Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|077640
Gene name
Locationscaffold_04:2985728..2988355
Strand-
Gene length (bp)2627
Transcript length (bp)2370
Coding sequence length (bp)2370
Protein length (aa) 790

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03644 Glyco_hydro_85 Glycosyl hydrolase family 85 2.6E-86 67 399

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SRL4|ENAS2_ARATH Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana GN=ENGASE2 PE=1 SV=1 43 326 3.0E-46
sp|F4JZC2|ENAS1_ARATH Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana GN=ENGASE1 PE=1 SV=1 43 344 6.0E-43
sp|Q8NFI3|ENASE_HUMAN Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens GN=ENGASE PE=1 SV=1 43 617 5.0E-42
sp|Q8BX80|ENASE_MOUSE Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus GN=Engase PE=1 SV=1 43 526 7.0E-40
sp|P0C7A1|ENASE_CHICK Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus GN=ENGASE PE=1 SV=1 13 463 6.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SRL4|ENAS2_ARATH Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana GN=ENGASE2 PE=1 SV=1 43 326 3.0E-46
sp|F4JZC2|ENAS1_ARATH Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana GN=ENGASE1 PE=1 SV=1 43 344 6.0E-43
sp|Q8NFI3|ENASE_HUMAN Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens GN=ENGASE PE=1 SV=1 43 617 5.0E-42
sp|Q8BX80|ENASE_MOUSE Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus GN=Engase PE=1 SV=1 43 526 7.0E-40
sp|P0C7A1|ENASE_CHICK Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus GN=ENGASE PE=1 SV=1 13 463 6.0E-39
sp|A1L251|ENASE_DANRE Cytosolic endo-beta-N-acetylglucosaminidase OS=Danio rerio GN=engase PE=2 SV=1 16 403 1.0E-35
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0033925 mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|077640
MPTTNLLPAKDQFFQSLAELDAYQTKKQSERPAVSQTTEWTPRKSPALGSRGRLLVCHDYKGGYVEDPQGLSYTF
NYWSLCESFVYFSHHRVTIPPPGWVNAAHRQGVKMLGVLIFEGDAQAEALRLIVGKLPQTSGSLQSSAPSTLPIS
SHYAIALADLAAERGFDGYLLNFECVLTGGVEQARSLAAWITLLQSELVKRVGPHAETVWYDSVIFTGSLAWQNR
LNSFNLPFFIPSTSFFSNYSWSPSFTDISVQYYNSLDSQLIGLASDSRSKTLQDVLMGIDVWGRGSYGGGGFGCY
KSLNHITPAHLSTALFAQAWTWETRENESDFTWDLWWNYERDLWVGNPDPNAVIPVPSIPTPDEGPYKPLSTFFS
RLPPPDPDDVPFHTTFCPGVGRSWFVAGVPVHQYPVGWMDVDKQTTMGDLIWPIPTLTLEGNSEGPLPDVAASVD
MTDSWNSGTSIRLLFTDKEINPDHSFRSFSFPIQTLTVTTQKSYTASIIYKLIPDGTTTFELSTALSIVPLQTGD
TFTQDQMRAMTCAISPNSVTTTELTNDWVKSTMEFIIADTPPGIVSLDCSIGLTLAITSSQISPFPLTLLLGQLN
VHSTPSSTIQPNFPRILWSDFSSSSVQFNDGSTREVTNVNWQPATSLSQVGPITITSPEDPNSAWTPQPPLEKQW
WPGFVYFNVYASPPPSPTTSSGISLIQLPNRQHQHLLQLPSDTNPIPGLIWLGTSGPDNSLTKGNFQFSFDRTQL
PGELRELPTLRVYVQGILDTGEILDGDSSAFVDVTFPIA*
Coding >Agabi119p4|077640
ATGCCTACCACCAATCTTTTGCCTGCTAAGGATCAATTTTTTCAGTCTTTGGCTGAACTAGACGCGTATCAGACG
AAGAAACAGTCTGAGCGACCCGCTGTCAGCCAAACGACCGAGTGGACACCAAGAAAGTCCCCGGCCCTAGGATCA
CGAGGAAGACTTCTAGTTTGCCATGATTACAAGGGAGGGTATGTAGAAGATCCCCAAGGCCTCTCTTATACGTTT
AATTATTGGTCCCTCTGCGAATCATTTGTCTATTTCTCTCATCACCGTGTTACTATACCCCCTCCGGGATGGGTC
AACGCGGCTCATCGTCAAGGAGTCAAGATGCTTGGCGTCTTGATATTTGAAGGCGACGCCCAAGCGGAAGCCCTC
CGTTTGATTGTAGGTAAACTCCCTCAAACTTCAGGCTCGCTGCAATCATCTGCGCCCTCAACTTTACCAATATCC
TCTCATTACGCTATCGCTCTTGCCGATCTTGCCGCAGAGAGGGGCTTCGATGGATATCTCCTCAATTTTGAATGT
GTATTGACTGGAGGTGTTGAACAAGCTCGAAGCCTCGCCGCCTGGATTACTCTTCTTCAATCGGAGCTCGTCAAA
CGCGTCGGTCCCCATGCTGAGACGGTTTGGTATGATAGTGTTATATTTACCGGAAGCTTGGCATGGCAAAATCGG
TTGAATTCTTTCAATTTGCCGTTCTTCATCCCGTCTACCAGTTTCTTTTCAAACTACTCGTGGAGTCCCTCCTTT
ACCGACATAAGCGTTCAATATTACAACTCTCTAGACTCTCAACTTATCGGCCTTGCGTCCGATAGCAGATCCAAG
ACTCTTCAGGATGTCCTCATGGGGATAGACGTCTGGGGCCGAGGTTCCTATGGTGGAGGAGGATTTGGATGTTAT
AAATCCCTGAACCACATCACTCCAGCCCATCTCAGCACAGCTCTATTTGCTCAGGCTTGGACTTGGGAAACCAGA
GAAAATGAGTCTGACTTCACTTGGGATCTTTGGTGGAACTATGAGCGGGATCTCTGGGTCGGAAACCCTGATCCT
AATGCTGTCATACCCGTACCGAGTATTCCCACCCCCGACGAAGGGCCGTATAAACCTCTCAGCACGTTCTTTTCT
CGACTTCCTCCTCCTGATCCGGATGATGTTCCATTCCATACGACTTTTTGTCCCGGAGTTGGACGTTCTTGGTTC
GTTGCTGGAGTTCCAGTGCATCAGTACCCTGTCGGATGGATGGACGTCGATAAACAGACTACCATGGGGGATTTA
ATTTGGCCAATCCCCACTCTTACGTTGGAGGGAAACTCCGAGGGACCTTTACCTGACGTCGCTGCTTCTGTCGAT
ATGACTGATTCATGGAATAGTGGCACTTCTATACGCCTCCTTTTCACCGATAAGGAAATCAATCCAGATCACTCC
TTCCGTTCGTTCTCATTCCCTATCCAAACTCTGACTGTCACCACTCAGAAGAGCTATACTGCGAGTATCATATAC
AAACTCATACCTGATGGCACCACTACGTTCGAACTCAGCACCGCACTCTCTATTGTCCCGCTTCAAACCGGGGAC
ACGTTCACTCAGGACCAGATGCGCGCTATGACCTGCGCTATTTCACCTAACTCGGTCACCACCACTGAACTCACA
AATGACTGGGTGAAATCTACAATGGAATTTATCATCGCCGATACACCTCCCGGCATCGTATCTCTCGATTGTTCT
ATCGGTCTCACCCTTGCAATCACATCCTCCCAGATATCACCATTCCCACTCACTCTTCTCCTCGGCCAACTGAAC
GTCCACAGCACACCTTCTTCAACAATCCAACCCAACTTCCCTCGTATTCTCTGGTCCGATTTCTCCAGTTCTTCA
GTTCAATTTAACGATGGTAGTACCAGAGAGGTGACGAACGTCAATTGGCAACCGGCTACATCGTTATCTCAAGTT
GGTCCTATCACGATCACTTCACCTGAAGATCCGAACAGCGCTTGGACTCCACAACCTCCTTTAGAGAAACAATGG
TGGCCTGGATTCGTATACTTCAATGTTTACGCCTCCCCACCTCCTTCTCCCACCACCTCTTCCGGTATCAGTCTC
ATCCAACTGCCAAATCGACAACACCAACATTTACTCCAATTACCATCCGATACCAATCCGATACCAGGATTAATC
TGGCTAGGAACCTCTGGCCCGGACAACTCTCTCACCAAAGGCAACTTTCAATTCTCTTTTGACAGAACTCAACTT
CCAGGCGAGTTGAGAGAGTTACCTACGCTTAGAGTGTATGTCCAAGGTATACTTGATACCGGAGAAATTTTGGAT
GGGGATAGTTCGGCTTTCGTTGATGTTACATTCCCAATTGCTTGA
Transcript >Agabi119p4|077640
ATGCCTACCACCAATCTTTTGCCTGCTAAGGATCAATTTTTTCAGTCTTTGGCTGAACTAGACGCGTATCAGACG
AAGAAACAGTCTGAGCGACCCGCTGTCAGCCAAACGACCGAGTGGACACCAAGAAAGTCCCCGGCCCTAGGATCA
CGAGGAAGACTTCTAGTTTGCCATGATTACAAGGGAGGGTATGTAGAAGATCCCCAAGGCCTCTCTTATACGTTT
AATTATTGGTCCCTCTGCGAATCATTTGTCTATTTCTCTCATCACCGTGTTACTATACCCCCTCCGGGATGGGTC
AACGCGGCTCATCGTCAAGGAGTCAAGATGCTTGGCGTCTTGATATTTGAAGGCGACGCCCAAGCGGAAGCCCTC
CGTTTGATTGTAGGTAAACTCCCTCAAACTTCAGGCTCGCTGCAATCATCTGCGCCCTCAACTTTACCAATATCC
TCTCATTACGCTATCGCTCTTGCCGATCTTGCCGCAGAGAGGGGCTTCGATGGATATCTCCTCAATTTTGAATGT
GTATTGACTGGAGGTGTTGAACAAGCTCGAAGCCTCGCCGCCTGGATTACTCTTCTTCAATCGGAGCTCGTCAAA
CGCGTCGGTCCCCATGCTGAGACGGTTTGGTATGATAGTGTTATATTTACCGGAAGCTTGGCATGGCAAAATCGG
TTGAATTCTTTCAATTTGCCGTTCTTCATCCCGTCTACCAGTTTCTTTTCAAACTACTCGTGGAGTCCCTCCTTT
ACCGACATAAGCGTTCAATATTACAACTCTCTAGACTCTCAACTTATCGGCCTTGCGTCCGATAGCAGATCCAAG
ACTCTTCAGGATGTCCTCATGGGGATAGACGTCTGGGGCCGAGGTTCCTATGGTGGAGGAGGATTTGGATGTTAT
AAATCCCTGAACCACATCACTCCAGCCCATCTCAGCACAGCTCTATTTGCTCAGGCTTGGACTTGGGAAACCAGA
GAAAATGAGTCTGACTTCACTTGGGATCTTTGGTGGAACTATGAGCGGGATCTCTGGGTCGGAAACCCTGATCCT
AATGCTGTCATACCCGTACCGAGTATTCCCACCCCCGACGAAGGGCCGTATAAACCTCTCAGCACGTTCTTTTCT
CGACTTCCTCCTCCTGATCCGGATGATGTTCCATTCCATACGACTTTTTGTCCCGGAGTTGGACGTTCTTGGTTC
GTTGCTGGAGTTCCAGTGCATCAGTACCCTGTCGGATGGATGGACGTCGATAAACAGACTACCATGGGGGATTTA
ATTTGGCCAATCCCCACTCTTACGTTGGAGGGAAACTCCGAGGGACCTTTACCTGACGTCGCTGCTTCTGTCGAT
ATGACTGATTCATGGAATAGTGGCACTTCTATACGCCTCCTTTTCACCGATAAGGAAATCAATCCAGATCACTCC
TTCCGTTCGTTCTCATTCCCTATCCAAACTCTGACTGTCACCACTCAGAAGAGCTATACTGCGAGTATCATATAC
AAACTCATACCTGATGGCACCACTACGTTCGAACTCAGCACCGCACTCTCTATTGTCCCGCTTCAAACCGGGGAC
ACGTTCACTCAGGACCAGATGCGCGCTATGACCTGCGCTATTTCACCTAACTCGGTCACCACCACTGAACTCACA
AATGACTGGGTGAAATCTACAATGGAATTTATCATCGCCGATACACCTCCCGGCATCGTATCTCTCGATTGTTCT
ATCGGTCTCACCCTTGCAATCACATCCTCCCAGATATCACCATTCCCACTCACTCTTCTCCTCGGCCAACTGAAC
GTCCACAGCACACCTTCTTCAACAATCCAACCCAACTTCCCTCGTATTCTCTGGTCCGATTTCTCCAGTTCTTCA
GTTCAATTTAACGATGGTAGTACCAGAGAGGTGACGAACGTCAATTGGCAACCGGCTACATCGTTATCTCAAGTT
GGTCCTATCACGATCACTTCACCTGAAGATCCGAACAGCGCTTGGACTCCACAACCTCCTTTAGAGAAACAATGG
TGGCCTGGATTCGTATACTTCAATGTTTACGCCTCCCCACCTCCTTCTCCCACCACCTCTTCCGGTATCAGTCTC
ATCCAACTGCCAAATCGACAACACCAACATTTACTCCAATTACCATCCGATACCAATCCGATACCAGGATTAATC
TGGCTAGGAACCTCTGGCCCGGACAACTCTCTCACCAAAGGCAACTTTCAATTCTCTTTTGACAGAACTCAACTT
CCAGGCGAGTTGAGAGAGTTACCTACGCTTAGAGTGTATGTCCAAGGTATACTTGATACCGGAGAAATTTTGGAT
GGGGATAGTTCGGCTTTCGTTGATGTTACATTCCCAATTGCTTGA
Gene >Agabi119p4|077640
ATGCCTACCACCAATCTTTTGCCTGCTAAGGATCAATTTTTTCAGTCTTTGGCTGAACTAGACGCGTATCAGACG
AAGAAACAGTCTGAGCGACCCGCTGTCAGCCAAACGACCGAGTGGACACCAAGAAAGTCCCCGGCCCTAGGATCA
CGAGGAAGACTTCTAGTAAGCTGGAGAGTACATTCGTGCGACCAATATTGTTACTGATAAAACTAACAGGTTTGC
CATGATTACAAGGTAGCGGTGAATGCTATGTATCGCCATCCATTTCTTATGTCGTGTTTTAGGGAGGGTATGTAG
AAGATCCCCAAGGCCTCTCTTATACGTTTAATTATTGGTCCCTCTGCGAATCATTTGTCTAGTAAGTCTCTGCCT
TTCAAATAGTTAACTATATTCACATTCGTTGCTCAGTTTCTCTCATCACCGTGTTACTATACCCCCTCCGGGATG
GGTCAACGCGGCTCATCGTCAAGGAGTCAAGATGCTTGGCGTCTTGTGAATTTATTTTTACTCTATTTGAACAAT
AATCTAATGAAATATCAGGATATTTGAAGGCGACGCCCAAGCGGAAGCCCTCCGTTTGATTGTAGGTAAACTCCC
TCAAACTTCAGGCTCGCTGCAATCATCTGCGCCCTCAACTTTACCAATATCCTCTCATTACGCTATCGCTCTTGC
CGATCTTGCCGCAGAGAGGGGCTTCGATGGATATCTCCTCAATTTTGAATGTGTATTGACTGGAGGTGTTGAACA
AGCTCGAAGCCTCGCCGCCTGGATTACTCTTCTTCAATCGGAGCTCGTCAAACGCGTCGGTCCCCATGCTGAGAC
GGTTTGGTATGATAGTGTTATATTTACCGGAAGCTTGGCATGGCAAAATCGGTTGAATTCTTTCAATTTGCCGTT
CTTCATCCCGTCTACCAGTTTCTTTTCAAACTACTCGGTGAGTATTTCGGCCCATCAACAAAAGAACACATAATG
ACACTTTACTTTCCTAGTGGAGTCCCTCCTTTACCGACATAAGCGTTCAATATTACAACTCTCTAGACTCTCAAC
TTATCGGCCTTGCGTCCGATAGCAGATCCAAGACTCTTCAGGATGTCCTCATGGGGATAGACGTCTGGGGCCGAG
GTTCCTATGGTGGAGGAGGATTTGGATGTTATAAATCCCTGAACCACATCACTCCAGCCCATCTCAGCACAGCTC
TATTTGCTCAGGCTTGGACTTGGGAAACCAGAGAAAATGAGTCTGACTTCACTTGGGATCTTTGGTGGAACTATG
AGCGGGATCTCTGGGTCGGAAACCCTGATCCTAATGCTGTCATACCCGTACCGAGTATTCCCACCCCCGACGAAG
GGCCGTATAAACCTCTCAGCACGTTCTTTTCTCGACTTCCTCCTCCTGATCCGGATGATGTTCCATTCCATACGA
CTTTTTGTCCCGGAGTTGGACGTTCTTGGTTCGTTGCTGGAGTTCCAGTGCATCAGTACCCTGTCGGATGGATGG
ACGTCGATAAACAGACTACCATGGGGGATTTAATTTGGCCAATCCCCACTCTTACGTTGGAGGGAAACTCCGAGG
GACCTTTACCTGACGTCGCTGCTTCTGTCGATATGACTGATTCATGGAATAGTGGCACTTCTATACGCCTCCTTT
TCACCGATAAGGAAATCAATCCAGATCACTCCTTCCGTTCGTTCTCATTCCCTATCCAAACTCTGACTGTCACCA
CTCAGAAGAGCTATACTGCGAGTATCATATACAAACTCATACCTGATGGCACCACTACGTTCGAACTCAGCACCG
CACTCTCTATTGTCCCGCTTCAAACCGGGGACACGTTCACTCAGGACCAGATGCGCGCTATGACCTGCGCTATTT
CACCTAACTCGGTCACCACCACTGAACTCACAAATGACTGGGTGAAATCTACAATGGAATTTATCATCGCCGATA
CACCTCCCGGCATCGTATCTCTCGATTGTTCTATCGGTCTCACCCTTGCAATCACATCCTCCCAGATATCACCAT
TCCCACTCACTCTTCTCCTCGGCCAACTGAACGTCCACAGCACACCTTCTTCAACAATCCAACCCAACTTCCCTC
GTATTCTCTGGTCCGATTTCTCCAGTTCTTCAGTTCAATTTAACGATGGTAGTACCAGAGAGGTGACGAACGTCA
ATTGGCAACCGGCTACATCGTTATCTCAAGTTGGTCCTATCACGATCACTTCACCTGAAGATCCGAACAGCGCTT
GGACTCCACAACCTCCTTTAGAGAAACAATGGTGGCCTGGATTCGTATACTTCAATGTTTACGCCTCCCCACCTC
CTTCTCCCACCACCTCTTCCGGTATCAGTCTCATCCAACTGCCAAATCGACAACACCAACATTTACTCCAATTAC
CATCCGATACCAATCCGATACCAGGATTAATCTGGCTAGGAACCTCTGGCCCGGACAACTCTCTCACCAAAGGCA
ACTTTCAATTCTCTTTTGACAGAACTCAACTTCCAGGCGAGTTGAGAGAGTTACCTACGCTTAGAGTGTATGTCC
AAGGTATACTTGATACCGGAGAAATTTTGGATGGGGATAGTTCGGCTTTCGTTGATGTTACATTCCCAATTGCTT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail