Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|075050
Gene name
Locationscaffold_04:2176837..2177635
Strand-
Gene length (bp)798
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.1E-07 11 241
PF00106 adh_short short chain dehydrogenase 2.6E-06 6 220

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P21158|CSGA_MYXXA C-factor OS=Myxococcus xanthus GN=csgA PE=1 SV=1 113 265 2.0E-17
sp|Q7Z9I2|YCP9_SCHPO Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 6 265 2.0E-11
sp|Q9P7I6|YJNK_SCHPO Uncharacterized oxidoreductase C24B10.20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.20 PE=3 SV=1 5 265 3.0E-11
sp|Q7Z9I3|YCP8_SCHPO Uncharacterized oxidoreductase C663.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.08c PE=3 SV=1 11 265 2.0E-08
sp|P36086|YKH1_YEAST Uncharacterized oxidoreductase YKL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL071W PE=1 SV=1 11 263 6.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|075050
MPHPFVLVTPGATRGLSLALTRQFLKTTRYPVFASHRTQKSDDEIKELILDGISGNVDPTRLNLLRLDLTSEDSI
CQAADSLESMLSKSHWENPYIHTAFLTGGVLFPEKQPADLDWARLKETYQINVISHLLIIKHFSRFLPPTASSFT
VPNPSKWVHITARVGSIADNHRGGWYSYRSSKAALNQVIKTFDNQLAMNKSQAFCVGMHPGTVKTDLSRGYWKSA
SIDEVFEAQDAAENLVNVVENLQTQQRGKIWDWAGEGIPW*
Coding >Agabi119p4|075050
ATGCCTCACCCCTTTGTCCTCGTAACTCCTGGTGCTACTCGCGGTCTCTCCCTCGCGCTCACCCGCCAGTTTCTC
AAGACCACCAGATATCCAGTATTTGCATCTCATCGCACCCAGAAGAGCGACGACGAAATTAAAGAACTCATCCTC
GATGGCATCAGCGGCAATGTCGATCCCACGCGTCTCAATCTTCTTCGCTTGGACCTCACGTCCGAAGACTCTATT
TGCCAAGCCGCTGATTCTCTCGAAAGCATGCTGTCCAAGTCTCACTGGGAAAATCCTTACATACATACCGCCTTT
CTCACTGGCGGGGTGCTGTTCCCGGAAAAACAGCCTGCGGATCTCGATTGGGCTCGACTGAAAGAAACATATCAA
ATCAACGTCATATCACACCTTCTTATCATTAAACACTTCTCGCGCTTCCTTCCACCTACTGCCTCCAGCTTTACA
GTACCCAACCCCTCGAAGTGGGTTCATATCACGGCGCGAGTGGGTTCTATTGCCGACAACCACCGCGGGGGGTGG
TATTCTTATCGTTCATCCAAAGCGGCCCTTAATCAGGTTATCAAGACATTCGACAATCAATTGGCGATGAACAAG
AGTCAAGCTTTTTGCGTTGGGATGCACCCAGGAACAGTCAAGACAGACTTGAGTCGAGGCTACTGGAAGTCGGCT
TCCATCGACGAGGTATTTGAGGCGCAGGATGCTGCGGAGAATCTGGTAAATGTGGTGGAGAATTTGCAGACACAA
CAAAGGGGAAAAATCTGGGACTGGGCAGGCGAGGGCATTCCTTGGTAA
Transcript >Agabi119p4|075050
ATGCCTCACCCCTTTGTCCTCGTAACTCCTGGTGCTACTCGCGGTCTCTCCCTCGCGCTCACCCGCCAGTTTCTC
AAGACCACCAGATATCCAGTATTTGCATCTCATCGCACCCAGAAGAGCGACGACGAAATTAAAGAACTCATCCTC
GATGGCATCAGCGGCAATGTCGATCCCACGCGTCTCAATCTTCTTCGCTTGGACCTCACGTCCGAAGACTCTATT
TGCCAAGCCGCTGATTCTCTCGAAAGCATGCTGTCCAAGTCTCACTGGGAAAATCCTTACATACATACCGCCTTT
CTCACTGGCGGGGTGCTGTTCCCGGAAAAACAGCCTGCGGATCTCGATTGGGCTCGACTGAAAGAAACATATCAA
ATCAACGTCATATCACACCTTCTTATCATTAAACACTTCTCGCGCTTCCTTCCACCTACTGCCTCCAGCTTTACA
GTACCCAACCCCTCGAAGTGGGTTCATATCACGGCGCGAGTGGGTTCTATTGCCGACAACCACCGCGGGGGGTGG
TATTCTTATCGTTCATCCAAAGCGGCCCTTAATCAGGTTATCAAGACATTCGACAATCAATTGGCGATGAACAAG
AGTCAAGCTTTTTGCGTTGGGATGCACCCAGGAACAGTCAAGACAGACTTGAGTCGAGGCTACTGGAAGTCGGCT
TCCATCGACGAGGTATTTGAGGCGCAGGATGCTGCGGAGAATCTGGTAAATGTGGTGGAGAATTTGCAGACACAA
CAAAGGGGAAAAATCTGGGACTGGGCAGGCGAGGGCATTCCTTGGTAA
Gene >Agabi119p4|075050
ATGCCTCACCCCTTTGTCCTCGTAACTCCTGGTGCTACTCGCGGTCTCTCCCTCGCGCTCACCCGCCAGTTTCTC
AAGACCACCAGATATCCAGTATTTGCATCTCATCGCACCCAGAAGAGCGACGACGAAATTAAAGAACTCATCCTC
GATGGCATCAGCGGCAATGTCGATCCCACGCGTCTCAATCTTCTTCGCTTGGACCTCACGTCCGAAGACTCTATT
TGCCAAGCCGCTGATTCTCTCGAAAGCATGCTGTCCAAGTCTCACTGGGAAAATCCTTACATACATACCGCCTTT
CTCACTGGCGGGGTGCTGTTCCCGGAAAAACAGCCTGCGGATCTCGATTGGGCTCGACTGAAAGAAACATATCAA
ATCAACGTCATATCACACCTTCTTATCATTAAACACTTCTCGCGCTTCCTTCCACCTACTGCCTCCAGCTTTACA
GTACCCAACCCCTCGAAGTGGGTTCATATCACGGCGCGAGTGGGTTCTATTGCCGACAACCACCGCGGGGGGTGG
TATTCTTATCGTTCATCCAAAGCGGCCCTTAATCAGGTTATCAAGACATTCGACAATCAATTGGCGATGAACAAG
AGTCAAGCTTTTTGCGTTGGGATGCACCCAGGAACAGTCAAGACAGACTTGAGTCGAGGCTACTGGAAGTCGGCT
TCCATCGACGAGGTATTTGAGGCGCAGGATGCTGCGGAGAATCTGGTAAATGTGGTGGAGAATTTGCAGACACAA
CAAAGGGGAAAAATCTGGGACTGGGCAGGCGAGGGCATTCCTTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail