGTAA
Transcript >Agabi119p4|078990
ATGATGTCTACGAAAGCCCTTGGTATAGGTCCTGCGCTCAGACGCACAGCCCTAATCCCCCGTCATGGAAATTCA
ATGCTTCTAACCCGTTACATGATGAGCAAACGGGCGATTCAAACGGAATCTCTTCCACCCTCAGCTAACGACAAT
ATCCTCAACAAACAACGCCTCCAACGTCCCAGCAGCCCCCATTTCACAATCTATCAACCCCAATTAACATGGTTG
GGGTCCATCGCCAATCGTGTCACAGGTGCTGCCCTCAGCACACTTTTATACGGTTTCGCGCTCGCCTATCTCGTG
GCACCAACCACATTCGATAGCACGCATATAATTGAACTCGTTCATCAACTCCCTGAAAGCTTCAAATATGTGGTC
AAGCTTGGGTTGGCCGCTCCGTTCAGTTTCCACGCGATTAATGGGTTGAGACATTTGGCTTGGGATACCGGCAAA
TTTTTGAGCGTGAAAGGGGCTTATATGACGGGATACGCAGTTCTTGGTGCTTCAGCTGTGTCGACTGTATATCTA
ACATTCTTCATGTAA
Gene >Agabi119p4|078990
ATGATGTCTACGAAAGCCCTTGGTATAGGTCCTGCGCTCAGACGCACAGCCCTAATCCCCCGTCATGGTGGGTAT
AGTTTTGAACAACAGAACCGCCTTTTCTCATGTCGGCGACAGGAAATTCAATGCTTCTAACCCGTTACATGATGA
GCAAACGGTAAGCCATACCATATCTTCTTTATCCTACCAAGCTTTAACAATGTATCTTTCTTACTAGGGCGATTC
AAACGGAATCTCTTCCACCCTCAGCTAACGACAATATCCTCAACAAACAACGCCTCCAACGTCCCAGCAGCCCCC
ATTTCACAATCTATCAACCCCAATTAACATGGTTGGGGTCCATCGCCAATCGTGTCACAGGTGCTGCCCTCAGCA
CACGTACGTCTTTTCCCTTTTGCCTTTCCACACCAGACTCTCACGCATATATACAAACCCTCAATGTTGATATCC
AGTTTTATACGGTTTCGCGCTCGCCTATCTCGTGGCACCAACCACATTCGATAGCACGCATATAATTGAACTCGT
TCATCAACTCCCTGAAAGCTTCAAATATGTGGTCAAGCTTGGGTTGGCCGCTCCGTTCAGTTTCCACGCGATTAA
TGGGTTGAGACATTTGGCTTGGGATACCGGCAAATGTACGTCTCGTCTCTCTTTGATTTTCTCTCTCTCTCTCGC
TGATTCAGCTACGCTTGTGTTTCTCTAGTTTTGAGCGTGAAAGGGGCTTATATGACGGGATACGCAGTTCTTGGT
GCTTCAGCTGTGTCGACTGTATATCTAACATTCTTCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail