Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|077800
Gene name
Locationscaffold_04:3033373..3035325
Strand-
Gene length (bp)1952
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00731 AIRC AIR carboxylase 7.5E-63 413 558
PF02222 ATP-grasp ATP-grasp domain 4.9E-58 118 289
PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain 1.5E-18 316 376
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 2.2E-06 109 277

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C017|PUR6_CRYNH Phosphoribosylaminoimidazole carboxylase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=ADE2 PE=2 SV=1 4 575 0.0E+00
sp|P50504|PUR6_SCHOC Phosphoribosylaminoimidazole carboxylase OS=Schwanniomyces occidentalis GN=ADE2 PE=3 SV=1 1 575 0.0E+00
sp|P15567|PUR6_SCHPO Phosphoribosylaminoimidazole carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade6 PE=3 SV=1 3 575 0.0E+00
sp|Q92210|PUR6_CANAL Phosphoribosylaminoimidazole carboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADE2 PE=3 SV=2 1 580 0.0E+00
sp|P0CQ37|PUR6_CRYNB Phosphoribosylaminoimidazole carboxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ADE2 PE=3 SV=1 4 575 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C017|PUR6_CRYNH Phosphoribosylaminoimidazole carboxylase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=ADE2 PE=2 SV=1 4 575 0.0E+00
sp|P50504|PUR6_SCHOC Phosphoribosylaminoimidazole carboxylase OS=Schwanniomyces occidentalis GN=ADE2 PE=3 SV=1 1 575 0.0E+00
sp|P15567|PUR6_SCHPO Phosphoribosylaminoimidazole carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade6 PE=3 SV=1 3 575 0.0E+00
sp|Q92210|PUR6_CANAL Phosphoribosylaminoimidazole carboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADE2 PE=3 SV=2 1 580 0.0E+00
sp|P0CQ37|PUR6_CRYNB Phosphoribosylaminoimidazole carboxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ADE2 PE=3 SV=1 4 575 0.0E+00
sp|P0CQ36|PUR6_CRYNJ Phosphoribosylaminoimidazole carboxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ADE2 PE=3 SV=1 4 575 0.0E+00
sp|Q01930|PUR6_OGAME Phosphoribosylaminoimidazole carboxylase OS=Ogataea methanolica GN=ADE1 PE=3 SV=1 1 544 0.0E+00
sp|O74197|PUR6_CANGA Phosphoribosylaminoimidazole carboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ADE2 PE=3 SV=2 1 575 0.0E+00
sp|P21264|PUR6_YEAST Phosphoribosylaminoimidazole carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE2 PE=1 SV=1 1 575 0.0E+00
sp|P55195|PUR6_VIGAC Phosphoribosylaminoimidazole carboxylase, chloroplastic (Fragment) OS=Vigna aconitifolia GN=PURKE PE=2 SV=1 16 575 7.0E-173
sp|Q54975|PURK_SYNE7 N5-carboxyaminoimidazole ribonucleotide synthase OS=Synechococcus elongatus (strain PCC 7942) GN=purK PE=3 SV=2 4 376 1.0E-75
sp|Q49WI9|PURK_STAS1 N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=purK PE=3 SV=1 13 377 1.0E-66
sp|O58058|PURE_PYRHO N5-carboxyaminoimidazole ribonucleotide mutase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purE PE=3 SV=1 406 575 1.0E-66
sp|Q9WYS7|PURE_THEMA N5-carboxyaminoimidazole ribonucleotide mutase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purE PE=1 SV=1 411 575 1.0E-66
sp|P12045|PURK_BACSU N5-carboxyaminoimidazole ribonucleotide synthase OS=Bacillus subtilis (strain 168) GN=purK PE=3 SV=2 13 372 6.0E-65
sp|Q5HH19|PURK_STAAC N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain COL) GN=purK PE=3 SV=1 13 378 4.0E-64
sp|Q8NX94|PURK_STAAW N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain MW2) GN=purK PE=3 SV=1 13 378 4.0E-64
sp|Q6GAE8|PURK_STAAS N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain MSSA476) GN=purK PE=3 SV=1 13 378 4.0E-64
sp|Q6GI19|PURK_STAAR N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain MRSA252) GN=purK PE=3 SV=1 13 378 1.0E-63
sp|Q7A695|PURK_STAAN N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain N315) GN=purK PE=1 SV=1 13 378 6.0E-63
sp|Q99V32|PURK_STAAM N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purK PE=3 SV=1 13 378 6.0E-63
sp|Q4L574|PURK_STAHJ N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=purK PE=3 SV=2 13 382 3.0E-62
sp|Q8CPP2|PURK_STAES N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purK PE=3 SV=1 13 369 3.0E-61
sp|Q5HQA5|PURK_STAEQ N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purK PE=3 SV=1 13 369 3.0E-61
sp|P72158|PURK_PSEAE N5-carboxyaminoimidazole ribonucleotide synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purK PE=3 SV=2 6 377 1.0E-60
sp|Q9UY68|PURE_PYRAB N5-carboxyaminoimidazole ribonucleotide mutase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purE PE=3 SV=1 411 575 2.0E-60
sp|P9WHL9|PURK_MYCTU N5-carboxyaminoimidazole ribonucleotide synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=purK PE=1 SV=1 5 369 5.0E-58
sp|P9WHL8|PURK_MYCTO N5-carboxyaminoimidazole ribonucleotide synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=purK PE=3 SV=1 5 369 5.0E-58
sp|P65899|PURK_MYCBO N5-carboxyaminoimidazole ribonucleotide synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=purK PE=3 SV=1 5 369 5.0E-58
sp|Q55498|PURE_SYNY3 N5-carboxyaminoimidazole ribonucleotide mutase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purE PE=3 SV=1 406 575 3.0E-57
sp|O66608|PURK_AQUAE N5-carboxyaminoimidazole ribonucleotide synthase OS=Aquifex aeolicus (strain VF5) GN=purK PE=1 SV=1 6 369 9.0E-57
sp|P52559|PURK_BRUME N5-carboxyaminoimidazole ribonucleotide synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=purK PE=3 SV=2 13 364 3.0E-56
sp|P74724|PURK_SYNY3 N5-carboxyaminoimidazole ribonucleotide synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purK PE=3 SV=1 5 370 4.0E-56
sp|P46701|PURK_MYCLE N5-carboxyaminoimidazole ribonucleotide synthase OS=Mycobacterium leprae (strain TN) GN=purK PE=3 SV=1 5 397 2.0E-55
sp|O67239|PURE_AQUAE N5-carboxyaminoimidazole ribonucleotide mutase OS=Aquifex aeolicus (strain VF5) GN=purE PE=3 SV=1 410 569 1.0E-54
sp|Q87KE0|PURK_VIBPA N5-carboxyaminoimidazole ribonucleotide synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purK PE=3 SV=1 8 380 4.0E-54
sp|Q5E1R3|PURK_VIBF1 N5-carboxyaminoimidazole ribonucleotide synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=purK PE=3 SV=1 6 380 5.0E-53
sp|Q54QE4|PURCE_DICDI Bifunctional purine synthesis protein purC/E OS=Dictyostelium discoideum GN=purC/E PE=1 SV=1 5 364 5.0E-53
sp|P12044|PURE_BACSU N5-carboxyaminoimidazole ribonucleotide mutase OS=Bacillus subtilis (strain 168) GN=purE PE=3 SV=1 410 567 6.0E-53
sp|Q7MGL1|PURK_VIBVY N5-carboxyaminoimidazole ribonucleotide synthase OS=Vibrio vulnificus (strain YJ016) GN=purK PE=3 SV=1 8 380 1.0E-52
sp|Q44678|PURK_CORAM N5-carboxyaminoimidazole ribonucleotide synthase OS=Corynebacterium ammoniagenes GN=purK PE=3 SV=1 5 378 1.0E-52
sp|Q8DDD8|PURK_VIBVU N5-carboxyaminoimidazole ribonucleotide synthase OS=Vibrio vulnificus (strain CMCP6) GN=purK PE=3 SV=1 8 380 4.0E-52
sp|Q44679|PURE_CORAM N5-carboxyaminoimidazole ribonucleotide mutase OS=Corynebacterium ammoniagenes GN=purE PE=3 SV=1 411 556 9.0E-51
sp|Q9KVT8|PURK_VIBCH N5-carboxyaminoimidazole ribonucleotide synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=purK PE=3 SV=1 8 380 7.0E-50
sp|P9WHM1|PURE_MYCTU N5-carboxyaminoimidazole ribonucleotide mutase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=purE PE=1 SV=1 410 570 9.0E-48
sp|P9WHM0|PURE_MYCTO N5-carboxyaminoimidazole ribonucleotide mutase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=purE PE=3 SV=1 410 570 9.0E-48
sp|P46702|PURE_MYCLE N5-carboxyaminoimidazole ribonucleotide mutase OS=Mycobacterium leprae (strain TN) GN=purE PE=3 SV=1 410 569 8.0E-47
sp|O06456|PURE_SULSO N5-carboxyaminoimidazole ribonucleotide mutase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=purE PE=3 SV=1 411 561 1.0E-46
sp|P72157|PURE_PSEAE N5-carboxyaminoimidazole ribonucleotide mutase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purE PE=3 SV=2 412 563 6.0E-46
sp|Q5E1R4|PURE_VIBF1 N5-carboxyaminoimidazole ribonucleotide mutase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=purE PE=3 SV=1 413 563 6.0E-44
sp|Q87KE1|PURE_VIBPA N5-carboxyaminoimidazole ribonucleotide mutase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purE PE=3 SV=1 413 561 1.0E-42
sp|Q54QE4|PURCE_DICDI Bifunctional purine synthesis protein purC/E OS=Dictyostelium discoideum GN=purC/E PE=1 SV=1 411 524 3.0E-41
sp|O06457|PURK_SULSO N5-carboxyaminoimidazole ribonucleotide synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=purK PE=3 SV=1 29 381 2.0E-40
sp|P43849|PURE_HAEIN N5-carboxyaminoimidazole ribonucleotide mutase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purE PE=3 SV=1 413 563 2.0E-40
sp|Q9KVT7|PURE_VIBCH N5-carboxyaminoimidazole ribonucleotide mutase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=purE PE=3 SV=1 413 563 1.0E-39
sp|Q7MGL2|PURE_VIBVY N5-carboxyaminoimidazole ribonucleotide mutase OS=Vibrio vulnificus (strain YJ016) GN=purE PE=3 SV=1 413 526 2.0E-39
sp|Q8DDD7|PURE_VIBVU N5-carboxyaminoimidazole ribonucleotide mutase OS=Vibrio vulnificus (strain CMCP6) GN=purE PE=3 SV=1 413 526 2.0E-39
sp|Q8FYW3|PURE_BRUSU N5-carboxyaminoimidazole ribonucleotide mutase OS=Brucella suis biovar 1 (strain 1330) GN=purE PE=3 SV=1 413 526 3.0E-37
sp|P52558|PURE_BRUME N5-carboxyaminoimidazole ribonucleotide mutase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=purE PE=3 SV=2 413 526 6.0E-37
sp|P0AG18|PURE_ECOLI N5-carboxyaminoimidazole ribonucleotide mutase OS=Escherichia coli (strain K12) GN=purE PE=1 SV=2 407 522 4.0E-36
sp|P0AG19|PURE_ECO57 N5-carboxyaminoimidazole ribonucleotide mutase OS=Escherichia coli O157:H7 GN=purE PE=3 SV=2 407 522 4.0E-36
sp|Q58033|PURE_METJA N5-carboxyaminoimidazole ribonucleotide mutase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=purE PE=1 SV=1 412 570 4.0E-35
sp|A3M4Q9|PURT_ACIBT Phosphoribosylglycinamide formyltransferase 2 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=purT PE=3 SV=2 6 370 2.0E-34
sp|A1ANT6|PURT_PELPD Phosphoribosylglycinamide formyltransferase 2 OS=Pelobacter propionicus (strain DSM 2379) GN=purT PE=3 SV=1 8 372 4.0E-34
sp|P43850|PURK_HAEIN N5-carboxyaminoimidazole ribonucleotide synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purK PE=3 SV=1 6 365 5.0E-33
sp|Q2SZW6|PURT_BURTA Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=purT PE=3 SV=2 6 361 1.0E-32
sp|A2BWY5|PURT_PROM5 Phosphoribosylglycinamide formyltransferase 2 OS=Prochlorococcus marinus (strain MIT 9515) GN=purT PE=3 SV=1 8 373 2.0E-32
sp|A0KK42|PURT_AERHH Phosphoribosylglycinamide formyltransferase 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=purT PE=3 SV=1 8 361 2.0E-32
sp|Q47A50|PURT_DECAR Phosphoribosylglycinamide formyltransferase 2 OS=Dechloromonas aromatica (strain RCB) GN=purT PE=3 SV=1 6 383 3.0E-32
sp|C4LDC0|PURT_TOLAT Phosphoribosylglycinamide formyltransferase 2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=purT PE=3 SV=1 8 361 3.0E-32
sp|Q6FAM6|PURT_ACIAD Phosphoribosylglycinamide formyltransferase 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=purT PE=3 SV=1 8 374 6.0E-32
sp|C5CP83|PURT_VARPS Phosphoribosylglycinamide formyltransferase 2 OS=Variovorax paradoxus (strain S110) GN=purT PE=3 SV=1 6 377 9.0E-32
sp|Q0I600|PURT_SYNS3 Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain CC9311) GN=purT PE=3 SV=2 1 361 1.0E-31
sp|Q31DQ3|PURT_THICR Phosphoribosylglycinamide formyltransferase 2 OS=Thiomicrospira crunogena (strain XCL-2) GN=purT PE=3 SV=1 8 361 1.0E-31
sp|Q0SEI4|PURT_RHOJR Phosphoribosylglycinamide formyltransferase 2 OS=Rhodococcus jostii (strain RHA1) GN=purT PE=3 SV=1 6 361 2.0E-31
sp|A1VT89|PURT_POLNA Phosphoribosylglycinamide formyltransferase 2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=purT PE=3 SV=1 6 373 3.0E-31
sp|P39771|PURT_BACSU Phosphoribosylglycinamide formyltransferase 2 OS=Bacillus subtilis (strain 168) GN=purT PE=3 SV=2 6 384 3.0E-31
sp|B1Y650|PURT_LEPCP Phosphoribosylglycinamide formyltransferase 2 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=purT PE=3 SV=1 6 373 3.0E-31
sp|A4SMX4|PURT_AERS4 Phosphoribosylglycinamide formyltransferase 2 OS=Aeromonas salmonicida (strain A449) GN=purT PE=3 SV=1 8 361 6.0E-31
sp|A3N7B6|PURT_BURP6 Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia pseudomallei (strain 668) GN=purT PE=3 SV=1 6 361 7.0E-31
sp|Q3AUF2|PURT_SYNS9 Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain CC9902) GN=purT PE=3 SV=2 4 376 8.0E-31
sp|Q2IJJ5|PURT_ANADE Phosphoribosylglycinamide formyltransferase 2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=purT PE=3 SV=1 8 375 9.0E-31
sp|Q3SKP9|PURT_THIDA Phosphoribosylglycinamide formyltransferase 2 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=purT PE=3 SV=1 6 369 2.0E-30
sp|Q63VY4|PURT_BURPS Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia pseudomallei (strain K96243) GN=purT PE=3 SV=1 6 361 2.0E-30
sp|Q3JUJ4|PURT_BURP1 Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia pseudomallei (strain 1710b) GN=purT PE=3 SV=2 6 361 2.0E-30
sp|A3NT04|PURT_BURP0 Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia pseudomallei (strain 1106a) GN=purT PE=3 SV=1 6 361 2.0E-30
sp|Q7V179|PURT_PROMP Phosphoribosylglycinamide formyltransferase 2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=purT PE=3 SV=1 8 373 2.0E-30
sp|A1SWW0|PURT_PSYIN Phosphoribosylglycinamide formyltransferase 2 OS=Psychromonas ingrahamii (strain 37) GN=purT PE=3 SV=1 8 361 3.0E-30
sp|Q30XN3|PURT_DESAG Phosphoribosylglycinamide formyltransferase 2 OS=Desulfovibrio alaskensis (strain G20) GN=purT PE=3 SV=1 8 361 3.0E-30
sp|P09029|PURK_ECOLI N5-carboxyaminoimidazole ribonucleotide synthase OS=Escherichia coli (strain K12) GN=purK PE=1 SV=2 6 381 3.0E-30
sp|Q39QR8|PURT_GEOMG Phosphoribosylglycinamide formyltransferase 2 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=purT PE=3 SV=1 6 372 4.0E-30
sp|A0R2Y2|PURT_MYCS2 Phosphoribosylglycinamide formyltransferase 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=purT PE=3 SV=1 6 378 5.0E-30
sp|A4T9D5|PURT_MYCGI Phosphoribosylglycinamide formyltransferase 2 OS=Mycobacterium gilvum (strain PYR-GCK) GN=purT PE=3 SV=1 6 361 5.0E-30
sp|A1V2C2|PURT_BURMS Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia mallei (strain SAVP1) GN=purT PE=3 SV=1 6 361 5.0E-30
sp|Q62IF4|PURT_BURMA Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia mallei (strain ATCC 23344) GN=purT PE=3 SV=1 6 361 5.0E-30
sp|A2S4F3|PURT_BURM9 Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia mallei (strain NCTC 10229) GN=purT PE=3 SV=1 6 361 5.0E-30
sp|A3MI07|PURT_BURM7 Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia mallei (strain NCTC 10247) GN=purT PE=3 SV=1 6 361 5.0E-30
sp|Q31AM1|PURT_PROM9 Phosphoribosylglycinamide formyltransferase 2 OS=Prochlorococcus marinus (strain MIT 9312) GN=purT PE=3 SV=1 1 373 5.0E-30
sp|C4XMB3|PURT_DESMR Phosphoribosylglycinamide formyltransferase 2 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=purT PE=3 SV=1 8 361 6.0E-30
sp|Q3A5Q4|PURT_PELCD Phosphoribosylglycinamide formyltransferase 2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=purT PE=3 SV=1 8 385 9.0E-30
sp|A0Q8N2|PURT_FRATN Phosphoribosylglycinamide formyltransferase 2 OS=Francisella tularensis subsp. novicida (strain U112) GN=purT PE=3 SV=1 1 361 1.0E-29
sp|A4IVS8|PURT_FRATW Phosphoribosylglycinamide formyltransferase 2 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=purT PE=3 SV=1 1 361 1.0E-29
sp|A1TE53|PURT_MYCVP Phosphoribosylglycinamide formyltransferase 2 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=purT PE=3 SV=1 6 376 1.0E-29
sp|Q5NE84|PURT_FRATT Phosphoribosylglycinamide formyltransferase 2 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=purT PE=3 SV=1 1 361 2.0E-29
sp|Q14FN7|PURT_FRAT1 Phosphoribosylglycinamide formyltransferase 2 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=purT PE=3 SV=1 1 361 2.0E-29
sp|Q21SJ0|PURT_RHOFT Phosphoribosylglycinamide formyltransferase 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=purT PE=3 SV=1 6 370 2.0E-29
sp|A5GX22|PURT_SYNR3 Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain RCC307) GN=purT PE=3 SV=1 16 376 3.0E-29
sp|Q58881|PURT_METJA Phosphoribosylglycinamide formyltransferase 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=purT PE=3 SV=2 8 376 3.0E-29
sp|A1U3I4|PURT_MARHV Phosphoribosylglycinamide formyltransferase 2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=purT PE=3 SV=2 8 378 4.0E-29
sp|Q55336|PURT_SYNY3 Phosphoribosylglycinamide formyltransferase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purT PE=3 SV=1 4 361 4.0E-29
sp|Q9KSM8|PURT_VIBCH Phosphoribosylglycinamide formyltransferase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=purT PE=3 SV=2 8 361 5.0E-29
sp|C3LLS4|PURT_VIBCM Phosphoribosylglycinamide formyltransferase 2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=purT PE=3 SV=1 8 361 5.0E-29
sp|A3PD91|PURT_PROM0 Phosphoribosylglycinamide formyltransferase 2 OS=Prochlorococcus marinus (strain MIT 9301) GN=purT PE=3 SV=1 1 373 6.0E-29
sp|Q8FMB3|PURT_COREF Phosphoribosylglycinamide formyltransferase 2 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=purT PE=3 SV=2 6 376 6.0E-29
sp|A0K993|PURT_BURCH Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia cenocepacia (strain HI2424) GN=purT PE=3 SV=1 6 361 7.0E-29
sp|Q1BUU4|PURT_BURCA Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=purT PE=3 SV=1 6 361 7.0E-29
sp|Q470L8|PURT_CUPPJ Phosphoribosylglycinamide formyltransferase 2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=purT PE=3 SV=2 6 378 8.0E-29
sp|A7Z0Z2|PURT_BACMF Phosphoribosylglycinamide formyltransferase 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=purT PE=3 SV=1 8 360 9.0E-29
sp|Q6LRI4|PURT_PHOPR Phosphoribosylglycinamide formyltransferase 2 OS=Photobacterium profundum GN=purT PE=3 SV=1 8 361 2.0E-28
sp|Q12FU8|PURT_POLSJ Phosphoribosylglycinamide formyltransferase 2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=purT PE=3 SV=1 6 373 2.0E-28
sp|Q46KI4|PURT_PROMT Phosphoribosylglycinamide formyltransferase 2 OS=Prochlorococcus marinus (strain NATL2A) GN=purT PE=3 SV=1 8 378 2.0E-28
sp|A1S9F3|PURT_SHEAM Phosphoribosylglycinamide formyltransferase 2 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=purT PE=3 SV=1 8 361 3.0E-28
sp|Q7VBB3|PURT_PROMA Phosphoribosylglycinamide formyltransferase 2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=purT PE=3 SV=1 8 361 3.0E-28
sp|B1MKI7|PURT_MYCA9 Phosphoribosylglycinamide formyltransferase 2 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=purT PE=3 SV=1 6 376 3.0E-28
sp|Q8NM23|PURT_CORGL Phosphoribosylglycinamide formyltransferase 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=purT PE=3 SV=2 6 383 4.0E-28
sp|A4QHG1|PURT_CORGB Phosphoribosylglycinamide formyltransferase 2 OS=Corynebacterium glutamicum (strain R) GN=purT PE=3 SV=1 6 383 4.0E-28
sp|A2BRG6|PURT_PROMS Phosphoribosylglycinamide formyltransferase 2 OS=Prochlorococcus marinus (strain AS9601) GN=purT PE=3 SV=1 1 373 4.0E-28
sp|Q6M0Z5|PURT_METMP Phosphoribosylglycinamide formyltransferase 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=purT PE=3 SV=1 8 376 4.0E-28
sp|C6BV99|PURT_DESAD Phosphoribosylglycinamide formyltransferase 2 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=purT PE=3 SV=1 8 376 5.0E-28
sp|Q142Q7|PURT_BURXL Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia xenovorans (strain LB400) GN=purT PE=3 SV=1 6 378 5.0E-28
sp|A2C2S8|PURT_PROM1 Phosphoribosylglycinamide formyltransferase 2 OS=Prochlorococcus marinus (strain NATL1A) GN=purT PE=3 SV=1 8 378 6.0E-28
sp|Q5JFN8|PURT_THEKO Phosphoribosylglycinamide formyltransferase 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=purT PE=3 SV=1 2 370 6.0E-28
sp|Q9CLZ5|PURT_PASMU Phosphoribosylglycinamide formyltransferase 2 OS=Pasteurella multocida (strain Pm70) GN=purT PE=3 SV=1 6 363 6.0E-28
sp|Q0KAH8|PURT_CUPNH Phosphoribosylglycinamide formyltransferase 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=purT PE=3 SV=2 6 378 6.0E-28
sp|Q5E4R4|PURT_VIBF1 Phosphoribosylglycinamide formyltransferase 2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=purT PE=3 SV=1 8 361 7.0E-28
sp|Q0HS20|PURT_SHESR Phosphoribosylglycinamide formyltransferase 2 OS=Shewanella sp. (strain MR-7) GN=purT PE=3 SV=1 8 383 7.0E-28
sp|A4G068|PURT_METM5 Phosphoribosylglycinamide formyltransferase 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=purT PE=3 SV=1 8 376 8.0E-28
sp|Q0BP50|PURT_FRATO Phosphoribosylglycinamide formyltransferase 2 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=purT PE=3 SV=1 1 361 8.0E-28
sp|Q2A5V8|PURT_FRATH Phosphoribosylglycinamide formyltransferase 2 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=purT PE=3 SV=1 1 361 8.0E-28
sp|A7N9C6|PURT_FRATF Phosphoribosylglycinamide formyltransferase 2 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=purT PE=3 SV=1 1 361 8.0E-28
sp|Q7W3K5|PURT_BORPA Phosphoribosylglycinamide formyltransferase 2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=purT PE=3 SV=1 6 376 9.0E-28
sp|B8GRA4|PURT_THISH Phosphoribosylglycinamide formyltransferase 2 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=purT PE=3 SV=1 6 361 1.0E-27
sp|Q606K7|PURT_METCA Phosphoribosylglycinamide formyltransferase 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=purT PE=3 SV=1 6 383 1.0E-27
sp|Q7WEY0|PURT_BORBR Phosphoribosylglycinamide formyltransferase 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=purT PE=3 SV=1 6 376 1.0E-27
sp|B3R259|PURT_CUPTR Phosphoribosylglycinamide formyltransferase 2 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=purT PE=3 SV=1 6 378 1.0E-27
sp|P22348|PURE_METSM Probable N5-carboxyaminoimidazole ribonucleotide mutase OS=Methanobrevibacter smithii GN=purE PE=3 SV=1 411 579 1.0E-27
sp|Q65VI3|PURT_MANSM Phosphoribosylglycinamide formyltransferase 2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=purT PE=3 SV=2 6 363 1.0E-27
sp|O58056|PURT_PYRHO Phosphoribosylglycinamide formyltransferase 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purT PE=1 SV=2 2 384 1.0E-27
sp|B8DJ34|PURT_DESVM Phosphoribosylglycinamide formyltransferase 2 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=purT PE=3 SV=1 8 361 1.0E-27
sp|Q5N3J5|PURT_SYNP6 Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=purT PE=3 SV=1 8 361 2.0E-27
sp|Q31QP9|PURT_SYNE7 Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus elongatus (strain PCC 7942) GN=purT PE=3 SV=1 8 361 2.0E-27
sp|Q2KUD7|PURT_BORA1 Phosphoribosylglycinamide formyltransferase 2 OS=Bordetella avium (strain 197N) GN=purT PE=3 SV=1 8 378 2.0E-27
sp|Q0HFS6|PURT_SHESM Phosphoribosylglycinamide formyltransferase 2 OS=Shewanella sp. (strain MR-4) GN=purT PE=3 SV=1 8 383 2.0E-27
sp|Q39E61|PURT_BURL3 Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=purT PE=3 SV=1 6 361 2.0E-27
sp|B5XQ21|PURT_KLEP3 Phosphoribosylglycinamide formyltransferase 2 OS=Klebsiella pneumoniae (strain 342) GN=purT PE=3 SV=1 6 369 3.0E-27
sp|A0L052|PURT_SHESA Phosphoribosylglycinamide formyltransferase 2 OS=Shewanella sp. (strain ANA-3) GN=purT PE=3 SV=1 8 383 3.0E-27
sp|Q8EBB7|PURT_SHEON Phosphoribosylglycinamide formyltransferase 2 OS=Shewanella oneidensis (strain MR-1) GN=purT PE=3 SV=2 8 383 3.0E-27
sp|Q7W006|PURT_BORPE Phosphoribosylglycinamide formyltransferase 2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=purT PE=3 SV=1 6 376 4.0E-27
sp|Q1LMC7|PURT_CUPMC Phosphoribosylglycinamide formyltransferase 2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=purT PE=3 SV=1 6 384 4.0E-27
sp|A9BNI6|PURT_DELAS Phosphoribosylglycinamide formyltransferase 2 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=purT PE=3 SV=1 6 361 7.0E-27
sp|Q7U3B3|PURT_SYNPX Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain WH8102) GN=purT PE=3 SV=1 4 361 8.0E-27
sp|A1VFP6|PURT_DESVV Phosphoribosylglycinamide formyltransferase 2 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=purT PE=3 SV=1 8 372 1.0E-26
sp|Q72E56|PURT_DESVH Phosphoribosylglycinamide formyltransferase 2 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=purT PE=3 SV=1 8 372 1.0E-26
sp|A4G4X3|PURT_HERAR Phosphoribosylglycinamide formyltransferase 2 OS=Herminiimonas arsenicoxydans GN=purT PE=3 SV=1 6 370 1.0E-26
sp|A1TV10|PURT_ACIAC Phosphoribosylglycinamide formyltransferase 2 OS=Acidovorax citrulli (strain AAC00-1) GN=purT PE=3 SV=1 6 378 1.0E-26
sp|A4JGK4|PURT_BURVG Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=purT PE=3 SV=1 6 361 2.0E-26
sp|B0BQ46|PURT_ACTPJ Phosphoribosylglycinamide formyltransferase 2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=purT PE=3 SV=1 6 363 2.0E-26
sp|Q8G5B0|PURT_BIFLO Phosphoribosylglycinamide formyltransferase 2 OS=Bifidobacterium longum (strain NCC 2705) GN=purT PE=3 SV=2 8 376 2.0E-26
sp|Q9UY67|PURT_PYRAB Phosphoribosylglycinamide formyltransferase 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purT PE=3 SV=1 2 374 3.0E-26
sp|A1BHN0|PURT_CHLPD Phosphoribosylglycinamide formyltransferase 2 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=purT PE=3 SV=1 8 373 3.0E-26
sp|A6VIB2|PURT_METM7 Phosphoribosylglycinamide formyltransferase 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=purT PE=3 SV=1 8 376 3.0E-26
sp|Q981B9|PURT_SULSO Phosphoribosylglycinamide formyltransferase 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=purT PE=3 SV=2 8 378 3.0E-26
sp|Q5LD90|PURT_BACFN Phosphoribosylglycinamide formyltransferase 2 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=purT PE=3 SV=1 8 375 3.0E-26
sp|Q1H1W4|PURT_METFK Phosphoribosylglycinamide formyltransferase 2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=purT PE=3 SV=1 6 361 4.0E-26
sp|Q64UB2|PURT_BACFR Phosphoribosylglycinamide formyltransferase 2 OS=Bacteroides fragilis (strain YCH46) GN=purT PE=3 SV=1 8 375 5.0E-26
sp|Q8U3M7|PURT_PYRFU Phosphoribosylglycinamide formyltransferase 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=purT PE=3 SV=1 2 374 5.0E-26
sp|Q0I203|PURT_HAES1 Phosphoribosylglycinamide formyltransferase 2 OS=Haemophilus somnus (strain 129Pt) GN=purT PE=3 SV=1 6 363 5.0E-26
sp|B2VJA4|PURT_ERWT9 Phosphoribosylglycinamide formyltransferase 2 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=purT PE=3 SV=1 6 361 5.0E-26
sp|A1RMT4|PURT_SHESW Phosphoribosylglycinamide formyltransferase 2 OS=Shewanella sp. (strain W3-18-1) GN=purT PE=3 SV=1 8 383 6.0E-26
sp|Q8KDJ0|PURT_CHLTE Phosphoribosylglycinamide formyltransferase 2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=purT PE=3 SV=1 4 373 8.0E-26
sp|Q8D2R3|PURT_WIGBR Phosphoribosylglycinamide formyltransferase 2 OS=Wigglesworthia glossinidia brevipalpis GN=purT PE=3 SV=1 6 378 1.0E-25
sp|B3GXZ2|PURT_ACTP7 Phosphoribosylglycinamide formyltransferase 2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=purT PE=3 SV=1 6 363 1.0E-25
sp|A3N1B2|PURT_ACTP2 Phosphoribosylglycinamide formyltransferase 2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=purT PE=3 SV=1 6 363 1.0E-25
sp|B2FTB9|PURT_STRMK Phosphoribosylglycinamide formyltransferase 2 OS=Stenotrophomonas maltophilia (strain K279a) GN=purT PE=3 SV=1 8 378 1.0E-25
sp|Q8A9W1|PURT_BACTN Phosphoribosylglycinamide formyltransferase 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=purT PE=3 SV=1 8 375 2.0E-25
sp|Q30UL7|PURT_SULDN Phosphoribosylglycinamide formyltransferase 2 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=purT PE=3 SV=1 2 381 2.0E-25
sp|Q48LW5|PURT_PSE14 Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=purT PE=3 SV=1 8 361 2.0E-25
sp|Q0BD59|PURT_BURCM Phosphoribosylglycinamide formyltransferase 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=purT PE=3 SV=1 6 361 2.0E-25
sp|Q87Q53|PURT_VIBPA Phosphoribosylglycinamide formyltransferase 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purT PE=3 SV=1 8 361 2.0E-25
sp|A7MVH5|PURT_VIBCB Phosphoribosylglycinamide formyltransferase 2 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=purT PE=3 SV=1 8 361 2.0E-25
sp|A6Q186|PURT_NITSB Phosphoribosylglycinamide formyltransferase 2 OS=Nitratiruptor sp. (strain SB155-2) GN=purT PE=3 SV=1 8 369 2.0E-25
sp|Q3AG69|PURT_SYNSC Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain CC9605) GN=purT PE=3 SV=1 4 361 2.0E-25
sp|A6Q6K6|PURT_SULNB Phosphoribosylglycinamide formyltransferase 2 OS=Sulfurovum sp. (strain NBC37-1) GN=purT PE=3 SV=1 8 376 3.0E-25
sp|A9MNE8|PURT_SALAR Phosphoribosylglycinamide formyltransferase 2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=purT PE=3 SV=1 6 361 3.0E-25
sp|A7MEA0|PURT_CROS8 Phosphoribosylglycinamide formyltransferase 2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=purT PE=3 SV=2 6 361 3.0E-25
sp|Q8Z5X3|PURT_SALTI Phosphoribosylglycinamide formyltransferase 2 OS=Salmonella typhi GN=purT PE=3 SV=1 6 361 3.0E-25
sp|B5BH72|PURT_SALPK Phosphoribosylglycinamide formyltransferase 2 OS=Salmonella paratyphi A (strain AKU_12601) GN=purT PE=3 SV=1 6 361 3.0E-25
sp|Q5PIA0|PURT_SALPA Phosphoribosylglycinamide formyltransferase 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=purT PE=3 SV=1 6 361 3.0E-25
sp|A6URA6|PURT_METVS Phosphoribosylglycinamide formyltransferase 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=purT PE=3 SV=1 8 361 3.0E-25
sp|C0Q2G8|PURT_SALPC Phosphoribosylglycinamide formyltransferase 2 OS=Salmonella paratyphi C (strain RKS4594) GN=purT PE=3 SV=1 6 361 4.0E-25
sp|Q57NB7|PURT_SALCH Phosphoribosylglycinamide formyltransferase 2 OS=Salmonella choleraesuis (strain SC-B67) GN=purT PE=3 SV=1 6 361 4.0E-25
sp|A6L404|PURT_BACV8 Phosphoribosylglycinamide formyltransferase 2 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=purT PE=3 SV=1 1 375 5.0E-25
sp|B4SP00|PURT_STRM5 Phosphoribosylglycinamide formyltransferase 2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=purT PE=3 SV=1 8 361 5.0E-25
sp|Q7MK47|PURT_VIBVY Phosphoribosylglycinamide formyltransferase 2 OS=Vibrio vulnificus (strain YJ016) GN=purT PE=3 SV=1 8 361 5.0E-25
sp|Q8DA32|PURT_VIBVU Phosphoribosylglycinamide formyltransferase 2 OS=Vibrio vulnificus (strain CMCP6) GN=purT PE=3 SV=1 8 361 5.0E-25
sp|B4TYQ6|PURT_SALSV Phosphoribosylglycinamide formyltransferase 2 OS=Salmonella schwarzengrund (strain CVM19633) GN=purT PE=3 SV=1 6 361 6.0E-25
sp|B4SVD3|PURT_SALNS Phosphoribosylglycinamide formyltransferase 2 OS=Salmonella newport (strain SL254) GN=purT PE=3 SV=1 6 361 8.0E-25
sp|Q8XCJ9|PURT_ECO57 Phosphoribosylglycinamide formyltransferase 2 OS=Escherichia coli O157:H7 GN=purT PE=3 SV=1 6 372 8.0E-25
sp|B5FSQ0|PURT_SALDC Phosphoribosylglycinamide formyltransferase 2 OS=Salmonella dublin (strain CT_02021853) GN=purT PE=3 SV=1 6 361 8.0E-25
sp|Q8ZNW5|PURT_SALTY Phosphoribosylglycinamide formyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=purT PE=3 SV=1 6 361 8.0E-25
sp|Q886V7|PURT_PSESM Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=purT PE=3 SV=1 8 361 9.0E-25
sp|C6DFT2|PURT_PECCP Phosphoribosylglycinamide formyltransferase 2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=purT PE=3 SV=1 6 372 1.0E-24
sp|Q3M8Q4|PURT_ANAVT Phosphoribosylglycinamide formyltransferase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=purT PE=3 SV=1 4 361 1.0E-24
sp|P41654|PURE_METTH Probable N5-carboxyaminoimidazole ribonucleotide mutase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=purE PE=3 SV=1 410 565 1.0E-24
sp|P46927|PURT_MANHA Phosphoribosylglycinamide formyltransferase 2 OS=Mannheimia haemolytica GN=purT PE=1 SV=1 6 375 1.0E-24
sp|A4Y447|PURT_SHEPC Phosphoribosylglycinamide formyltransferase 2 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=purT PE=3 SV=1 8 383 2.0E-24
sp|A9MUY8|PURT_SALPB Phosphoribosylglycinamide formyltransferase 2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=purT PE=3 SV=1 6 361 2.0E-24
sp|Q6D4B6|PURT_PECAS Phosphoribosylglycinamide formyltransferase 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=purT PE=3 SV=1 6 372 2.0E-24
sp|A6SZI7|PURT_JANMA Phosphoribosylglycinamide formyltransferase 2 OS=Janthinobacterium sp. (strain Marseille) GN=purT PE=3 SV=1 6 372 2.0E-24
sp|A5GPT7|PURT_SYNPW Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain WH7803) GN=purT PE=3 SV=1 8 386 2.0E-24
sp|Q2SJZ8|PURT_HAHCH Phosphoribosylglycinamide formyltransferase 2 OS=Hahella chejuensis (strain KCTC 2396) GN=purT PE=3 SV=1 8 376 3.0E-24
sp|Q2NTH8|PURT_SODGM Phosphoribosylglycinamide formyltransferase 2 OS=Sodalis glossinidius (strain morsitans) GN=purT PE=3 SV=1 6 361 3.0E-24
sp|Q83KS0|PURT_SHIFL Phosphoribosylglycinamide formyltransferase 2 OS=Shigella flexneri GN=purT PE=3 SV=1 6 375 3.0E-24
sp|Q0T3V7|PURT_SHIF8 Phosphoribosylglycinamide formyltransferase 2 OS=Shigella flexneri serotype 5b (strain 8401) GN=purT PE=3 SV=1 6 375 3.0E-24
sp|B4F1Q4|PURT_PROMH Phosphoribosylglycinamide formyltransferase 2 OS=Proteus mirabilis (strain HI4320) GN=purT PE=3 SV=1 6 371 4.0E-24
sp|Q18K60|PURT_HALWD Phosphoribosylglycinamide formyltransferase 2 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=purT PE=3 SV=1 21 361 6.0E-24
sp|Q4ZWZ4|PURT_PSEU2 Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=purT PE=3 SV=1 8 361 7.0E-24
sp|Q07YK6|PURT_SHEFN Phosphoribosylglycinamide formyltransferase 2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=purT PE=3 SV=1 8 361 8.0E-24
sp|Q1RAT6|PURT_ECOUT Phosphoribosylglycinamide formyltransferase 2 OS=Escherichia coli (strain UTI89 / UPEC) GN=purT PE=3 SV=1 6 372 8.0E-24
sp|Q0TGY3|PURT_ECOL5 Phosphoribosylglycinamide formyltransferase 2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=purT PE=3 SV=1 6 372 8.0E-24
sp|A1AC10|PURT_ECOK1 Phosphoribosylglycinamide formyltransferase 2 OS=Escherichia coli O1:K1 / APEC GN=purT PE=3 SV=1 6 372 8.0E-24
sp|Q8EYF0|PURT_LEPIN Phosphoribosylglycinamide formyltransferase 2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=purT PE=3 SV=1 8 361 8.0E-24
sp|Q72LY0|PURT_LEPIC Phosphoribosylglycinamide formyltransferase 2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=purT PE=3 SV=1 8 361 8.0E-24
sp|Q96Y60|PURT_SULTO Phosphoribosylglycinamide formyltransferase 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=purT PE=3 SV=2 16 378 1.0E-23
sp|A6UUH1|PURT_META3 Phosphoribosylglycinamide formyltransferase 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=purT PE=3 SV=1 8 378 1.0E-23
sp|Q32HB3|PURT_SHIDS Phosphoribosylglycinamide formyltransferase 2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=purT PE=3 SV=1 6 372 1.0E-23
sp|B2U494|PURT_SHIB3 Phosphoribosylglycinamide formyltransferase 2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=purT PE=3 SV=1 6 372 1.0E-23
sp|A3D1A0|PURT_SHEB5 Phosphoribosylglycinamide formyltransferase 2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=purT PE=3 SV=1 8 361 2.0E-23
sp|Q322G6|PURT_SHIBS Phosphoribosylglycinamide formyltransferase 2 OS=Shigella boydii serotype 4 (strain Sb227) GN=purT PE=3 SV=1 6 372 2.0E-23
sp|Q8PN36|PURT_XANAC Phosphoribosylglycinamide formyltransferase 2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=purT PE=3 SV=1 8 378 2.0E-23
sp|Q056L2|PURT_LEPBL Phosphoribosylglycinamide formyltransferase 2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=purT PE=3 SV=1 8 361 2.0E-23
sp|Q04P21|PURT_LEPBJ Phosphoribosylglycinamide formyltransferase 2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=purT PE=3 SV=1 8 361 2.0E-23
sp|Q3Z2K0|PURT_SHISS Phosphoribosylglycinamide formyltransferase 2 OS=Shigella sonnei (strain Ss046) GN=purT PE=3 SV=1 6 372 2.0E-23
sp|P33221|PURT_ECOLI Phosphoribosylglycinamide formyltransferase 2 OS=Escherichia coli (strain K12) GN=purT PE=1 SV=3 6 372 2.0E-23
sp|B1XHB7|PURT_ECODH Phosphoribosylglycinamide formyltransferase 2 OS=Escherichia coli (strain K12 / DH10B) GN=purT PE=3 SV=1 6 372 2.0E-23
sp|C4ZZK6|PURT_ECOBW Phosphoribosylglycinamide formyltransferase 2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=purT PE=3 SV=1 6 372 2.0E-23
sp|Q7VNI4|PURT_HAEDU Phosphoribosylglycinamide formyltransferase 2 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=purT PE=3 SV=1 6 375 3.0E-23
sp|Q7M8I0|PURT_WOLSU Phosphoribosylglycinamide formyltransferase 2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=purT PE=3 SV=1 8 381 3.0E-23
sp|Q4KHR3|PURT_PSEF5 Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=purT PE=3 SV=1 8 361 3.0E-23
sp|Q8PBI2|PURT_XANCP Phosphoribosylglycinamide formyltransferase 2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=purT PE=3 SV=1 8 378 4.0E-23
sp|B0RY47|PURT_XANCB Phosphoribosylglycinamide formyltransferase 2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=purT PE=3 SV=1 8 378 4.0E-23
sp|Q4US21|PURT_XANC8 Phosphoribosylglycinamide formyltransferase 2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=purT PE=3 SV=1 8 378 4.0E-23
sp|A6GWP9|PURT_FLAPJ Phosphoribosylglycinamide formyltransferase 2 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=purT PE=3 SV=1 8 361 5.0E-23
sp|Q4JXR6|PURT_CORJK Phosphoribosylglycinamide formyltransferase 2 OS=Corynebacterium jeikeium (strain K411) GN=purT PE=3 SV=1 8 378 5.0E-23
sp|A8ACE0|PURT_IGNH4 Phosphoribosylglycinamide formyltransferase 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=purT PE=3 SV=1 2 384 7.0E-23
sp|C1DDZ2|PURT_AZOVD Phosphoribosylglycinamide formyltransferase 2 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=purT PE=3 SV=1 8 361 7.0E-23
sp|C3K1H6|PURT_PSEFS Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas fluorescens (strain SBW25) GN=purT PE=3 SV=1 8 361 7.0E-23
sp|Q7V3S4|PURT_PROMM Phosphoribosylglycinamide formyltransferase 2 OS=Prochlorococcus marinus (strain MIT 9313) GN=purT PE=3 SV=1 21 361 8.0E-23
sp|B1JP38|PURT_YERPY Phosphoribosylglycinamide formyltransferase 2 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=purT PE=3 SV=1 6 369 8.0E-23
sp|A4TKC7|PURT_YERPP Phosphoribosylglycinamide formyltransferase 2 OS=Yersinia pestis (strain Pestoides F) GN=purT PE=3 SV=1 6 369 8.0E-23
sp|Q1CH54|PURT_YERPN Phosphoribosylglycinamide formyltransferase 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=purT PE=3 SV=1 6 369 8.0E-23
sp|A9R5W9|PURT_YERPG Phosphoribosylglycinamide formyltransferase 2 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=purT PE=3 SV=1 6 369 8.0E-23
sp|Q7CHW4|PURT_YERPE Phosphoribosylglycinamide formyltransferase 2 OS=Yersinia pestis GN=purT PE=3 SV=1 6 369 8.0E-23
sp|Q1C8V8|PURT_YERPA Phosphoribosylglycinamide formyltransferase 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=purT PE=3 SV=1 6 369 8.0E-23
sp|Q66BW5|PURT_YERPS Phosphoribosylglycinamide formyltransferase 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=purT PE=3 SV=1 6 369 9.0E-23
sp|B2K0H3|PURT_YERPB Phosphoribosylglycinamide formyltransferase 2 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=purT PE=3 SV=1 6 369 9.0E-23
sp|Q5GWZ8|PURT_XANOR Phosphoribosylglycinamide formyltransferase 2 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=purT PE=3 SV=2 8 378 9.0E-23
sp|Q2P047|PURT_XANOM Phosphoribosylglycinamide formyltransferase 2 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=purT PE=3 SV=1 8 378 9.0E-23
sp|B2SRI5|PURT_XANOP Phosphoribosylglycinamide formyltransferase 2 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=purT PE=3 SV=1 8 378 9.0E-23
sp|A6WK72|PURT_SHEB8 Phosphoribosylglycinamide formyltransferase 2 OS=Shewanella baltica (strain OS185) GN=purT PE=3 SV=1 8 361 1.0E-22
sp|Q8YXB6|PURT_NOSS1 Phosphoribosylglycinamide formyltransferase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=purT PE=3 SV=1 4 388 1.0E-22
sp|A1K4Y1|PURT_AZOSB Phosphoribosylglycinamide formyltransferase 2 OS=Azoarcus sp. (strain BH72) GN=purT PE=3 SV=1 8 361 1.0E-22
sp|Q4JC46|PURT_SULAC Phosphoribosylglycinamide formyltransferase 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=purT PE=3 SV=1 16 378 2.0E-22
sp|A1JLK9|PURT_YERE8 Phosphoribosylglycinamide formyltransferase 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=purT PE=3 SV=1 6 372 2.0E-22
sp|Q3KHJ9|PURT_PSEPF Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=purT PE=3 SV=1 8 361 3.0E-22
sp|Q3BW63|PURT_XANC5 Phosphoribosylglycinamide formyltransferase 2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=purT PE=3 SV=1 8 378 3.0E-22
sp|Q1I5Y3|PURT_PSEE4 Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas entomophila (strain L48) GN=purT PE=3 SV=1 8 361 3.0E-22
sp|A4VIT1|PURT_PSEU5 Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas stutzeri (strain A1501) GN=purT PE=3 SV=1 8 361 3.0E-21
sp|Q9HXP3|PURT_PSEAE Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purT PE=3 SV=1 8 361 4.0E-21
sp|Q02RM4|PURT_PSEAB Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=purT PE=3 SV=1 8 361 4.0E-21
sp|B7UYK0|PURT_PSEA8 Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas aeruginosa (strain LESB58) GN=purT PE=3 SV=1 8 361 4.0E-21
sp|A1A0S3|PURT_BIFAA Phosphoribosylglycinamide formyltransferase 2 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=purT PE=3 SV=2 8 376 4.0E-21
sp|A6LHW2|PURT_PARD8 Phosphoribosylglycinamide formyltransferase 2 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=purT PE=3 SV=1 8 360 5.0E-21
sp|Q88MW1|PURT_PSEPK Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas putida (strain KT2440) GN=purT PE=3 SV=1 8 361 6.0E-21
sp|Q2N8K3|PURT_ERYLH Phosphoribosylglycinamide formyltransferase 2 OS=Erythrobacter litoralis (strain HTCC2594) GN=purT PE=3 SV=1 8 372 1.0E-20
sp|B0KRH6|PURT_PSEPG Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas putida (strain GB-1) GN=purT PE=3 SV=1 8 361 2.0E-20
sp|A2CE36|PURT_PROM3 Phosphoribosylglycinamide formyltransferase 2 OS=Prochlorococcus marinus (strain MIT 9303) GN=purT PE=3 SV=2 21 361 2.0E-20
sp|B1JDF0|PURT_PSEPW Phosphoribosylglycinamide formyltransferase 2 OS=Pseudomonas putida (strain W619) GN=purT PE=3 SV=1 8 361 3.0E-20
sp|Q0VRD0|PURT_ALCBS Phosphoribosylglycinamide formyltransferase 2 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=purT PE=3 SV=1 6 376 4.0E-20
sp|C5BGW0|PURT_EDWI9 Phosphoribosylglycinamide formyltransferase 2 OS=Edwardsiella ictaluri (strain 93-146) GN=purT PE=3 SV=1 6 378 6.0E-19
sp|P22348|PURE_METSM Probable N5-carboxyaminoimidazole ribonucleotide mutase OS=Methanobrevibacter smithii GN=purE PE=3 SV=1 402 543 2.0E-12
sp|Q73PV9|PURE_TREDE Phosphoribosylaminoimidazole carboxylase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=purE PE=1 SV=1 411 568 3.0E-10
sp|O28997|PURE_ARCFU Phosphoribosylaminoimidazole carboxylase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=purE PE=3 SV=1 415 568 1.0E-09
sp|P41654|PURE_METTH Probable N5-carboxyaminoimidazole ribonucleotide mutase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=purE PE=3 SV=1 407 538 1.0E-08
sp|Q06862|ACCC_NOSS1 Biotin carboxylase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=accC PE=3 SV=1 97 277 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006189 'de novo' IMP biosynthetic process Yes
GO:0009168 purine ribonucleoside monophosphate biosynthetic process No
GO:0005488 binding No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0009167 purine ribonucleoside monophosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0019637 organophosphate metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0009127 purine nucleoside monophosphate biosynthetic process No
GO:0006163 purine nucleotide metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0009156 ribonucleoside monophosphate biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0000166 nucleotide binding No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0006753 nucleoside phosphate metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0009117 nucleotide metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0046040 IMP metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009126 purine nucleoside monophosphate metabolic process No
GO:0009123 nucleoside monophosphate metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0072521 purine-containing compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0044281 small molecule metabolic process No
GO:0009124 nucleoside monophosphate biosynthetic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:0009987 cellular process No
GO:0043168 anion binding No
GO:0071704 organic substance metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0019438 aromatic compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0009161 ribonucleoside monophosphate metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009150 purine ribonucleotide metabolic process No
GO:0006188 IMP biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|077800
MSNQVVGILGGGQLGRMLAASASLLNIKIIILDTGEHAPAKQISAPTASHLSHIDGSFADPEKIRELASKVDVLT
VEIEHVDADALQEIEASTSVEIHPSPSTIKIIQDKLRQKEHLSAHGAPVSQFLGVENTRESLLAAGDALGYPFML
KSRTLAYDGRGNFAVKNASQVEDAIAALGGRPLYAEKWVPFMKEIAVMVVRATHGYVVSYPVVETVHKDNICHLV
FAPLRGRDATLEARARTVAEQAVRSLSGAGIFGVEMFLMENGDIYINEIAPRPHNSGHYTIEACETSQYENHLRA
ILSLPLGSTAMKVPSAVMMNLIGRSSSMKEVETLVQVALTVPGAVVHLYGKSECRKGRKMGHITIVANSDSDIRA
RLRPLLGSMHFSTPEEIDPYAPPPQVFGSGFSSCNPLVGIIMGSDSDLHVMLPAARILDQFEVPYELSIVSAHRT
PDRLVEYARSAATRGLRAIIAGAGGAAHLPGMVAAMTPLPVIGVPVRGSTLDGVDSLHSIVQMPRGIPVATVAIN
NGVNAGLLAVRILSAGSPTLARAMEEYMKNMEKEVLEKVEKLKEVGWEQYQVKRI*
Coding >Agabi119p4|077800
ATGTCGAACCAAGTTGTCGGGATTCTCGGGGGTGGTCAGCTTGGTCGCATGCTGGCCGCATCGGCTTCACTTCTG
AATATCAAAATCATCATCTTAGACACTGGAGAACATGCACCAGCGAAACAAATTTCAGCACCCACAGCTTCTCAC
CTATCTCATATCGATGGCTCATTCGCGGACCCCGAAAAAATTCGTGAACTGGCCTCAAAAGTCGATGTATTGACG
GTAGAAATAGAACACGTCGATGCCGACGCCCTTCAAGAGATCGAAGCGTCCACAAGTGTGGAAATACATCCTAGC
CCTTCGACTATAAAGATCATACAGGACAAGCTTCGTCAAAAGGAACATCTCTCTGCCCACGGCGCTCCAGTCTCT
CAATTCCTAGGCGTAGAAAACACAAGAGAGTCTTTGCTTGCCGCAGGAGATGCACTTGGATACCCCTTCATGCTT
AAAAGTCGCACGCTCGCATATGACGGTCGAGGAAACTTCGCAGTAAAGAATGCCTCACAAGTCGAAGATGCGATT
GCTGCACTTGGAGGACGCCCTCTCTACGCAGAGAAATGGGTACCCTTCATGAAAGAAATCGCAGTCATGGTTGTT
CGTGCCACGCACGGATATGTTGTTTCTTATCCTGTTGTAGAAACTGTCCACAAGGACAATATCTGTCACCTGGTA
TTTGCACCTTTGAGAGGGAGGGATGCGACTTTGGAGGCTCGGGCACGAACGGTTGCGGAGCAGGCTGTTAGGTCG
TTGTCGGGTGCTGGTATTTTCGGTGTGGAAATGTTTTTGATGGAGAACGGCGACATATATATCAACGAAATCGCA
CCTCGCCCCCATAATTCGGGTCACTATACAATCGAGGCATGTGAAACGTCTCAATACGAAAATCATCTACGTGCT
ATTCTCTCCCTTCCTCTGGGATCCACTGCCATGAAAGTACCCTCTGCCGTCATGATGAATCTAATCGGTCGGTCA
TCATCCATGAAGGAGGTAGAAACATTAGTGCAAGTTGCACTGACAGTTCCAGGTGCCGTTGTCCACCTTTACGGA
AAGAGCGAATGTCGAAAAGGTCGTAAAATGGGGCATATCACCATCGTTGCAAATTCTGATTCTGATATTCGAGCT
CGCCTACGGCCGCTACTGGGATCAATGCACTTCTCGACCCCGGAAGAAATTGACCCTTACGCTCCTCCTCCTCAA
GTCTTTGGTTCAGGCTTCTCAAGCTGTAACCCCCTTGTTGGGATTATCATGGGCTCTGATTCTGATTTGCATGTG
ATGTTACCCGCCGCGAGGATACTTGATCAGTTTGAAGTTCCGTATGAGCTCTCCATTGTTTCTGCCCATCGAACT
CCTGATCGTCTGGTTGAATACGCACGCTCCGCCGCAACGAGGGGTTTGCGAGCCATCATAGCAGGAGCAGGAGGT
GCAGCTCATCTACCGGGCATGGTTGCTGCTATGACACCCTTACCTGTCATTGGTGTTCCTGTGAGAGGGAGTACT
CTCGATGGAGTCGATTCACTTCATAGTATCGTGCAAATGCCCCGAGGAATACCTGTTGCTACTGTCGCTATCAAC
AATGGCGTTAACGCCGGCCTGTTGGCGGTCAGGATATTATCTGCTGGATCACCAACGTTGGCTAGAGCGATGGAA
GAATATATGAAAAACATGGAAAAGGAAGTGCTCGAAAAAGTTGAGAAGTTAAAGGAGGTCGGGTGGGAACAGTAT
CAGGTAAAACGAATTTGA
Transcript >Agabi119p4|077800
ATGTCGAACCAAGTTGTCGGGATTCTCGGGGGTGGTCAGCTTGGTCGCATGCTGGCCGCATCGGCTTCACTTCTG
AATATCAAAATCATCATCTTAGACACTGGAGAACATGCACCAGCGAAACAAATTTCAGCACCCACAGCTTCTCAC
CTATCTCATATCGATGGCTCATTCGCGGACCCCGAAAAAATTCGTGAACTGGCCTCAAAAGTCGATGTATTGACG
GTAGAAATAGAACACGTCGATGCCGACGCCCTTCAAGAGATCGAAGCGTCCACAAGTGTGGAAATACATCCTAGC
CCTTCGACTATAAAGATCATACAGGACAAGCTTCGTCAAAAGGAACATCTCTCTGCCCACGGCGCTCCAGTCTCT
CAATTCCTAGGCGTAGAAAACACAAGAGAGTCTTTGCTTGCCGCAGGAGATGCACTTGGATACCCCTTCATGCTT
AAAAGTCGCACGCTCGCATATGACGGTCGAGGAAACTTCGCAGTAAAGAATGCCTCACAAGTCGAAGATGCGATT
GCTGCACTTGGAGGACGCCCTCTCTACGCAGAGAAATGGGTACCCTTCATGAAAGAAATCGCAGTCATGGTTGTT
CGTGCCACGCACGGATATGTTGTTTCTTATCCTGTTGTAGAAACTGTCCACAAGGACAATATCTGTCACCTGGTA
TTTGCACCTTTGAGAGGGAGGGATGCGACTTTGGAGGCTCGGGCACGAACGGTTGCGGAGCAGGCTGTTAGGTCG
TTGTCGGGTGCTGGTATTTTCGGTGTGGAAATGTTTTTGATGGAGAACGGCGACATATATATCAACGAAATCGCA
CCTCGCCCCCATAATTCGGGTCACTATACAATCGAGGCATGTGAAACGTCTCAATACGAAAATCATCTACGTGCT
ATTCTCTCCCTTCCTCTGGGATCCACTGCCATGAAAGTACCCTCTGCCGTCATGATGAATCTAATCGGTCGGTCA
TCATCCATGAAGGAGGTAGAAACATTAGTGCAAGTTGCACTGACAGTTCCAGGTGCCGTTGTCCACCTTTACGGA
AAGAGCGAATGTCGAAAAGGTCGTAAAATGGGGCATATCACCATCGTTGCAAATTCTGATTCTGATATTCGAGCT
CGCCTACGGCCGCTACTGGGATCAATGCACTTCTCGACCCCGGAAGAAATTGACCCTTACGCTCCTCCTCCTCAA
GTCTTTGGTTCAGGCTTCTCAAGCTGTAACCCCCTTGTTGGGATTATCATGGGCTCTGATTCTGATTTGCATGTG
ATGTTACCCGCCGCGAGGATACTTGATCAGTTTGAAGTTCCGTATGAGCTCTCCATTGTTTCTGCCCATCGAACT
CCTGATCGTCTGGTTGAATACGCACGCTCCGCCGCAACGAGGGGTTTGCGAGCCATCATAGCAGGAGCAGGAGGT
GCAGCTCATCTACCGGGCATGGTTGCTGCTATGACACCCTTACCTGTCATTGGTGTTCCTGTGAGAGGGAGTACT
CTCGATGGAGTCGATTCACTTCATAGTATCGTGCAAATGCCCCGAGGAATACCTGTTGCTACTGTCGCTATCAAC
AATGGCGTTAACGCCGGCCTGTTGGCGGTCAGGATATTATCTGCTGGATCACCAACGTTGGCTAGAGCGATGGAA
GAATATATGAAAAACATGGAAAAGGAAGTGCTCGAAAAAGTTGAGAAGTTAAAGGAGGTCGGGTGGGAACAGTAT
CAGGTAAAACGAATTTGA
Gene >Agabi119p4|077800
ATGTCGAACCAAGTTGTCGGGATTCTCGGTGTGCGTAGTTCACTACTCGCGGCATGTTGTTTTATTGATCTCAAT
CGACTTATAGATGCGTTTTGTTGTGCTTTAATAACCTTGTCCAACTGTTAACACTAGGGGGTGGTCAGCTTGGTC
GCATGCTGGCCGCATCGGCTTCACTTCTGAATATCAAAATCATCATCTTAGACACTGGAGAACATGCACCAGCGA
AACAAATTTCAGCACCCACAGCTTCTCACCTATCTCATATCGATGGCTCATTCGCGGACCCCGAAAAAATTCGTG
AACTGGCCTCAAAAGTCGATGTATTGACGGTAGAAATAGAACACGTCGATGCCGACGCCCTTCAAGAGATCGAAG
CGTCCACAAGTGTGGAAATACATCCTAGCCCTTCGACTATAAAGATCATACAGGACAAGCTTCGTCAAAAGGAAC
ATCTCTCTGCCCACGGCGCTCCAGTCTCTCAATTCCTAGGCGTAGAAAACACAAGAGAGTCTTTGCTTGCCGCAG
GAGATGCACTTGGATACCCCTTCATGCTTAAAAGTCGCACGCTCGCATATGACGGTCGAGGAAACTTCGCAGTAA
AGAATGCCTCACAAGTCGAAGATGCGATTGCTGCACTTGGAGGACGCCCTCTCTACGCAGAGAAATGGGTACCCT
TCATGAAAGAAATCGCAGTCATGGTTGTTCGTGCCACGCACGGATATGTTGTTTCTTATCCTGTTGTAGAAACTG
TCCACAAGGACAATATCTGTCACCTGGTATTTGCACCTTTGAGAGGGAGGGATGCGACTTTGGAGGCTCGGGCAC
GAACGGTTGCGGAGCAGGCTGTTAGGTCGTTGTCGGGTGCTGGTATTTTCGGTGTGGAAATGTTTTTGATGGAGA
ACGGTGCGTGTACCTGGCGTCTCAGCCTTATTGACTAGTAACGACTTTGAAGGCGACATATATATCAACGAAATC
GCACCTCGCCCCCATAATTCGGGTCACTATACAATCGAGGCATGTGAAACGTCTCAATACGAAAATCATCTACGT
GCTATTCTCTCCCTTCCTCTGGGATCCACTGCCATGAAAGTACCCTCTGCCGTCATGATGAATCTAATCGGTCGG
TCATCATCCATGAAGGAGGTAGAAACATTAGTGCAAGTTGCACTGACAGTTCCAGGTGCCGTTGTCCACCTTTAC
GGAAAGAGCGAATGTCGAAAAGGTCGTAAAATGGGGCATATCACCATCGTTGCAAATTCTGATTCTGATATTCGA
GCTCGCCTACGGCCGCTACTGGGATCAATGCACTTCTCGACCCCGGAAGAAATTGACCCTTACGCTCCTCCTCCT
CAAGTCTTTGGTTCAGGCTTCTCAAGCTGTAACCCCCTTGTTGGGATTATCATGGGCTCTGATTCTGATTTGCAT
GTGATGTTACCCGCCGCGAGGATACTTGATCAGTTTGAAGTTCCGTATGAGCTCTCCATTGTTTCTGCCCATCGA
ACTCCTGATCGTCTGGTTGAATACGCACGCTCCGCCGCAACGAGGGGTTTGCGAGCCATCATAGCAGGAGCAGGA
GGTGCAGCTCATCTACCGGGCATGGTTGCTGCTATGACACCCTTACCTGTCATTGGTGTTCCTGTGAGAGGGAGT
ACTCTCGATGGAGTCGATTCACTTCATAGTATCGTGCAAATGCCCGTGAGTTGTCAAAATCATATAAATTGGGAT
ATTGACATATTATATTTGTTCGGTAGCGAGGAATACCTGTTGCTACTGTCGCTATCAACAATGGCGTTAACGCCG
GCCTGTTGGCGGTCAGGATATTATCTGCTGGATCACCAACGTTGGCTAGAGCGATGGAAGAATATATGAAAAACA
TGGAAAAGGAAGTGCTCGAAAAAGTTGAGAAGTTAAAGGAGGTCGGGTGGGAACAGTATCAGGTAAAACGAATTT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail