Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|077740
Gene name
Locationscaffold_04:3019802..3021087
Strand+
Gene length (bp)1285
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10503 Esterase_PHB Esterase PHB depolymerase 1.9E-26 42 229
PF00734 CBM_1 Fungal cellulose binding domain 3.5E-12 322 350
PF00326 Peptidase_S9 Prolyl oligopeptidase family 5.6E-06 77 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 21 354 1.0E-103
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 1 354 1.0E-101
sp|B8NBI2|AXE1_ASPFN Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=axeA PE=3 SV=1 21 291 4.0E-98
sp|Q75P26|AXE1_ASPOR Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=axeA PE=1 SV=1 21 291 2.0E-97
sp|A9JPE6|AXE1_ASPFL Probable acetylxylan esterase A OS=Aspergillus flavus GN=axeA PE=3 SV=1 21 291 2.0E-97
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 21 354 1.0E-103
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 1 354 1.0E-101
sp|B8NBI2|AXE1_ASPFN Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=axeA PE=3 SV=1 21 291 4.0E-98
sp|Q75P26|AXE1_ASPOR Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=axeA PE=1 SV=1 21 291 2.0E-97
sp|A9JPE6|AXE1_ASPFL Probable acetylxylan esterase A OS=Aspergillus flavus GN=axeA PE=3 SV=1 21 291 2.0E-97
sp|Q5B037|AXE1_EMENI Acetylxylan esterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=axeA PE=1 SV=2 27 291 1.0E-96
sp|Q9HE18|FAEB_TALFU Feruloyl esterase B OS=Talaromyces funiculosus GN=FAEB PE=1 SV=1 27 354 3.0E-96
sp|Q8NJP6|AXE1_TALPU Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 21 354 3.0E-93
sp|B8M9H9|FAEB_TALSN Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=faeB PE=1 SV=1 27 354 2.0E-91
sp|Q96W96|AXE1_ASPFI Acetylxylan esterase A OS=Aspergillus ficuum GN=axeA PE=1 SV=1 11 290 5.0E-88
sp|A1CSZ8|AXE1_ASPCL Probable acetylxylan esterase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=axeA PE=3 SV=1 21 290 1.0E-87
sp|A2QZI3|AXE1_ASPNC Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=axeA PE=3 SV=1 11 290 2.0E-87
sp|Q92194|AXE1_ASPAW Acetylxylan esterase A OS=Aspergillus awamori GN=axeA PE=1 SV=2 18 290 2.0E-86
sp|Q0C8Z1|AXE1_ASPTN Probable acetylxylan esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=axeA PE=3 SV=1 21 290 2.0E-83
sp|A8PB24|AXE1_COPC7 Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_12850 PE=1 SV=1 27 290 1.0E-70
sp|G2QND5|FAEB_MYCTT Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Fae1a PE=1 SV=1 14 290 1.0E-70
sp|Q9HGR3|FAEB_NEUCR Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fae-1 PE=2 SV=2 26 290 1.0E-67
sp|P52090|PHA1_PAULE Poly(3-hydroxyalkanoate) depolymerase C OS=Paucimonas lemoignei GN=phaZ1 PE=3 SV=1 4 255 3.0E-39
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 304 354 1.0E-11
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 279 354 1.0E-10
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 308 354 2.0E-10
sp|P12625|PHB_RALPI Poly(3-hydroxybutyrate) depolymerase OS=Ralstonia pickettii PE=3 SV=1 4 169 5.0E-10
sp|P19355|GUX1_HYPRU Exoglucanase 1 OS=Hypocrea rufa GN=cbh1 PE=3 SV=2 308 354 3.0E-09
sp|P62695|GUX1_TRIKO Exoglucanase 1 OS=Trichoderma koningii GN=cbh1 PE=3 SV=1 317 354 5.0E-09
sp|P62694|GUX1_HYPJE Exoglucanase 1 OS=Hypocrea jecorina GN=cbh1 PE=1 SV=1 317 354 5.0E-09
sp|B8YG19|XS20E_NEOPA Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum GN=xynS20E PE=1 SV=1 40 214 6.0E-09
sp|Q7SA23|GUX1A_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 295 354 8.0E-09
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 315 354 2.0E-08
sp|B2ADA5|GH6D_PODAN Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GH6D PE=3 SV=1 305 354 3.0E-08
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 315 354 3.0E-08
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 314 354 5.0E-08
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 305 354 1.0E-07
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 314 353 2.0E-07
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 321 354 3.0E-07
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 322 354 4.0E-07
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 321 354 4.0E-07
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 318 354 5.0E-07
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 320 354 8.0E-07
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 323 354 8.0E-07
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 323 354 8.0E-07
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 322 354 1.0E-06
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 320 354 1.0E-06
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 323 354 1.0E-06
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 320 354 2.0E-06
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 320 354 2.0E-06
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 321 354 2.0E-06
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 320 354 2.0E-06
sp|P07981|GUN1_HYPJE Endoglucanase EG-1 OS=Hypocrea jecorina GN=egl1 PE=1 SV=1 322 354 3.0E-06
sp|P43317|GUN5_HYPJE Endoglucanase-5 OS=Hypocrea jecorina GN=egl5 PE=3 SV=1 317 354 4.0E-06
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 322 354 4.0E-06
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 322 354 4.0E-06
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 323 354 4.0E-06
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 323 354 5.0E-06
sp|G2QCS4|CEL7A_MYCTT Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 315 354 5.0E-06
sp|G4MM92|CEL6A_MAGO7 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel6A PE=1 SV=1 321 354 5.0E-06
sp|Q12714|GUN1_TRILO Endoglucanase EG-1 OS=Trichoderma longibrachiatum GN=egl1 PE=3 SV=1 322 354 6.0E-06
sp|A1DNL0|CBHB_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhB PE=3 SV=1 322 354 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008236 serine-type peptidase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0006508 proteolysis Yes
GO:0005576 extracellular region Yes
GO:0016787 hydrolase activity Yes
GO:0030248 cellulose binding Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0030247 polysaccharide binding No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0030246 carbohydrate binding No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0008233 peptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|077740
MFSFSKCLALIAGVVAGVNAAGPLQQQTGSWGANPTNVGFYYYKPASVSSNPALIVAIHYCSGTAQAFYSGTSYA
NLADQHGFIVIYPDAPDAGGCWDVHTTATLTHDGGGDSLAIANMVRFAISNWGVDASRVYMTGLSSGAMMTNVLA
GAYPDLFAAGSAWAGVPYGCFGGPDMWNSACSTGQITKSGQQWGSDVRSGYPGYTGPRPKLEIWQGTLDTTLNYH
NFGEGIKQWTNIFGYSETPTEVDTNWPLPNWTRSVYGPNFRAISAAGVDHNIQIQANQVLDWFGITGGGSTPPTS
SPPTTTTPPSTTTSPNGPAQSQWGQCGGIGWQGPFTCVAGTTCQMINQWYSQCL*
Coding >Agabi119p4|077740
ATGTTCTCCTTTTCTAAATGTCTAGCCTTAATAGCAGGGGTCGTCGCTGGAGTCAATGCGGCAGGCCCTCTACAG
CAACAAACAGGCAGTTGGGGAGCTAATCCCACGAATGTTGGTTTTTACTACTATAAACCAGCTTCCGTATCGTCA
AATCCTGCGCTCATTGTGGCTATTCACTATTGCTCGGGTACTGCGCAAGCTTTTTACTCGGGCACTAGCTATGCC
AACTTAGCTGATCAACACGGATTCATCGTGATATATCCCGATGCGCCCGATGCTGGAGGTTGTTGGGATGTCCAC
ACTACTGCTACACTTACCCATGACGGTGGGGGTGATTCGCTTGCCATCGCAAACATGGTCCGCTTCGCTATCTCG
AACTGGGGAGTTGATGCGAGCCGCGTTTATATGACGGGACTCTCATCTGGAGCTATGATGACTAACGTACTTGCT
GGTGCATACCCCGACCTGTTTGCGGCGGGATCAGCATGGGCTGGTGTTCCATACGGATGCTTCGGCGGTCCGGAC
ATGTGGAATAGCGCCTGTTCCACGGGACAAATCACAAAGTCTGGACAACAATGGGGTAGCGACGTGCGCTCTGGC
TACCCTGGCTATACTGGCCCTCGACCAAAGTTGGAAATATGGCAAGGAACCCTCGATACTACTCTCAATTATCAC
AACTTCGGTGAGGGTATCAAGCAATGGACCAATATATTTGGCTATTCCGAAACTCCGACCGAGGTTGACACGAAT
TGGCCCCTGCCCAACTGGACTCGAAGTGTTTACGGGCCTAACTTTCGGGCCATTAGTGCAGCTGGTGTAGACCAC
AACATCCAAATCCAGGCCAACCAAGTTCTTGACTGGTTCGGAATCACTGGTGGCGGATCAACTCCTCCTACTTCG
TCACCTCCGACTACGACTACCCCTCCTTCTACTACCACTTCACCAAATGGACCAGCTCAAAGTCAATGGGGGCAA
TGTGGCGGGATTGGATGGCAAGGGCCATTCACTTGCGTAGCGGGGACGACTTGTCAGATGATAAACCAATGGTAT
TCACAGTGCCTATGA
Transcript >Agabi119p4|077740
ATGTTCTCCTTTTCTAAATGTCTAGCCTTAATAGCAGGGGTCGTCGCTGGAGTCAATGCGGCAGGCCCTCTACAG
CAACAAACAGGCAGTTGGGGAGCTAATCCCACGAATGTTGGTTTTTACTACTATAAACCAGCTTCCGTATCGTCA
AATCCTGCGCTCATTGTGGCTATTCACTATTGCTCGGGTACTGCGCAAGCTTTTTACTCGGGCACTAGCTATGCC
AACTTAGCTGATCAACACGGATTCATCGTGATATATCCCGATGCGCCCGATGCTGGAGGTTGTTGGGATGTCCAC
ACTACTGCTACACTTACCCATGACGGTGGGGGTGATTCGCTTGCCATCGCAAACATGGTCCGCTTCGCTATCTCG
AACTGGGGAGTTGATGCGAGCCGCGTTTATATGACGGGACTCTCATCTGGAGCTATGATGACTAACGTACTTGCT
GGTGCATACCCCGACCTGTTTGCGGCGGGATCAGCATGGGCTGGTGTTCCATACGGATGCTTCGGCGGTCCGGAC
ATGTGGAATAGCGCCTGTTCCACGGGACAAATCACAAAGTCTGGACAACAATGGGGTAGCGACGTGCGCTCTGGC
TACCCTGGCTATACTGGCCCTCGACCAAAGTTGGAAATATGGCAAGGAACCCTCGATACTACTCTCAATTATCAC
AACTTCGGTGAGGGTATCAAGCAATGGACCAATATATTTGGCTATTCCGAAACTCCGACCGAGGTTGACACGAAT
TGGCCCCTGCCCAACTGGACTCGAAGTGTTTACGGGCCTAACTTTCGGGCCATTAGTGCAGCTGGTGTAGACCAC
AACATCCAAATCCAGGCCAACCAAGTTCTTGACTGGTTCGGAATCACTGGTGGCGGATCAACTCCTCCTACTTCG
TCACCTCCGACTACGACTACCCCTCCTTCTACTACCACTTCACCAAATGGACCAGCTCAAAGTCAATGGGGGCAA
TGTGGCGGGATTGGATGGCAAGGGCCATTCACTTGCGTAGCGGGGACGACTTGTCAGATGATAAACCAATGGTAT
TCACAGTGCCTATGA
Gene >Agabi119p4|077740
ATGTTCTCCTTTTCTAAATGTCTAGCCTTAATAGCAGGGGTCGTCGCTGGAGTCAATGCGGCAGGCCCTCTACAG
CAACAAACAGGCAGTTGGGGAGCTAATCCCACGAATGTTGGTTTTTACTACTATAAACCAGCTTCCGTATCGTCA
AATCCTGCGCTCATTGTGGCTATTCACTATTGCTCGGGTACTGCGCAAGCTTTTTACTCGGGCACTAGCTATGCC
AACTTAGCTGATCAACACGGATTCATCGTGATATATCCCGATGCGCCCGATGCTGGAGGTTGTTGGGATGTCCAC
ACTACTGCTACACTTACCCATGACGGTGGGGGTGATTCGCTTGCCATCGCAAACATGGTCCGCTTCGCTATCTCG
AACTGGGGAGTTGATGCGAGCCGCGTTTATATGACGGGACTCTCATCTGGAGCTATGATGACTAACGTACTTGCT
GGTGCATACCCCGACCTGTTTGCGGCGGGATCAGCATGGGCTGGTGTTCCATACGGATGCTTCGGCGGTCCGGAC
ATGTGGAATAGCGCCTGTTCCACGGGACAAATCACAAAGTCTGGACAACAATGGGTGAGCACGATTTTGCGTAAT
TAAGTCCGTGTTTTTGACAGCCTTTATATCAATCAGGGTAGCGACGTGCGCTCTGGCTACCCTGGCTATACTGGC
CCTCGACCAAAGTTGGAAATATGGCAAGGAACCCTGTGAGTTGATTTGCAACCCAGTCAATAAACGATTGTCTTA
CATGAAACATTCAGCGATACTACTCTCAATTATCACAACTTCGGTGAGGGTATCAAGCAATGGACCAATATATTT
GGCTATTCCGAAACTCCGACCGAGGTTGACACGAATTGGCCCCTGCCCAACTGGACTCGAAGTGTTTACGGGCCT
AACTTTCGGGCCATTAGTGCAGCTGGTGTAGACCACAACATCCAAATCCAGGCCAACCAAGTTCTTGACTGGTTC
GGAATCACTGGTGGCGGATCAACTCCTCCTACTTCGTCACCTCCGACTACGACTACCCCTCCTTCTACTACCACT
TCACCAAATGGACCAGCTCAAAGTCAATGGGGGCAATGTGGCGGGTATGCTGCTTTTTCGGAAATTGGCTCTTGA
CATCATTAGCTGATATTGTCTAGGATTGGATGGCAAGGGCCATTCACTTGCGTAGCGGGGACGACTTGTCAGATG
ATAAACCAATGGTATTCACAGGTACTTTTAACGCCTTCATTCATACCTTCGCCGGTAGATCTAATTTCGACTGTA
GTGCCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail