Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|076460
Gene name
Locationscaffold_04:2478035..2478503
Strand+
Gene length (bp)468
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06093 Spt4 Spt4/RpoE2 zinc finger 2.2E-27 14 91

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S743|SPT4_NEUCR Transcription elongation factor spt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trf-2 PE=3 SV=1 1 113 2.0E-37
sp|P0CR68|SPT4_CRYNJ Transcription elongation factor SPT4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPT4 PE=3 SV=1 5 116 3.0E-37
sp|P0CR69|SPT4_CRYNB Transcription elongation factor SPT4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPT4 PE=3 SV=1 5 116 3.0E-37
sp|Q4I5W5|SPT4_GIBZE Transcription elongation factor SPT4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPT4 PE=3 SV=2 9 116 5.0E-35
sp|Q6DGQ0|SPT4H_DANRE Transcription elongation factor SPT4 OS=Danio rerio GN=supt4h1 PE=3 SV=1 12 113 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S743|SPT4_NEUCR Transcription elongation factor spt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trf-2 PE=3 SV=1 1 113 2.0E-37
sp|P0CR68|SPT4_CRYNJ Transcription elongation factor SPT4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPT4 PE=3 SV=1 5 116 3.0E-37
sp|P0CR69|SPT4_CRYNB Transcription elongation factor SPT4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPT4 PE=3 SV=1 5 116 3.0E-37
sp|Q4I5W5|SPT4_GIBZE Transcription elongation factor SPT4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPT4 PE=3 SV=2 9 116 5.0E-35
sp|Q6DGQ0|SPT4H_DANRE Transcription elongation factor SPT4 OS=Danio rerio GN=supt4h1 PE=3 SV=1 12 113 3.0E-34
sp|Q5HZ97|SPT4H_XENLA Transcription elongation factor SPT4 OS=Xenopus laevis GN=supt4h1 PE=3 SV=1 12 113 3.0E-34
sp|Q9TZ93|SPT4H_CAEEL Transcription elongation factor SPT4 OS=Caenorhabditis elegans GN=spt-4 PE=3 SV=1 1 117 6.0E-34
sp|Q4R941|SPT4H_MACFA Transcription elongation factor SPT4 OS=Macaca fascicularis GN=SUPT4H1 PE=3 SV=1 12 113 1.0E-33
sp|P63272|SPT4H_HUMAN Transcription elongation factor SPT4 OS=Homo sapiens GN=SUPT4H1 PE=1 SV=1 12 113 1.0E-33
sp|Q3SYX6|SPT4H_BOVIN Transcription elongation factor SPT4 OS=Bos taurus GN=SUPT4H1 PE=3 SV=1 12 113 1.0E-33
sp|P63271|SPT4A_MOUSE Transcription elongation factor SPT4-A OS=Mus musculus GN=Supt4h1a PE=2 SV=1 12 113 1.0E-33
sp|Q5RFH5|SPT4H_PONAB Transcription elongation factor SPT4 OS=Pongo abelii GN=SUPT4H1 PE=3 SV=1 12 113 3.0E-33
sp|Q9Z199|SPT4B_MOUSE Transcription elongation factor SPT4-B OS=Mus musculus GN=Supt4h1b PE=2 SV=1 12 113 1.0E-32
sp|Q9TVQ5|SPT4H_DROME Transcription elongation factor SPT4 OS=Drosophila melanogaster GN=spt4 PE=1 SV=1 4 113 7.0E-32
sp|Q628A6|SPT4H_CAEBR Transcription elongation factor SPT4 OS=Caenorhabditis briggsae GN=spt-4 PE=3 SV=1 1 117 2.0E-31
sp|Q4WU00|SPT4_ASPFU Transcription elongation factor spt4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spt4 PE=3 SV=1 9 111 3.0E-30
sp|Q5AK73|SPT4_CANAL Transcription elongation factor SPT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPT4 PE=3 SV=1 15 118 1.0E-23
sp|Q9P7K8|SPT4_SCHPO Transcription elongation factor spt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt4 PE=1 SV=1 15 118 2.0E-21
sp|P81205|SPT4_KLULA Transcription elongation factor SPT4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPT4 PE=3 SV=1 15 118 8.0E-21
sp|Q6FMX1|SPT4_CANGA Transcription elongation factor SPT4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SPT4 PE=3 SV=1 15 113 7.0E-20
sp|P32914|SPT4_YEAST Transcription elongation factor SPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT4 PE=1 SV=1 15 113 1.0E-19
sp|Q752J8|SPT4_ASHGO Transcription elongation factor SPT4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPT4 PE=3 SV=1 15 118 3.0E-19
sp|Q8LCQ3|SPT41_ARATH Transcription elongation factor SPT4 homolog 1 OS=Arabidopsis thaliana GN=At5g08565 PE=2 SV=3 7 111 2.0E-18
sp|Q94C60|SPT42_ARATH Transcription elongation factor SPT4 homolog 2 OS=Arabidopsis thaliana GN=At5g63670 PE=2 SV=1 7 109 2.0E-18
sp|Q6BHA5|SPT4_DEBHA Transcription elongation factor SPT4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPT4 PE=3 SV=2 12 118 2.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|076460
MSAPIPPQAKGKNLRACLLCSVVLTPTDFRKIGCPNCEEIMQLKGSPDRILSCTTTNFDGVIALFAPDTSWVARW
QRTTNYARGIYAVHVKGRVPDDVEAELENRGIKYRPRDLTDQD*
Coding >Agabi119p4|076460
ATGAGCGCCCCAATTCCACCACAAGCCAAAGGCAAAAACCTTCGAGCATGTCTGCTTTGTTCTGTCGTCCTGACA
CCCACCGACTTTCGCAAAATCGGATGTCCAAATTGTGAAGAAATCATGCAGCTCAAGGGCAGCCCAGACCGAATA
TTATCGTGTACTACAACCAACTTTGATGGTGTCATCGCTCTTTTTGCACCTGACACCAGCTGGGTCGCCCGTTGG
CAGAGAACAACGAATTACGCCCGTGGAATATATGCCGTTCACGTCAAAGGCCGTGTTCCGGACGACGTTGAAGCT
GAGCTTGAGAATCGGGGAATAAAGTATCGACCCCGCGACTTGACCGACCAGGATTAA
Transcript >Agabi119p4|076460
ATGAGCGCCCCAATTCCACCACAAGCCAAAGGCAAAAACCTTCGAGCATGTCTGCTTTGTTCTGTCGTCCTGACA
CCCACCGACTTTCGCAAAATCGGATGTCCAAATTGTGAAGAAATCATGCAGCTCAAGGGCAGCCCAGACCGAATA
TTATCGTGTACTACAACCAACTTTGATGGTGTCATCGCTCTTTTTGCACCTGACACCAGCTGGGTCGCCCGTTGG
CAGAGAACAACGAATTACGCCCGTGGAATATATGCCGTTCACGTCAAAGGCCGTGTTCCGGACGACGTTGAAGCT
GAGCTTGAGAATCGGGGAATAAAGTATCGACCCCGCGACTTGACCGACCAGGATTAA
Gene >Agabi119p4|076460
ATGAGCGCCCCAATTCCACCACAAGCCAAAGGCAAAAACCTTCGAGCATGTCTGCTTTGTTCTGTCGTCCTGACA
CCCACCGACTTTCGCAAAATCGGATGTCCAAATTGTGAAGAAATCATGCAGGTATGCTTTTCGTACTTGTATCGC
TACTATCCTTGTTGAAGCCTCGTCCAGCTCAAGGGCAGCCCAGACCGAATATTATCGTGTACTACAACCAACTTT
GATGGTGTCATCGCTCTTTTTGCACCTGACACCAGCTGGGTCGCCCGTTGGCAGAGAACAAGTGCGTTTGTCAAC
TTTTTTTCATGAGTTTCATTCCGTTAAATTGAGACTCTCATTTTAGCGAATTACGCCCGTGGAATATATGCCGTT
CACGTCAAAGGCCGTGTTCCGGACGACGTTGAAGCTGAGCTTGAGAATCGGGGAATAAAGTATCGACCCCGCGAC
TTGACCGACCAGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail