Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|076520
Gene name
Locationscaffold_04:2489122..2492592
Strand+
Gene length (bp)3470
Transcript length (bp)2805
Coding sequence length (bp)2805
Protein length (aa) 935

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08711 Med26 TFIIS helical bundle-like domain 3.0E-08 400 450
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 1.3E-06 908 931
PF18044 zf-CCCH_4 CCCH-type zinc finger 1.3E-05 910 931

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6GLQ4|PP1RA_XENLA Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Xenopus laevis GN=ppp1r10 PE=2 SV=1 595 712 6.0E-06

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|076520
MDPIFHWVSQPSMLPESSQHESQRQTQSSLDDWAKERPAAMPQTGSIGVGSSSAANSMDISDFTTLGELGGEPMP
TNSQQSAPSLLSSPQTFYSQLTQSHNQFFLPSYPTLAYGNSTWPPIPLSNYSTLNGATISSNSTASQPTQQQSPP
PNSPPAQQSQSTHVGQQQNSTVQSQPPESTNHHQPLMIDPALTLPGSNPNLQPYGSIFASQPQRQQYPFTHFIPS
SYYRQASTATSQGTLSPQALMNPSSLLTSISPASFYGTQSSTTQSDSQTSQPSSTLQNQPQSTLQTQPQPLEPSP
EEIAQRKARFYTSVKPLLHSSAFSGAQAVNTLVERIMSNIHEADPSIRLEILTKIRDGAGNHYFRAWSENPRAMD
ITREWLKAAYSADDDSPLLETIMPLLHIIDRLPLTVESLRASKLGKLVVKLVKDPPSPAIKDMASNIERRWRQLV
SGGEGPPNAPSASSAEDPKVKKRKSDPLNIKSLPPQKKQAISNSAMKPSAAREPKDKPKPISNTAAVKDAKSDSS
FFSAPKPKPKLPSFKKAPVPAMVKKEENVAQPSSVDPFQEVLRTMKARKESPVVSTPPAAVNTPPQTNSLSRNGK
KKKSVTWAPDSQLESVKLIERAVYDDEPPEGMHMAHSLRDLDRGEGAALHAHLFEETVDWLEPSMLEIPPDIEVP
VRGEGSQEKATQEQREQTALSAVYMTAQMIPDSPAEPVVILPEEEVDKDVVTMICGESDSIFWSDGVPVEPVSHT
ASVADLVGQLASGSGVDPALGGTHFNGQGLDLKSVGLDTSATLSAVSALPQEQLQQLLQQLASYGSPGSNPSPPS
SASYNNIDPTWGTGSNQYSNDYGQNYHEDNNEREAWPPNGPKGRGRGRSSGRGRGRGRGGGGNGSNGGGGNGGGE
EYRQQPNKRKPCSFFAAGKCRFGDQCDFAHDVAS*
Coding >Agabi119p4|076520
ATGGATCCTATTTTTCACTGGGTCTCCCAGCCCTCGATGCTGCCAGAGTCCTCTCAGCATGAATCGCAGAGGCAG
ACCCAGTCATCCCTCGATGACTGGGCAAAAGAGCGCCCGGCTGCCATGCCCCAAACGGGCTCTATCGGCGTCGGC
TCCTCTTCGGCCGCAAACAGCATGGACATTAGCGATTTCACCACTCTCGGAGAATTGGGAGGTGAGCCTATGCCA
ACAAATTCGCAGCAGTCCGCCCCTTCCCTGCTGTCCTCGCCCCAGACGTTCTACTCCCAGCTCACCCAATCCCAC
AACCAATTCTTTTTGCCATCCTACCCCACGCTTGCCTATGGCAACTCGACCTGGCCACCCATTCCCCTTTCCAAC
TACTCGACTCTCAACGGCGCGACCATCTCGTCCAATTCGACCGCGTCGCAACCCACTCAGCAGCAATCACCTCCA
CCCAACTCCCCTCCCGCACAACAATCACAATCCACTCACGTTGGCCAGCAGCAAAACTCGACGGTCCAGTCACAG
CCGCCAGAGTCGACCAACCATCATCAGCCTCTCATGATCGATCCAGCGTTGACGTTACCAGGATCCAATCCCAAT
TTACAACCTTATGGATCCATCTTTGCTTCCCAGCCACAACGCCAGCAATATCCCTTTACGCACTTTATTCCCTCT
TCTTACTATCGCCAAGCTTCGACCGCCACGTCTCAAGGAACTCTGTCTCCTCAAGCATTGATGAACCCGAGTTCC
CTTTTGACCTCGATTAGTCCGGCATCATTTTATGGCACTCAGTCTTCAACTACTCAATCAGATTCGCAAACGTCT
CAACCATCATCAACATTGCAAAATCAACCACAATCTACGTTGCAAACCCAACCTCAACCTCTCGAACCGTCTCCC
GAGGAGATCGCACAGAGGAAAGCGCGGTTTTATACGTCGGTCAAACCGTTACTGCATTCTTCGGCTTTTTCAGGA
GCCCAGGCCGTCAACACTTTAGTAGAGCGAATTATGAGCAATATCCATGAGGCTGACCCTTCTATACGACTGGAA
ATATTGACGAAGATCCGGGACGGTGCAGGTAACCATTATTTTAGGGCTTGGTCTGAAAACCCGCGTGCAATGGAT
ATTACACGAGAGTGGCTTAAAGCTGCATACTCTGCTGATGATGATAGTCCTCTACTTGAAACGATCATGCCACTA
CTGCATATCATCGATCGATTGCCTTTAACGGTAGAAAGCCTCAGAGCCTCAAAGCTGGGCAAACTTGTAGTGAAG
CTTGTAAAAGATCCGCCCTCTCCAGCCATCAAGGACATGGCCTCGAATATCGAACGCCGATGGCGTCAGCTTGTC
AGCGGTGGTGAAGGGCCACCTAATGCCCCTAGCGCCAGCTCGGCAGAGGACCCAAAAGTGAAGAAACGAAAAAGC
GATCCACTCAATATCAAGTCTCTCCCGCCGCAGAAAAAACAGGCAATTTCAAATTCGGCAATGAAACCTTCGGCT
GCAAGAGAACCCAAAGACAAACCAAAGCCTATATCAAACACTGCCGCTGTCAAGGATGCCAAGTCCGATTCGTCT
TTCTTTTCAGCACCCAAACCCAAGCCAAAATTGCCCAGTTTTAAGAAAGCACCGGTGCCTGCGATGGTCAAGAAG
GAGGAGAATGTTGCGCAGCCGTCGTCGGTAGATCCGTTCCAAGAAGTTCTCAGGACGATGAAGGCTCGAAAGGAG
TCACCTGTCGTATCGACACCGCCTGCAGCTGTGAATACACCTCCGCAGACAAATAGTCTTTCGAGAAATGGTAAA
AAGAAGAAATCTGTGACTTGGGCACCTGATTCCCAACTTGAATCGGTGAAGCTAATTGAACGGGCGGTCTATGAT
GATGAACCTCCAGAGGGAATGCATATGGCCCACAGCCTGCGTGATTTGGATCGAGGTGAAGGTGCAGCTCTTCAC
GCACACTTGTTCGAGGAGACAGTGGATTGGTTGGAACCTTCAATGCTTGAAATACCCCCGGATATCGAAGTGCCG
GTGCGTGGGGAAGGAAGTCAAGAGAAGGCGACGCAAGAGCAACGGGAACAGACAGCGCTCAGCGCTGTGTATATG
ACGGCTCAAATGATCCCGGATAGTCCGGCGGAGCCTGTAGTCATTTTACCCGAAGAGGAAGTGGACAAGGATGTA
GTGACGATGATTTGCGGGGAAAGTGACTCTATCTTCTGGAGTGACGGAGTGCCAGTTGAACCGGTATCCCACACT
GCATCAGTGGCGGATCTAGTTGGACAATTGGCATCAGGGAGTGGTGTTGATCCCGCGTTAGGGGGTACTCACTTT
AACGGTCAGGGATTGGATTTGAAATCAGTGGGCCTTGACACATCTGCTACTTTGTCTGCCGTATCTGCCTTACCA
CAGGAGCAGCTACAACAGTTGCTCCAACAGTTAGCGTCGTATGGATCGCCCGGATCTAATCCATCACCACCATCA
TCAGCATCATATAATAACATTGATCCGACATGGGGAACAGGGTCGAATCAGTATTCCAACGATTATGGACAAAAC
TATCATGAGGACAACAATGAGCGAGAAGCATGGCCGCCAAATGGACCGAAGGGACGGGGGCGAGGGCGAAGTTCT
GGACGTGGTCGGGGAAGGGGACGTGGCGGTGGTGGTAATGGGAGTAATGGAGGAGGAGGCAATGGCGGGGGAGAA
GAGTATAGACAACAACCGAATAAACGAAAACCTTGCAGTTTCTTTGCGGCTGGAAAGTGTAGATTTGGCGACCAA
TGTGATTTTGCCCATGACGTAGCCTCGTAG
Transcript >Agabi119p4|076520
ATGGATCCTATTTTTCACTGGGTCTCCCAGCCCTCGATGCTGCCAGAGTCCTCTCAGCATGAATCGCAGAGGCAG
ACCCAGTCATCCCTCGATGACTGGGCAAAAGAGCGCCCGGCTGCCATGCCCCAAACGGGCTCTATCGGCGTCGGC
TCCTCTTCGGCCGCAAACAGCATGGACATTAGCGATTTCACCACTCTCGGAGAATTGGGAGGTGAGCCTATGCCA
ACAAATTCGCAGCAGTCCGCCCCTTCCCTGCTGTCCTCGCCCCAGACGTTCTACTCCCAGCTCACCCAATCCCAC
AACCAATTCTTTTTGCCATCCTACCCCACGCTTGCCTATGGCAACTCGACCTGGCCACCCATTCCCCTTTCCAAC
TACTCGACTCTCAACGGCGCGACCATCTCGTCCAATTCGACCGCGTCGCAACCCACTCAGCAGCAATCACCTCCA
CCCAACTCCCCTCCCGCACAACAATCACAATCCACTCACGTTGGCCAGCAGCAAAACTCGACGGTCCAGTCACAG
CCGCCAGAGTCGACCAACCATCATCAGCCTCTCATGATCGATCCAGCGTTGACGTTACCAGGATCCAATCCCAAT
TTACAACCTTATGGATCCATCTTTGCTTCCCAGCCACAACGCCAGCAATATCCCTTTACGCACTTTATTCCCTCT
TCTTACTATCGCCAAGCTTCGACCGCCACGTCTCAAGGAACTCTGTCTCCTCAAGCATTGATGAACCCGAGTTCC
CTTTTGACCTCGATTAGTCCGGCATCATTTTATGGCACTCAGTCTTCAACTACTCAATCAGATTCGCAAACGTCT
CAACCATCATCAACATTGCAAAATCAACCACAATCTACGTTGCAAACCCAACCTCAACCTCTCGAACCGTCTCCC
GAGGAGATCGCACAGAGGAAAGCGCGGTTTTATACGTCGGTCAAACCGTTACTGCATTCTTCGGCTTTTTCAGGA
GCCCAGGCCGTCAACACTTTAGTAGAGCGAATTATGAGCAATATCCATGAGGCTGACCCTTCTATACGACTGGAA
ATATTGACGAAGATCCGGGACGGTGCAGGTAACCATTATTTTAGGGCTTGGTCTGAAAACCCGCGTGCAATGGAT
ATTACACGAGAGTGGCTTAAAGCTGCATACTCTGCTGATGATGATAGTCCTCTACTTGAAACGATCATGCCACTA
CTGCATATCATCGATCGATTGCCTTTAACGGTAGAAAGCCTCAGAGCCTCAAAGCTGGGCAAACTTGTAGTGAAG
CTTGTAAAAGATCCGCCCTCTCCAGCCATCAAGGACATGGCCTCGAATATCGAACGCCGATGGCGTCAGCTTGTC
AGCGGTGGTGAAGGGCCACCTAATGCCCCTAGCGCCAGCTCGGCAGAGGACCCAAAAGTGAAGAAACGAAAAAGC
GATCCACTCAATATCAAGTCTCTCCCGCCGCAGAAAAAACAGGCAATTTCAAATTCGGCAATGAAACCTTCGGCT
GCAAGAGAACCCAAAGACAAACCAAAGCCTATATCAAACACTGCCGCTGTCAAGGATGCCAAGTCCGATTCGTCT
TTCTTTTCAGCACCCAAACCCAAGCCAAAATTGCCCAGTTTTAAGAAAGCACCGGTGCCTGCGATGGTCAAGAAG
GAGGAGAATGTTGCGCAGCCGTCGTCGGTAGATCCGTTCCAAGAAGTTCTCAGGACGATGAAGGCTCGAAAGGAG
TCACCTGTCGTATCGACACCGCCTGCAGCTGTGAATACACCTCCGCAGACAAATAGTCTTTCGAGAAATGGTAAA
AAGAAGAAATCTGTGACTTGGGCACCTGATTCCCAACTTGAATCGGTGAAGCTAATTGAACGGGCGGTCTATGAT
GATGAACCTCCAGAGGGAATGCATATGGCCCACAGCCTGCGTGATTTGGATCGAGGTGAAGGTGCAGCTCTTCAC
GCACACTTGTTCGAGGAGACAGTGGATTGGTTGGAACCTTCAATGCTTGAAATACCCCCGGATATCGAAGTGCCG
GTGCGTGGGGAAGGAAGTCAAGAGAAGGCGACGCAAGAGCAACGGGAACAGACAGCGCTCAGCGCTGTGTATATG
ACGGCTCAAATGATCCCGGATAGTCCGGCGGAGCCTGTAGTCATTTTACCCGAAGAGGAAGTGGACAAGGATGTA
GTGACGATGATTTGCGGGGAAAGTGACTCTATCTTCTGGAGTGACGGAGTGCCAGTTGAACCGGTATCCCACACT
GCATCAGTGGCGGATCTAGTTGGACAATTGGCATCAGGGAGTGGTGTTGATCCCGCGTTAGGGGGTACTCACTTT
AACGGTCAGGGATTGGATTTGAAATCAGTGGGCCTTGACACATCTGCTACTTTGTCTGCCGTATCTGCCTTACCA
CAGGAGCAGCTACAACAGTTGCTCCAACAGTTAGCGTCGTATGGATCGCCCGGATCTAATCCATCACCACCATCA
TCAGCATCATATAATAACATTGATCCGACATGGGGAACAGGGTCGAATCAGTATTCCAACGATTATGGACAAAAC
TATCATGAGGACAACAATGAGCGAGAAGCATGGCCGCCAAATGGACCGAAGGGACGGGGGCGAGGGCGAAGTTCT
GGACGTGGTCGGGGAAGGGGACGTGGCGGTGGTGGTAATGGGAGTAATGGAGGAGGAGGCAATGGCGGGGGAGAA
GAGTATAGACAACAACCGAATAAACGAAAACCTTGCAGTTTCTTTGCGGCTGGAAAGTGTAGATTTGGCGACCAA
TGTGATTTTGCCCATGACGTAGCCTCGTAG
Gene >Agabi119p4|076520
ATGGATCCTATTTTTCACTGGGTCTCCCAGCCCTCGATGCTGCCAGAGTCCTCTCAGCATGAATCGCAGAGGCAG
ACCCAGTCATCCCTCGATGACTGGGCAAAAGAGCGCCCGGCTGCCATGCCCCAAACGGGCTCTATCGGCGTCGGC
TCCTCTTCGGCCGCAAACAGCATGGACATTAGCGATTTCACCACTCTCGGAGAATTGGGAGGTGAGCCTATGCCA
ACAAATTCGCAGCAGTGTACGCCTCAGTGTGCTGGCTGATCGCGCACCGTAAACTAACAATCTGCTACAGCCGCC
CCTTCCCTGCTGTCCTCGCCCCAGACGTTCTACTCCCAGCTCACCCAATCCCACAACCAATTCTTTTTGCCATCC
TACCCCACGCTTGCCTATGGCAACTCGACCTGGCCACCCATTCCCCTTTCCAACTACTCGACTCTCAACGGCGCG
ACCATCTCGTCCAATTCGACCGCGTCGCAACCCACTCAGCAGCAATCACCTCCACCCAACTCCCCTCCCGCACAA
CAATCACAATCCACTCACGTTGGCCAGCAGCAAAACTCGACGGTCCAGTCACAGCCGCCAGAGTCGACCAACCAT
CATCAGCCTCTCATGATCGAGTATGTTCAAGCATCATTATAAATTTTTAGTGCCCTGATCCTCTCTTATAGTCCA
GCGTTGACGTTACCAGGATCCAATCCCAATTTACAACCTTATGGATCCATCTTTGCTTCCCAGCCACAACGCCAG
CAATATCCCTTTACGCACTTTATTCCCTCTTCTTACTATCGCCAAGCTTCGACCGCCACGTCTCAAGGAACTCTG
TCTCCTCAAGCATTGATGAACCCGAGTTCCCTTTTGACCTCGATTAGTCCGGCATCATTTTATGGCACTCAGTCT
TCAACTACTCAATCAGATTCGCAAACGTCTCAACCATCATCAACATTGCAAAATCAACCACAATCTACGTTGCAA
ACCCAACCTCAACCTCTCGAACCGTCTCCCGAGGAGATCGCACAGAGGAAAGCGCGGTTTTATACGTCGGTCAAA
CCGTTACTGCATTCTTCGGCTTTTTCAGGAGCCCAGGCCGTCAACACTTTAGTAGAGCGAATTATGAGCAATATC
CATGAGGCTGACCCTTCTATACGACTGGAAATATTGACGAAGATCCGGGACGGTGCAGGTAACCATTATTTTAGG
GCTTGGTCTGAAAACCCGCGTGCAATGGATATTACACGAGAGTGGCTTAAAGCTGCATACTCTGCTGATGATGAT
AGTCCTCTACTTGAAACGATCATGCCACTACTGCATGTACGTGGCCAAGTTATCTTCTGTGATTGAGTGAAGCTG
AATGAGCTGTTTGTTCGTTGTCTTTCAGATCATCGATCGATTGCCTTTAACGGTAGAAAGCCTCAGAGCCTCAAA
GCTGGGCAAACTTGTAGTGAAGCTTGTAAAAGATCCGCCCTCTCCAGGTGAGTTGACGCGTCCTTCATCCATCCA
GGTCAATATGTGTCTGCATGCACAGCTGCTCTTGTCCGAGCGTGAATTGAGATCGCCTCAAGCGTTATATTATGT
GTTACTGCCTTTTTGCCTGGACTTTGAAAGGAGTAATAGAATAGATGTATCTAACGTTTTATCATGCTTTTTTTG
GGGCCGCTCTACAAAATCGCAGCCATCAAGGACATGGCCTCGAATATCGAACGCCGATGGCGTCAGCTTGTCAGC
GGTGGTGAAGGGCCACCTAATGCCCCTAGCGCCAGCTCGGCAGAGGGTGGGTCACGTTAGTCCGTCGTAATGAAT
ACAACCGTTAAGCTGATATTCCCATATTCGTAGACCCAAAAGTGAAGAAACGAAAAAGCGATCCACTCAATATCA
AGTCTCTCCCGCCGCAGAAAAAACAGGCAATTTCAAATTCGGCAATGAAACCTTCGGCTGCAAGAGAACCCAAAG
ACAAACCAAAGCCTATATCAAACACTGCCGCTGTCAAGGATGCCAAGTCCGATTCGTCTTTCTTTTCAGCACCCA
AACCCAAGCCAAAATTGCCCAGTTTTAAGAAAGCACCGGTGCCTGCGATGGTCAAGAAGGAGGAGAATGTTGCGC
AGCCGTCGTCGGTAGATCCGTTCCAAGAAGTTCTCAGGACGATGAAGGCTCGAAAGGAGTCACCTGTCGTATCGA
CACCGCCTGCAGCTGTGAATACACCTCCGCAGACAAATAGTCTTTCGAGAAATGGTAAAAAGAAGAAATCTGTGA
CTTGGGCACCTGATTCCCAACTTGAATCGGTGAAGCTAATTGAACGGGCGGTCTATGATGATGAACCTCCAGAGG
TCAGCCATTGCCCATTTCGATCAGGTCACGTGCTCGGAATGTTCTGATGTCGCTTTCTTAGGGAATGCATATGGC
CCACAGCCTGCGTGATTTGGATCGAGGTGAAGGTGCAGCTCTTCACGCACACTTGTTCGAGGAGACAGTGGATTG
GTTGGAACCTTCAAGTAAGTGCATTCCGTATAGTAGAGAATGTTACGGAACGGAAAGAACCGACTTTGATGTGCA
GTGCTTGAAATACCCCCGGATATCGAAGTGCCGGTGCGTGGGGAAGGAAGTCAAGAGAAGGCGACGCAAGAGCAA
CGGGAACAGACAGCGCTCAGCGCTGTGTATATGACGGCTCAAATGATCCCGGATAGTCCGGCGGAGCCTGTAGTC
ATTTTACCCGAAGAGGAAGTGGACAAGGATGTAGTGACGATGATTTGCGGGGAAAGTGACTCTATCTTCTGGAGT
GACGGAGTGCCAGTTGAACCGGTATCCCACACTGCATCAGTGGCGGATCTAGTTGGACAATTGGCATCAGGGAGT
GGTGTTGATCCCGCGTTAGGGGGTACTCACTTTAACGGTCAGGGATTGGATTTGAAATCAGTGGGCCTTGACACA
TCTGCTACTTTGTCTGCCGTATCTGCCTTACCACAGGAGCAGCTACAACAGTTGCTCCAACAGTTAGCGTCGTAT
GGATCGCCCGGATCTAATCCATCACCACCATCATCAGCATCATATAATAACATTGATCCGACATGGGGAACAGGG
TCGAATCAGTATTCCAACGATTATGGACAAAACTATCATGAGGACAACAATGAGCGAGAAGCATGGCCGCCAAAT
GGACCGAAGGGACGGGGGCGAGGGCGAAGTTCTGGACGTGGTCGGGGAAGGGGACGTGGCGGTGGTGGTAATGGG
AGTAATGGAGGAGGAGGCAATGGCGGGGGAGAAGAGTATAGACAACAACCGAATAAACGAAAACCTTGCAGTTTC
TTTGCGGCTGGAAAGTGAGCATCCCCTCATCCAAACGTTCTTCCCTCCCCCTCCTTTCTTTCCCACCAAATCGCT
TTCTAAAAATGGAACAAAGTTGCTGATCACGTACCGCTTTCGATAGGTGTAGATTTGGCGACCAATGTGATTTTG
CCCATGACGTAGCCTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail