Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|077940
Gene name
Locationscaffold_04:3070320..3077191
Strand+
Gene length (bp)6871
Transcript length (bp)6060
Coding sequence length (bp)6060
Protein length (aa) 2020

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11707 Npa1 Ribosome 60S biogenesis N-terminal 2.8E-100 84 406
PF16201 NopRA1 Nucleolar pre-ribosomal-associated protein 1 2.2E-52 1631 1824

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74415|YJL2_SCHPO Uncharacterized protein C14G10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC14G10.02 PE=4 SV=1 156 759 3.0E-35
sp|P34241|URB1_YEAST Nucleolar pre-ribosomal-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URB1 PE=1 SV=2 55 786 4.0E-26
sp|O60287|NPA1P_HUMAN Nucleolar pre-ribosomal-associated protein 1 OS=Homo sapiens GN=URB1 PE=1 SV=4 1451 1825 3.0E-24
sp|Q571H0|NPA1P_MOUSE Nucleolar pre-ribosomal-associated protein 1 OS=Mus musculus GN=Urb1 PE=1 SV=2 1471 1825 9.0E-22
sp|Q571H0|NPA1P_MOUSE Nucleolar pre-ribosomal-associated protein 1 OS=Mus musculus GN=Urb1 PE=1 SV=2 65 751 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74415|YJL2_SCHPO Uncharacterized protein C14G10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC14G10.02 PE=4 SV=1 156 759 3.0E-35
sp|P34241|URB1_YEAST Nucleolar pre-ribosomal-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URB1 PE=1 SV=2 55 786 4.0E-26
sp|O60287|NPA1P_HUMAN Nucleolar pre-ribosomal-associated protein 1 OS=Homo sapiens GN=URB1 PE=1 SV=4 1451 1825 3.0E-24
sp|Q571H0|NPA1P_MOUSE Nucleolar pre-ribosomal-associated protein 1 OS=Mus musculus GN=Urb1 PE=1 SV=2 1471 1825 9.0E-22
sp|Q571H0|NPA1P_MOUSE Nucleolar pre-ribosomal-associated protein 1 OS=Mus musculus GN=Urb1 PE=1 SV=2 65 751 2.0E-21
sp|O60287|NPA1P_HUMAN Nucleolar pre-ribosomal-associated protein 1 OS=Homo sapiens GN=URB1 PE=1 SV=4 65 725 4.0E-19
sp|O74415|YJL2_SCHPO Uncharacterized protein C14G10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC14G10.02 PE=4 SV=1 1624 1802 8.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|077940
MSTLPPPSKKRKLEQLNKTPKFTTADQLRQALQNQNHSNPNAIVDVLNQIRNQFTIRSDEGVISPQDERLAIAEQ
WLTKNPGAQDIFNLWETSNPRQHNLLVSIISVLAALLPLLSSHYTYHALGYPIVKTLLTQQWMRKLNSYIGGAHN
ELILVTLKLFNAISGFAGGKEKKSLLDAFQWEIKSLPKLLSLRRKGKAEHNPLAKPDIRSLYILFLLSFLDAPTQ
TKNTFLEQHRDAFSSIFKGLAQDHYIFIRHVFEVVWIHFWSDPKIKRTTKIGIFNETTISNLLKIYDRTTSDDGD
MEHVPADLAHHFLLAITSRAGSGICFKDRGWYSREDADDNNNNEKSGKLHNKILANILKTLKVNEDSRQQELARR
ILEACPELVAGYWSSAQLTLEPRLSTKWITNISFFGTIISLPVPSASFFLPNTKNSLYNPTPPPLQTILSNILPS
DISPKLIFSKGLQSASGLVQHCTALALVKCLIKYAEVVEAIKGIEEVLEMGDTEEGLWGKRRREVEKEVRKRVPE
FQVIVGFSQQKAQSVQQQPKPNLIRGALLQESAQRLLLLYHIHLPEVVAEARFDVGKALTSFMLPADAGDEDDVV
KKFNLVQQLHVLQMLKESSNFVWTNKSSNSRTYLYTLLKSYTSSHIPALKSTLLDLLSHLLSNTIFFQETPTEPH
LWLLSLPNLVRAPDATSLDQAKLTDEAESVVTFLEDCIQRCLKTPYRYIEDMQKLPASQSPSSSGELNSDVYPSP
LIITLVEQLEAKLKIGGLLTPSDVLAIVSFLRKLVFRLSSRVRELMFFEAFVAWVVRVIDAEEGRGWCLEYPQTK
MAIRKEMMMMREILNHGELKPSASNLDFEAYLDEVEGLSIGEKSDERMIFAHSIIDRLRFTEGIIPAAEIKRLIL
AVQRHWAPALRDLAQYLPPRSGYLWENHILVGTDVGTPIPAVWLFYDATKEQILDSDYRINFAATFFSGRPSLHS
CLELIRLVEHRVRGVDEDETCGLLSLLSVLIREASLVLKENDLLTLKENLVARQSIVKQLAMKQHLDGRIRAGLR
DMVQGLFDPRSIADRRCISEICAYWLALLQEQLTLGAYDKVGDAAIWVQYLPLEPILHLLDSLTNDDTLLHDHHF
SSLLQSILGVIHSSVEDNVVNQNALRERIPRLLKVRKQLLGLRVVDDLLLLSIDSALPLGYSPYQSWDSESELPG
SLMWLMERAKIRWDQKAQPLGYTLPLDDFLDFDTWTPSTPRIISGLIYKQGFDPRQFENWLGSESCSSCSNEALA
IILQSALDVHHCLSSNMDSLSAKIWVPHFPRITALCFNPSTDAPIRQVSASCIELALDTFADHSEELIGLLRRQV
EEDRGSQPTLEAIRLGLRPDVSRILQEWVLHSLIERLAGDMSLSSDTLQLLNAAGQLLRSCDSIKGHQVETALGI
VIQHHLSRSSPMRLVIECINHTHLKPVAVNRYIQSILNHPHFYKYTNENNSDPDSRSHIIDLLHVLFNLHPTNTC
QITQIEPLLSIYHGTMSKDDIKLFSVFQLFEVQRKTSLAPLFNHWSSSSEIPCSSALDALLSLDAVTVFRTTLHF
PKGRKLSIDAIHSNSHSDAQIYDPIFLMLLVHLVLSEYHPATPFGWIELFRTNVVGLCIRSLSSKDQSVRELGLS
LLASLYECIKGLEFQERVHVSYILNLLRDLFPPSTIGDTLRRLPSYTTLILAHALRGVFYPSNFIYPLTSRFLLQ
RPELDANDVPMLYSMLYSPTDEWKKDRGWIIRFLADGMMSSDDWRVLKRRHAWDLLASLFQSSNEDQALRRGIFE
VIANLTCNRQATMSMIIKSSFLVWLEMQLVRVDDDEDAKWAKILGNIVLIVDHSKLDSVFKEAWKASIFRCLSIL
LSRSEDGLILPLVAPSIFRLGQSSTTLVPELEEAVVFATQAVIALKPLSDAVGDSEETESLKLPGFYPSHAIHES
DHLSRSYWRWLDCVVLLWRITMKPDHKSRSWDLLTSQLLASQLQGRPKHAEIDWVRKEVVRSLRKYSIC*
Coding >Agabi119p4|077940
ATGTCAACTCTTCCACCGCCCTCCAAAAAACGCAAGCTAGAACAACTCAATAAAACACCTAAATTCACTACTGCA
GATCAACTCCGACAAGCTCTCCAAAACCAAAATCATAGTAATCCAAATGCGATCGTTGACGTGCTGAATCAAATA
AGGAATCAATTCACGATAAGATCGGATGAAGGCGTGATTTCACCTCAGGATGAACGATTGGCTATTGCTGAACAA
TGGTTAACGAAGAATCCAGGCGCTCAGGATATTTTCAACTTGTGGGAGACATCTAACCCAAGACAACACAATTTG
CTAGTATCCATAATCTCCGTCCTTGCTGCTCTTCTACCGCTATTATCATCGCATTACACGTATCATGCTCTCGGC
TACCCCATCGTCAAAACCCTATTGACGCAACAGTGGATGAGGAAATTGAATTCGTATATTGGAGGAGCGCATAAC
GAATTGATTCTCGTCACGCTGAAACTTTTCAATGCCATTTCAGGGTTTGCGGGAGGGAAGGAAAAGAAGTCGCTG
CTTGACGCATTTCAATGGGAGATCAAGAGCTTGCCGAAATTATTGTCTCTTAGGAGAAAAGGCAAGGCAGAACAT
AACCCTCTTGCAAAACCAGATATCCGTTCCTTGTACATCCTGTTCTTGCTCTCCTTCCTCGACGCACCAACGCAA
ACGAAAAATACATTCCTAGAACAGCACCGAGACGCGTTTTCATCTATATTCAAAGGTCTTGCTCAAGATCATTAT
ATATTCATTCGTCATGTCTTTGAGGTGGTATGGATTCATTTCTGGTCGGATCCCAAAATCAAACGAACTACCAAA
ATCGGGATTTTCAATGAAACGACTATTTCTAATCTTCTTAAAATATATGACAGGACGACTTCAGATGATGGTGAT
ATGGAACATGTACCAGCGGATTTAGCACACCATTTCCTTCTCGCCATCACTTCACGTGCTGGATCTGGTATCTGT
TTCAAAGATCGTGGATGGTATTCTCGTGAAGATGCCGATGACAACAATAATAACGAAAAGAGTGGAAAGCTGCAC
AACAAGATTCTCGCGAATATATTGAAGACTCTGAAAGTCAACGAAGATTCGCGGCAACAGGAACTTGCGAGGAGA
ATACTCGAAGCTTGTCCGGAGCTCGTCGCGGGGTACTGGTCTTCAGCACAATTGACCTTGGAACCACGACTCTCG
ACTAAATGGATCACCAACATTTCTTTCTTCGGTACCATAATCTCCTTGCCCGTCCCTTCAGCCTCATTCTTCCTT
CCGAACACCAAAAATAGCCTATACAATCCCACTCCCCCTCCACTTCAAACCATCCTCTCGAACATCCTTCCCTCC
GACATTTCTCCAAAACTTATCTTTTCAAAAGGTCTCCAGTCTGCTTCGGGCCTGGTTCAACATTGCACAGCGCTT
GCGTTGGTGAAATGTTTGATCAAGTATGCGGAAGTGGTGGAAGCGATTAAGGGGATTGAAGAGGTTTTGGAGATG
GGCGATACGGAAGAAGGGTTATGGGGAAAGAGGAGACGGGAGGTTGAGAAGGAGGTGAGGAAACGGGTACCCGAA
TTTCAAGTCATCGTTGGATTTTCGCAACAGAAGGCTCAGAGCGTTCAACAACAGCCGAAACCTAACCTCATTCGG
GGCGCGTTGTTGCAAGAAAGTGCACAAAGGTTGCTGTTGCTGTATCATATCCACTTGCCGGAAGTGGTTGCTGAG
GCGAGATTCGATGTCGGAAAGGCCCTCACGAGTTTTATGCTCCCCGCAGATGCTGGAGATGAAGATGATGTCGTG
AAGAAGTTCAACCTGGTTCAGCAATTGCATGTCCTGCAAATGCTGAAGGAGAGCAGCAATTTTGTGTGGACGAAC
AAGTCTTCAAATTCTCGTACATACCTCTATACCCTTCTCAAGTCCTACACTTCATCCCATATTCCTGCTCTTAAA
TCCACTCTCCTCGACCTTCTCTCGCACCTCCTTTCCAATACCATCTTTTTCCAAGAAACGCCTACCGAACCTCAC
CTCTGGCTCTTATCTCTACCAAATCTCGTACGAGCGCCTGATGCCACGTCATTGGATCAAGCGAAACTTACAGAC
GAAGCTGAAAGTGTCGTGACGTTCCTCGAAGATTGTATTCAAAGATGTCTCAAGACGCCTTATCGTTACATTGAA
GACATGCAAAAACTTCCCGCCTCCCAGTCGCCTTCTTCCTCGGGGGAATTGAATTCCGATGTCTATCCGAGTCCC
CTCATTATAACTCTCGTTGAACAATTAGAAGCTAAACTGAAAATCGGAGGATTGCTAACTCCTTCGGATGTATTG
GCTATCGTATCATTTTTGAGGAAATTGGTGTTTAGGTTGTCAAGTCGAGTTAGGGAGTTGATGTTCTTTGAAGCA
TTTGTTGCGTGGGTTGTTCGAGTAATTGACGCTGAGGAGGGGAGAGGGTGGTGTTTGGAATACCCACAGACGAAG
ATGGCCATTAGGAAAGAGATGATGATGATGAGGGAGATACTCAACCATGGGGAGCTCAAGCCTTCTGCATCGAAT
TTAGACTTCGAAGCGTATTTGGATGAAGTCGAAGGTTTATCTATCGGGGAAAAGTCTGATGAGCGCATGATTTTC
GCTCACTCGATAATAGATCGACTTAGATTCACGGAAGGGATAATCCCAGCCGCTGAAATCAAACGGCTCATACTC
GCCGTTCAGAGACATTGGGCTCCTGCGTTGCGAGATCTTGCACAGTATCTTCCTCCTCGGTCAGGTTACCTGTGG
GAGAATCATATATTGGTTGGAACAGACGTTGGCACACCGATACCCGCGGTATGGCTCTTTTACGACGCCACGAAA
GAACAGATCCTCGACTCGGATTACCGAATCAATTTTGCTGCCACTTTTTTTTCCGGCAGACCTTCGTTGCACTCC
TGTTTAGAGCTGATTAGGCTTGTCGAGCATCGGGTACGGGGTGTCGATGAAGATGAAACTTGTGGATTGTTATCT
CTTTTATCTGTGCTTATTCGTGAAGCTTCTTTGGTGTTGAAGGAGAATGATCTGCTTACGTTGAAGGAGAACCTT
GTCGCTCGCCAGAGTATCGTGAAGCAACTCGCTATGAAGCAGCACCTCGATGGGCGAATACGAGCCGGCCTTCGA
GATATGGTGCAAGGTTTGTTCGACCCGCGGTCTATTGCTGATAGGCGGTGTATATCAGAAATTTGTGCTTATTGG
CTGGCACTTCTTCAGGAGCAACTTACTTTGGGTGCATACGATAAAGTTGGCGATGCGGCTATATGGGTGCAATAC
CTTCCGCTAGAACCAATTCTTCATCTTCTGGATAGCCTCACCAACGACGATACACTGTTACACGACCATCATTTC
AGTTCTCTCCTTCAATCTATTCTCGGCGTTATTCATTCATCAGTTGAGGACAACGTGGTCAATCAAAATGCGCTT
CGCGAGCGTATACCCCGACTTCTCAAAGTTCGAAAGCAACTTTTGGGGTTACGTGTAGTGGATGATTTACTGCTC
CTGTCTATCGATTCAGCTCTCCCTCTTGGATACTCCCCTTATCAAAGTTGGGATAGTGAAAGCGAGCTACCTGGT
TCGCTCATGTGGCTTATGGAACGTGCAAAGATACGTTGGGATCAAAAAGCTCAACCCTTGGGATATACCTTACCT
CTTGATGACTTTCTCGACTTCGATACATGGACGCCGTCAACTCCTAGGATCATTTCCGGTCTCATTTACAAACAA
GGTTTTGACCCCCGGCAGTTTGAGAATTGGCTGGGTTCAGAAAGCTGTTCATCATGCTCCAACGAAGCTTTGGCT
ATTATCCTCCAGTCGGCTTTGGACGTCCACCACTGCCTATCATCAAACATGGATTCGCTGAGTGCGAAAATTTGG
GTCCCGCATTTTCCCAGAATCACTGCGTTATGTTTCAACCCCTCTACCGACGCTCCGATACGACAGGTATCGGCA
TCGTGTATAGAACTTGCATTAGATACTTTTGCAGATCATTCGGAGGAGTTAATTGGTCTCTTGAGACGACAGGTG
GAAGAAGATCGGGGCAGTCAACCCACTTTGGAAGCCATCCGACTTGGTTTGCGCCCAGACGTCAGTCGAATATTA
CAAGAATGGGTGCTACATTCGTTGATAGAGAGGCTCGCGGGAGATATGTCATTGTCGTCGGATACATTGCAACTT
CTTAATGCTGCCGGTCAACTCCTTCGATCTTGCGACTCAATCAAGGGCCACCAAGTCGAAACCGCATTGGGAATT
GTCATACAACACCATCTCTCGCGATCTTCTCCCATGCGGCTCGTTATTGAATGTATTAATCATACACATCTGAAG
CCGGTCGCTGTCAATCGGTATATTCAAAGCATCCTCAATCATCCCCATTTCTACAAATACACAAACGAGAATAAC
TCGGATCCCGACTCACGTTCCCACATCATCGACCTTTTGCACGTACTTTTCAACCTTCATCCGACAAATACATGT
CAAATTACTCAAATAGAGCCTCTGCTTTCCATTTATCATGGCACCATGTCAAAGGATGACATCAAATTATTTTCT
GTCTTCCAGCTGTTTGAAGTACAACGGAAAACGTCATTAGCTCCGCTGTTCAACCATTGGTCGTCGTCTAGCGAG
ATCCCATGCTCCTCGGCTCTCGACGCATTGTTATCCCTTGACGCGGTCACGGTTTTTCGGACGACTCTGCACTTT
CCCAAAGGGAGGAAGCTATCAATTGATGCGATACATTCAAACAGTCACTCTGATGCTCAAATATACGATCCAATT
TTTTTGATGTTGCTCGTCCACTTGGTCTTATCTGAATATCATCCAGCAACTCCATTCGGCTGGATTGAGTTGTTC
AGAACAAACGTTGTAGGCCTCTGTATACGGTCGTTGTCGTCGAAGGATCAATCTGTCAGAGAATTAGGTCTTTCT
CTACTCGCTTCGTTATACGAGTGCATTAAAGGCTTGGAATTTCAAGAAAGAGTGCATGTGTCGTACATCCTCAAT
CTCCTCAGAGACCTTTTTCCTCCATCTACCATTGGCGACACGTTACGTCGATTACCATCATATACAACACTCATC
CTGGCCCACGCGCTGCGTGGCGTCTTTTACCCCTCAAATTTCATATATCCTCTCACATCCAGATTTCTCTTACAA
AGACCAGAACTGGATGCGAACGATGTACCTATGCTCTATAGCATGTTGTATAGTCCCACCGATGAGTGGAAAAAG
GACCGTGGCTGGATCATCCGTTTTCTTGCAGACGGTATGATGAGTTCTGATGACTGGAGAGTCCTGAAACGCAGA
CACGCGTGGGATTTACTGGCTAGTCTTTTTCAAAGCTCAAATGAAGACCAGGCGTTACGTCGGGGCATTTTTGAG
GTCATCGCTAACCTAACATGCAATCGTCAAGCAACGATGTCTATGATTATCAAGTCATCCTTCCTCGTTTGGCTC
GAAATGCAGCTGGTAAGGGTGGACGACGACGAGGACGCCAAGTGGGCGAAGATTTTGGGAAACATTGTTCTCATC
GTGGATCACTCCAAGCTTGACTCCGTGTTTAAAGAGGCGTGGAAGGCCAGCATTTTCCGTTGCTTGTCTATATTG
CTATCCCGATCGGAAGATGGCCTGATTCTTCCTCTTGTCGCCCCATCCATTTTTAGACTTGGCCAATCTTCCACC
ACACTAGTCCCAGAGCTGGAAGAGGCCGTTGTTTTTGCAACCCAAGCTGTAATTGCTTTAAAACCCCTCAGTGAT
GCAGTCGGTGACTCCGAAGAGACGGAATCCCTCAAACTCCCTGGTTTTTATCCCAGTCATGCCATACACGAATCT
GACCATCTTTCGCGATCCTACTGGCGTTGGTTGGACTGTGTAGTTCTCCTATGGAGGATCACTATGAAACCTGAT
CACAAGTCACGTTCGTGGGATCTTTTGACCTCTCAACTTTTGGCGAGCCAACTTCAGGGGAGACCGAAGCATGCA
GAAATTGATTGGGTGAGAAAAGAGGTGGTTCGATCACTACGAAAGTATTCTATCTGTTAA
Transcript >Agabi119p4|077940
ATGTCAACTCTTCCACCGCCCTCCAAAAAACGCAAGCTAGAACAACTCAATAAAACACCTAAATTCACTACTGCA
GATCAACTCCGACAAGCTCTCCAAAACCAAAATCATAGTAATCCAAATGCGATCGTTGACGTGCTGAATCAAATA
AGGAATCAATTCACGATAAGATCGGATGAAGGCGTGATTTCACCTCAGGATGAACGATTGGCTATTGCTGAACAA
TGGTTAACGAAGAATCCAGGCGCTCAGGATATTTTCAACTTGTGGGAGACATCTAACCCAAGACAACACAATTTG
CTAGTATCCATAATCTCCGTCCTTGCTGCTCTTCTACCGCTATTATCATCGCATTACACGTATCATGCTCTCGGC
TACCCCATCGTCAAAACCCTATTGACGCAACAGTGGATGAGGAAATTGAATTCGTATATTGGAGGAGCGCATAAC
GAATTGATTCTCGTCACGCTGAAACTTTTCAATGCCATTTCAGGGTTTGCGGGAGGGAAGGAAAAGAAGTCGCTG
CTTGACGCATTTCAATGGGAGATCAAGAGCTTGCCGAAATTATTGTCTCTTAGGAGAAAAGGCAAGGCAGAACAT
AACCCTCTTGCAAAACCAGATATCCGTTCCTTGTACATCCTGTTCTTGCTCTCCTTCCTCGACGCACCAACGCAA
ACGAAAAATACATTCCTAGAACAGCACCGAGACGCGTTTTCATCTATATTCAAAGGTCTTGCTCAAGATCATTAT
ATATTCATTCGTCATGTCTTTGAGGTGGTATGGATTCATTTCTGGTCGGATCCCAAAATCAAACGAACTACCAAA
ATCGGGATTTTCAATGAAACGACTATTTCTAATCTTCTTAAAATATATGACAGGACGACTTCAGATGATGGTGAT
ATGGAACATGTACCAGCGGATTTAGCACACCATTTCCTTCTCGCCATCACTTCACGTGCTGGATCTGGTATCTGT
TTCAAAGATCGTGGATGGTATTCTCGTGAAGATGCCGATGACAACAATAATAACGAAAAGAGTGGAAAGCTGCAC
AACAAGATTCTCGCGAATATATTGAAGACTCTGAAAGTCAACGAAGATTCGCGGCAACAGGAACTTGCGAGGAGA
ATACTCGAAGCTTGTCCGGAGCTCGTCGCGGGGTACTGGTCTTCAGCACAATTGACCTTGGAACCACGACTCTCG
ACTAAATGGATCACCAACATTTCTTTCTTCGGTACCATAATCTCCTTGCCCGTCCCTTCAGCCTCATTCTTCCTT
CCGAACACCAAAAATAGCCTATACAATCCCACTCCCCCTCCACTTCAAACCATCCTCTCGAACATCCTTCCCTCC
GACATTTCTCCAAAACTTATCTTTTCAAAAGGTCTCCAGTCTGCTTCGGGCCTGGTTCAACATTGCACAGCGCTT
GCGTTGGTGAAATGTTTGATCAAGTATGCGGAAGTGGTGGAAGCGATTAAGGGGATTGAAGAGGTTTTGGAGATG
GGCGATACGGAAGAAGGGTTATGGGGAAAGAGGAGACGGGAGGTTGAGAAGGAGGTGAGGAAACGGGTACCCGAA
TTTCAAGTCATCGTTGGATTTTCGCAACAGAAGGCTCAGAGCGTTCAACAACAGCCGAAACCTAACCTCATTCGG
GGCGCGTTGTTGCAAGAAAGTGCACAAAGGTTGCTGTTGCTGTATCATATCCACTTGCCGGAAGTGGTTGCTGAG
GCGAGATTCGATGTCGGAAAGGCCCTCACGAGTTTTATGCTCCCCGCAGATGCTGGAGATGAAGATGATGTCGTG
AAGAAGTTCAACCTGGTTCAGCAATTGCATGTCCTGCAAATGCTGAAGGAGAGCAGCAATTTTGTGTGGACGAAC
AAGTCTTCAAATTCTCGTACATACCTCTATACCCTTCTCAAGTCCTACACTTCATCCCATATTCCTGCTCTTAAA
TCCACTCTCCTCGACCTTCTCTCGCACCTCCTTTCCAATACCATCTTTTTCCAAGAAACGCCTACCGAACCTCAC
CTCTGGCTCTTATCTCTACCAAATCTCGTACGAGCGCCTGATGCCACGTCATTGGATCAAGCGAAACTTACAGAC
GAAGCTGAAAGTGTCGTGACGTTCCTCGAAGATTGTATTCAAAGATGTCTCAAGACGCCTTATCGTTACATTGAA
GACATGCAAAAACTTCCCGCCTCCCAGTCGCCTTCTTCCTCGGGGGAATTGAATTCCGATGTCTATCCGAGTCCC
CTCATTATAACTCTCGTTGAACAATTAGAAGCTAAACTGAAAATCGGAGGATTGCTAACTCCTTCGGATGTATTG
GCTATCGTATCATTTTTGAGGAAATTGGTGTTTAGGTTGTCAAGTCGAGTTAGGGAGTTGATGTTCTTTGAAGCA
TTTGTTGCGTGGGTTGTTCGAGTAATTGACGCTGAGGAGGGGAGAGGGTGGTGTTTGGAATACCCACAGACGAAG
ATGGCCATTAGGAAAGAGATGATGATGATGAGGGAGATACTCAACCATGGGGAGCTCAAGCCTTCTGCATCGAAT
TTAGACTTCGAAGCGTATTTGGATGAAGTCGAAGGTTTATCTATCGGGGAAAAGTCTGATGAGCGCATGATTTTC
GCTCACTCGATAATAGATCGACTTAGATTCACGGAAGGGATAATCCCAGCCGCTGAAATCAAACGGCTCATACTC
GCCGTTCAGAGACATTGGGCTCCTGCGTTGCGAGATCTTGCACAGTATCTTCCTCCTCGGTCAGGTTACCTGTGG
GAGAATCATATATTGGTTGGAACAGACGTTGGCACACCGATACCCGCGGTATGGCTCTTTTACGACGCCACGAAA
GAACAGATCCTCGACTCGGATTACCGAATCAATTTTGCTGCCACTTTTTTTTCCGGCAGACCTTCGTTGCACTCC
TGTTTAGAGCTGATTAGGCTTGTCGAGCATCGGGTACGGGGTGTCGATGAAGATGAAACTTGTGGATTGTTATCT
CTTTTATCTGTGCTTATTCGTGAAGCTTCTTTGGTGTTGAAGGAGAATGATCTGCTTACGTTGAAGGAGAACCTT
GTCGCTCGCCAGAGTATCGTGAAGCAACTCGCTATGAAGCAGCACCTCGATGGGCGAATACGAGCCGGCCTTCGA
GATATGGTGCAAGGTTTGTTCGACCCGCGGTCTATTGCTGATAGGCGGTGTATATCAGAAATTTGTGCTTATTGG
CTGGCACTTCTTCAGGAGCAACTTACTTTGGGTGCATACGATAAAGTTGGCGATGCGGCTATATGGGTGCAATAC
CTTCCGCTAGAACCAATTCTTCATCTTCTGGATAGCCTCACCAACGACGATACACTGTTACACGACCATCATTTC
AGTTCTCTCCTTCAATCTATTCTCGGCGTTATTCATTCATCAGTTGAGGACAACGTGGTCAATCAAAATGCGCTT
CGCGAGCGTATACCCCGACTTCTCAAAGTTCGAAAGCAACTTTTGGGGTTACGTGTAGTGGATGATTTACTGCTC
CTGTCTATCGATTCAGCTCTCCCTCTTGGATACTCCCCTTATCAAAGTTGGGATAGTGAAAGCGAGCTACCTGGT
TCGCTCATGTGGCTTATGGAACGTGCAAAGATACGTTGGGATCAAAAAGCTCAACCCTTGGGATATACCTTACCT
CTTGATGACTTTCTCGACTTCGATACATGGACGCCGTCAACTCCTAGGATCATTTCCGGTCTCATTTACAAACAA
GGTTTTGACCCCCGGCAGTTTGAGAATTGGCTGGGTTCAGAAAGCTGTTCATCATGCTCCAACGAAGCTTTGGCT
ATTATCCTCCAGTCGGCTTTGGACGTCCACCACTGCCTATCATCAAACATGGATTCGCTGAGTGCGAAAATTTGG
GTCCCGCATTTTCCCAGAATCACTGCGTTATGTTTCAACCCCTCTACCGACGCTCCGATACGACAGGTATCGGCA
TCGTGTATAGAACTTGCATTAGATACTTTTGCAGATCATTCGGAGGAGTTAATTGGTCTCTTGAGACGACAGGTG
GAAGAAGATCGGGGCAGTCAACCCACTTTGGAAGCCATCCGACTTGGTTTGCGCCCAGACGTCAGTCGAATATTA
CAAGAATGGGTGCTACATTCGTTGATAGAGAGGCTCGCGGGAGATATGTCATTGTCGTCGGATACATTGCAACTT
CTTAATGCTGCCGGTCAACTCCTTCGATCTTGCGACTCAATCAAGGGCCACCAAGTCGAAACCGCATTGGGAATT
GTCATACAACACCATCTCTCGCGATCTTCTCCCATGCGGCTCGTTATTGAATGTATTAATCATACACATCTGAAG
CCGGTCGCTGTCAATCGGTATATTCAAAGCATCCTCAATCATCCCCATTTCTACAAATACACAAACGAGAATAAC
TCGGATCCCGACTCACGTTCCCACATCATCGACCTTTTGCACGTACTTTTCAACCTTCATCCGACAAATACATGT
CAAATTACTCAAATAGAGCCTCTGCTTTCCATTTATCATGGCACCATGTCAAAGGATGACATCAAATTATTTTCT
GTCTTCCAGCTGTTTGAAGTACAACGGAAAACGTCATTAGCTCCGCTGTTCAACCATTGGTCGTCGTCTAGCGAG
ATCCCATGCTCCTCGGCTCTCGACGCATTGTTATCCCTTGACGCGGTCACGGTTTTTCGGACGACTCTGCACTTT
CCCAAAGGGAGGAAGCTATCAATTGATGCGATACATTCAAACAGTCACTCTGATGCTCAAATATACGATCCAATT
TTTTTGATGTTGCTCGTCCACTTGGTCTTATCTGAATATCATCCAGCAACTCCATTCGGCTGGATTGAGTTGTTC
AGAACAAACGTTGTAGGCCTCTGTATACGGTCGTTGTCGTCGAAGGATCAATCTGTCAGAGAATTAGGTCTTTCT
CTACTCGCTTCGTTATACGAGTGCATTAAAGGCTTGGAATTTCAAGAAAGAGTGCATGTGTCGTACATCCTCAAT
CTCCTCAGAGACCTTTTTCCTCCATCTACCATTGGCGACACGTTACGTCGATTACCATCATATACAACACTCATC
CTGGCCCACGCGCTGCGTGGCGTCTTTTACCCCTCAAATTTCATATATCCTCTCACATCCAGATTTCTCTTACAA
AGACCAGAACTGGATGCGAACGATGTACCTATGCTCTATAGCATGTTGTATAGTCCCACCGATGAGTGGAAAAAG
GACCGTGGCTGGATCATCCGTTTTCTTGCAGACGGTATGATGAGTTCTGATGACTGGAGAGTCCTGAAACGCAGA
CACGCGTGGGATTTACTGGCTAGTCTTTTTCAAAGCTCAAATGAAGACCAGGCGTTACGTCGGGGCATTTTTGAG
GTCATCGCTAACCTAACATGCAATCGTCAAGCAACGATGTCTATGATTATCAAGTCATCCTTCCTCGTTTGGCTC
GAAATGCAGCTGGTAAGGGTGGACGACGACGAGGACGCCAAGTGGGCGAAGATTTTGGGAAACATTGTTCTCATC
GTGGATCACTCCAAGCTTGACTCCGTGTTTAAAGAGGCGTGGAAGGCCAGCATTTTCCGTTGCTTGTCTATATTG
CTATCCCGATCGGAAGATGGCCTGATTCTTCCTCTTGTCGCCCCATCCATTTTTAGACTTGGCCAATCTTCCACC
ACACTAGTCCCAGAGCTGGAAGAGGCCGTTGTTTTTGCAACCCAAGCTGTAATTGCTTTAAAACCCCTCAGTGAT
GCAGTCGGTGACTCCGAAGAGACGGAATCCCTCAAACTCCCTGGTTTTTATCCCAGTCATGCCATACACGAATCT
GACCATCTTTCGCGATCCTACTGGCGTTGGTTGGACTGTGTAGTTCTCCTATGGAGGATCACTATGAAACCTGAT
CACAAGTCACGTTCGTGGGATCTTTTGACCTCTCAACTTTTGGCGAGCCAACTTCAGGGGAGACCGAAGCATGCA
GAAATTGATTGGGTGAGAAAAGAGGTGGTTCGATCACTACGAAAGTATTCTATCTGTTAA
Gene >Agabi119p4|077940
ATGTCAACTCTTCCACCGCCCTCCAAAAAACGCAAGCTAGAACAACTCAATAAAACACCTAAATTCACTACTGCA
GATCAACTCCGACAAGCTCTCCAAAACCAAAATCATAGTAATCCAAATGCGATCGTTGACGGTGCGGAAATGGCT
AGCATCAGCAAAAGAATGTTTACTCTTCTCCAAAGCTGACTAGCACTTTGTTGTTGTTCTTTTTAGTGCTGAATC
AAATAAGGAATCAATTCACGATAAGATCGGATGAAGGCGTGATTTCACCTCAGGATGAACGATTGGCTATTGCTG
AACAATGGTTAACGAAGAATCCAGGCGCTCAGGATATTTTCAACTTGTGGGAGACATCTAACCCAGTAAGTGCTT
AAACCATCCAGAATGAGTATCATCTTACGAAACAATTTACGAGCAGAGACAACACAATTTGCTAGTATCCATAAT
CTCCGTCCTTGCTGCTCTTCTACCGCTATTATCATCGCATTACACGTATCATGCTCTCGGCTACCCCATCGTCAA
AACCCTATTGACGCAACAGTGGATGAGGAAATTGAATTCGTATATTGGAGGAGCGCATAACGAATTGATTCTCGT
CACGCTGAAACTTTTCAATGCCATTTCAGGGTTTGCGGGAGGGAAGGAAAAGAAGTCGCTGCTTGACGCATTTCA
ATGGGAGATCAAGGTGTGTTTGCTCCTTTTTTTGGTCTTTTTTTCTCAATATACATTCTCGTAGAGCTTGCCGAA
ATTATTGTCTCTTAGGAGAAAAGGCAAGGCAGAACATAACCCTCTTGCAAAACCAGGTATGCTTCGAATCGTATC
ATCTCCTGTGCGAAGTACTCACATCTTCTGATAGATATCCGTTCCTTGTACATCCTGTTCTTGCTCTCCTTCCTC
GACGCACCAACGCAAACGAAAAATACATTCCTAGAACAGCACCGAGACGCGTTTTCATCTATATTCAAAGGTCTT
GCTCAAGATCATTATATATTCATTCGTCATGTCTTTGAGGTGGTATGGATTCATTTCTGGTCGGATCCCAAAATC
AAACGAACTACCAAAATCGGGATTTTCAATGAAACGACTATTTCTAATGTATGTTCATTTTCTTGACGTCGTGAA
ATCATCTTTCTCATTAAAATCAGCTTCTTAAAATATATGACAGGACGACTTCAGATGATGGTGATATGGAACATG
TACCAGCGGATTTAGCACACCATTTCCTTCTCGCCATCACTTCACGTGCTGGATCTGGTATCTGTTTCAAAGATC
GTGGATGGTATTCTCGTGAAGATGCCGATGACAACAATAATAACGAAAAGAGTGGAAAGCTGCACAACAAGATTC
TCGCGAATATATTGAAGACTCTGAAAGTCAACGAAGATTCGCGGCAACAGGAACTTGCGAGGAGAATACTCGAAG
CTTGTCCGGAGCTCGTCGCGGGGTGCATATATATACCTTTCCGTCTATCTTCATTAAATAATATGATTGCAGGTA
CTGGTCTTCAGCACAATTGACCTTGGAACCACGACTCTCGACTAAATGGATCACCAACATTTCTTTCTTCGGTAC
CATAATCTCCTTGCCCGTCCCTTCAGCCTCATTCTTCCTTCCGAACACCAAAAATAGCCTATACAATCCCACTCC
CCCTCCACTTCAAACCATCCTCTCGAACATCCTTCCCTCCGACATTTCTCCAAAACTTATCTTTTCAAAAGGTCT
CCAGTCTGCTTCGGGCCTGGTTCAACATTGCACAGCGCTTGCGTTGGTGAAATGTTTGATCAAGTATGCGGAAGT
GGTGGAAGCGATTAAGGGGATTGAAGAGGTTTTGGAGATGGGCGATACGGAAGAAGGGTTATGGGGAAAGAGGAG
ACGGGAGGTTGAGAAGGAGGTGAGGAAACGGGTACCCGAATTTCAAGTCATCGTTGGATTTTCGCAACAGAAGGC
TCAGAGCGTTCAACAACAGCCGAAACCTAACCTCATTCGGGGCGCGTTGTTGCAAGAAAGTGCACAAAGGTTGCT
GTTGCTGTATCATATCCACTTGCCGGAAGTGGTTGCTGAGGCGAGATTCGATGTCGGAAAGGCCCTCACGAGTTT
TATGCTCCCCGCAGATGCTGGAGATGAAGATGATGTCGTGAAGAAGTTCAACCTGGTTCAGCAATTGCATGTCCT
GCAAATGCTGAAGGAGAGCAGCAATTTTGTGTGGACGAACAAGTCTTGTGCGTTACCTTTTTATTTCTCAACTTA
CCTACTGATCTTTCTCCTCAGCAAATTCTCGTACATACCTCTATACCCTTCTCAAGTCCTACACTTCATCCCATA
TTCCTGCTCTTAAATCCACTCTCCTCGACCTTCTCTCGCACCTCCTTTCCAATACCATCTTTTTCCAAGAAACGC
CTACCGAACCTCACCTCTGGCTCTTATCTCTACCAAATCTCGTACGAGCGCCTGATGCCACGTCATTGGATCAAG
CGAAACTTACAGACGAAGCTGAAAGTGTCGTGACGTTCCTCGAAGATTGTATTCAAAGATGTCTCAAGACGCCTT
ATCGTTACATTGAAGACATGCAAAAACTTCCCGCCTCCCAGTCGCCTTCTTCCTCGGGGGAATTGAATTCCGATG
TCTATCCGAGTCCCCTCATTATAACTCTCGTTGAACAATTAGAAGCTAAACTGAAAATCGGAGGATTGCTAACTC
CTTCGGATGTATTGGCTATCGTATCATTTTTGAGGAAATTGGTGTTTAGGTTGTCAAGTCGAGTTAGGGAGTTGA
TGTTCTTTGAAGCATTTGTTGCGTGGGTTGTTCGAGTAATTGACGCTGAGGAGGGGAGAGGGTGGTGTTTGGAAT
ACCCACAGACGAAGATGGCCATTAGGAAAGAGATGATGATGATGAGGGAGATACTCAACCATGGGGAGCTCAAGC
CTTCTGCATCGAATTTAGACTTCGAAGCGTATTTGGATGAAGTCGAAGGTTTATCTATCGGTGAGCAATGCTTCT
CTTTGTGTTGATCAAGTTTCTCATGGCACGGTTTAGGGGAAAAGTCTGATGAGCGCATGATTTTCGCTCACTCGA
TAATAGATCGACTTAGATTCACGGAAGGGATAATCCCAGCCGCTGAAATCAAACGGCTCATACTCGCCGTTCAGA
GACATTGGGCTCCTGCGTTGCGAGATCTTGCACAGTATCTTCCTCCTCGGTCAGGTTACCTGTGGGAGAATCATA
TATTGGTTGGAACAGACGTTGGCACACCGTGAGTAGTCCTCAATTTACAGACTATGGTTCCCTCATAAGACCCTC
TAGGATACCCGCGGTATGGCTCTTTTACGACGCCACGAAAGAACAGATCCTCGACTCGGATTACCGAATCAATTT
TGCTGCCACTTTTTTTTCCGGCAGACCTTCGTTGCACTCCTGTTTAGAGCTGATTAGGCTTGTCGAGCATCGGGT
ACGGGGTGTCGATGAAGATGAAACTTGTGGATTGTTATCTCTTTTATCTGTGCTTATTCGTGAAGCTTCTTTGGT
GTTGAAGGAGAATGATCTGCTTACGTTGAAGGAGAACCTTGTCGCTCGCCAGAGTATCGTGAAGCAACTCGCTAT
GAAGCAGCACCTCGATGGGCGAATACGAGCCGGCCTTCGAGATATGGTGCAAGGTTTGTTCGACCCGCGGTCTAT
TGCTGATAGGCGGTGTATATCAGAAATTTGTGCTTATTGGCTGGCACTTCTTCAGGAGCAACTTACTTTGGGTGC
ATACGATAAAGTAAACATAGTTCAATTTTTGTTTCTTTGAACCACAAACAAATACTAATGAATTTTATAGGTTGG
CGATGCGGCTATATGGGTGCAATACCTTCCGCTAGAACCAATTCTTCATCTTCTGGATAGCCTCACCAACGACGA
TACACTGTTACACGACCATCATTTCAGTTCTCTCCTTCAATCTATTCTCGGCGTTATTCATTCATCAGTTGAGGA
CAACGTGGTCAATCAAAATGCGCTTCGCGAGCGTATACCCCGACTTCTCAAAGTTCGAAAGCAACTTTTGGGGTT
ACGTGTAGTGGATGATTTACTGCTCCTGTCTATCGATTCAGCTCTCCCTCTTGGATACTCCCCTTATCAAAGTTG
GGATAGTGAAAGCGAGCTACCTGGTTCGCTCATGTGGCTTATGGAACGTGCAAAGATACGTTGGGATCAAAAAGC
TCAACCCTTGGGATATACCTTACCTCTTGATGACTTTCTCGACTTCGATACATGGACGCCGTCAACTCCTAGGAT
CATTTCCGGTCTCATTTACAAACAAGGTTTTGACCCCCGGCAGTTTGAGAATTGGCTGGGTTCAGAAAGCTGTTC
ATCATGCTCCAACGAAGCTTTGGCTATTATCCTCCAGTCGGCTTTGGACGTCCACCACTGCCTATCATCAAACAT
GGATTCGCTGAGTGCGAAAATTTGGGTCCCGCATTTTCCCAGAATCACTGCGTTATGTTTCAACCCCTCTACCGA
CGCTCCGATACGACAGGTATCGGCATCGTGTATAGAACTTGCATTAGATACTTTTGCAGATCATTCGGAGGAGTT
AATTGGTCTCTTGAGACGACAGGTGGAAGAAGATCGGGGCAGTCAACCCACTTTGGAAGCCATCCGACTTGGTTT
GCGCCCAGACGTCAGTCGAATATTACAAGAATGGGTGCTACATTCGTTGATAGAGAGGCTCGCGGGAGATATGTC
ATTGTCGTCGGATACATTGCAACTTCTTAATGCTGCCGGTAAGTCGTCATGGACGCTTGTGGTGTTCGTCGCTGA
TAAGCGTTCAGGTCAACTCCTTCGATCTTGCGACTCAATCAAGGGCCACCAAGTCGAAACCGCATTGGGAATTGT
CATACAACACCATCTCTCGCGATCTTCTCCCATGCGGCTCGTTATTGAATGTATTAATCATACACATCTGAAGGT
GTGTCAACCCTGAGCATGGAGATAACCATATCGATGTTGACCCTAATATCAAAGCCGGTCGCTGTCAATCGGTAT
ATTCAAAGCATCCTCAATCATCCCCATTTCTACAAATACACAAACGAGAATAACTCGGATCCCGACTCACGTTCC
CACATCATCGACCTTTTGCACGTACTTTTCAACCTTCATCCGACAAATACATGTCAAATTACTCAAATAGAGCCT
CTGCTTTCCATTTATCATGGCACCATGTCAAAGGATGACATCAAATTATTTTCTGTCTTCCAGCTGTTTGAAGTA
CAACGGAAAACGTCATTAGCTCCGCTGTTCAACCATTGGTCGTCGTCTAGCGAGATCCCATGCTCCTCGGCTCTC
GACGCATTGTTATCCCTTGACGCGGTCACGGTTTTTCGGACGACTCTGCACTTTCCCAAAGGGAGGAAGCTATCA
ATTGATGCGATACATTCAAACAGTCACTCTGATGCTCAAATATACGATCCAATTTTTTTGATGTTGCTCGTCCAC
TTGGTCTTATCTGAATATCATCCAGCAACTCCATTCGGCTGGATTGAGTTGTTCAGAACAAACGTTGTAGGCCTC
TGTATACGGTCGTTGTCGTCGAAGGATCAATCTGTCAGAGAATTAGGTCTTTCTCTACTCGCTTCGTTATACGAG
TGCATTAAAGTAGGCATCGTCTTCTGAGTTCTACTTCTTATTGACTGAGGGTTTTATAGGGCTTGGAATTTCAAG
AAAGAGTGCATGTGTCGTACATCCTCAATCTCCTCAGAGACCTTTTTCCTCCATCTACCATTGGCGACACGTTAC
GTCGATTACCATCATATACAACACTCATCCTGGCCCACGCGCTGCGTGGCGTCTTTTACCCCTCAAATTTCATAT
ATCCTCTCACATCCAGATTTCTCTTACAAAGACCAGAACTGGATGCGAACGATGTACCTATGCTCTATAGCATGT
TGTATAGTCCCACCGATGAGTGGAAAAAGGACCGTGGCTGGATCATCCGTTTTCTTGCAGACGGTATGATGAGTT
CTGATGACTGGAGAGTCCTGAAACGCAGACACGCGTGGGATTTACTGGCTAGTCTTTTTCAAAGCTCAAATGAAG
ACCAGGCGTTACGTCGGGGCATTTTTGAGGTAGGCTGTGCCTCAACTTTGACTTTCTCCTTCATATCTAACGTCG
CCGATCGAAAGGTCATCGCTAACCTAACATGCAATCGTCAAGCAACGATGTCTATGATTATCAAGTCATCCTTCC
TCGTTTGGCTCGAAATGCAGCTGGTAAGGGTGGACGACGACGAGGACGCCAAGTGGGCGAAGATTTTGGGAAACA
TTGTTCTCATCGTGGATCACTCCAAGCTTGACTCCGTGTTTAAAGAGGCGTGGAAGGCCAGCATTTTCCGTTGCT
TGTCTATATTGCTATCCCGATGTGAGCATCGCGCATCTCCGCTGAGAACTTTTGACTAAATTCTTTTCTAGCGGA
AGATGGCCTGATTCTTCCTCTTGTCGCCCCATCCATTTTTAGACTTGGCCAATCTTCCACCACACTAGTCCCAGA
GCTGGAAGAGGCCGTTGTTTTTGCAACCCAAGCTGTAATTGCTTTAAAACCCCTCAGTGATGCAGTCGGTGACTC
CGAAGAGACGGAATCCCTCAAACTCCCTGGTTTTTATCCCAGTCATGCCATACACGAATCTGACCATCTTTCGCG
ATCCTACTGGCGTTGGTTGGACTGTGTAGTTCTCCTATGGAGGATCACTATGAAACCTGATCACAAGTCACGTTC
GTGGGATCTTTTGACCTCTCAACTTTTGGCGAGCCAACTTCAGGGGAGACCGAAGCATGCAGAAATTGATTGGGT
GAGAAAAGAGGTGGTTCGATCACTACGAAAGTATTCTATCTGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail