Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|075040
Gene name
Locationscaffold_04:2173090..2174993
Strand-
Gene length (bp)1903
Transcript length (bp)1677
Coding sequence length (bp)1677
Protein length (aa) 559

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05063 MT-A70 MT-A70 5.6E-56 349 523

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8C3P7|MTA70_MOUSE N6-adenosine-methyltransferase subunit METTL3 OS=Mus musculus GN=Mettl3 PE=1 SV=2 156 551 2.0E-116
sp|Q86U44|MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit OS=Homo sapiens GN=METTL3 PE=1 SV=2 156 551 1.0E-115
sp|F1R777|MTA70_DANRE N6-adenosine-methyltransferase subunit METTL3 OS=Danio rerio GN=mettl3 PE=2 SV=1 156 551 6.0E-114
sp|Q9VCE6|MTA70_DROME Probable N6-adenosine-methyltransferase MT-A70-like protein OS=Drosophila melanogaster GN=Ime4 PE=2 SV=1 208 545 2.0E-110
sp|Q6EU10|MTA70_ORYSJ Probable N6-adenosine-methyltransferase MT-A70-like OS=Oryza sativa subsp. japonica GN=Os02g0672600 PE=2 SV=1 157 549 2.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8C3P7|MTA70_MOUSE N6-adenosine-methyltransferase subunit METTL3 OS=Mus musculus GN=Mettl3 PE=1 SV=2 156 551 2.0E-116
sp|Q86U44|MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit OS=Homo sapiens GN=METTL3 PE=1 SV=2 156 551 1.0E-115
sp|F1R777|MTA70_DANRE N6-adenosine-methyltransferase subunit METTL3 OS=Danio rerio GN=mettl3 PE=2 SV=1 156 551 6.0E-114
sp|Q9VCE6|MTA70_DROME Probable N6-adenosine-methyltransferase MT-A70-like protein OS=Drosophila melanogaster GN=Ime4 PE=2 SV=1 208 545 2.0E-110
sp|Q6EU10|MTA70_ORYSJ Probable N6-adenosine-methyltransferase MT-A70-like OS=Oryza sativa subsp. japonica GN=Os02g0672600 PE=2 SV=1 157 549 2.0E-107
sp|O82486|MTA70_ARATH N6-adenosine-methyltransferase MT-A70-like OS=Arabidopsis thaliana GN=MTA PE=1 SV=2 187 554 4.0E-104
sp|Q2HVD6|MTA70_MEDTR Putative N6-adenosine-methyltransferase MT-A70-like OS=Medicago truncatula GN=MtrDRAFT_AC148918g15v1 PE=3 SV=1 85 549 9.0E-104
sp|P41833|IME4_YEAST N6-adenosine-methyltransferase IME4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IME4 PE=1 SV=1 127 545 4.0E-90
sp|Q5ZK35|MET14_CHICK N6-adenosine-methyltransferase subunit METTL14 OS=Gallus gallus GN=METTL14 PE=2 SV=1 330 521 1.0E-24
sp|Q5R5N4|MET14_PONAB N6-adenosine-methyltransferase subunit METTL14 OS=Pongo abelii GN=METTL14 PE=2 SV=1 330 521 2.0E-24
sp|Q9HCE5|MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14 OS=Homo sapiens GN=METTL14 PE=1 SV=2 330 521 2.0E-24
sp|Q3UIK4|MET14_MOUSE N6-adenosine-methyltransferase subunit METTL14 OS=Mus musculus GN=Mettl14 PE=1 SV=1 330 521 3.0E-24
sp|A4IFD8|MET14_BOVIN N6-adenosine-methyltransferase subunit METTL14 OS=Bos taurus GN=METTL14 PE=2 SV=1 330 521 3.0E-24
sp|Q6NZ22|MET14_DANRE N6-adenosine-methyltransferase subunit METTL14 OS=Danio rerio GN=mettl14 PE=2 SV=1 326 521 3.0E-23
sp|Q66KJ9|MET14_XENTR N6-adenosine-methyltransferase subunit METTL14 OS=Xenopus tropicalis GN=mettl14 PE=2 SV=1 330 524 6.0E-23
sp|Q6NU56|MET14_XENLA N6-adenosine-methyltransferase subunit METTL14 OS=Xenopus laevis GN=mettl14 PE=2 SV=1 330 521 9.0E-23
sp|Q9VLP7|MET14_DROME Methyltransferase-like protein 14 homolog OS=Drosophila melanogaster GN=CG7818 PE=2 SV=1 325 544 2.0E-21
sp|Q94AI4|METL1_ARATH Methyltransferase-like protein 1 OS=Arabidopsis thaliana GN=EMB1691 PE=2 SV=1 331 479 9.0E-14
sp|Q3U034|METL4_MOUSE Methyltransferase-like protein 4 OS=Mus musculus GN=Mettl4 PE=2 SV=1 349 524 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|075040
MSDDELYLITKTALRVILGDERTTFATPITSMALLTKIMTTDLPNGLFPASSKPTPRFRLTDVHRLESILEGLSQ
PQAWDEGYISVSRDNDTGELTIWELGLGPRKIVSGTKRKRIIDEEADSAAGSDNEEDEEGSMAGATGWAKSTLGG
LSREMRDVYALLQRGTAKGKLLAEHFRTIQDGFEPICSHITKEDCAKARLAASPNPISTTPTICDRVHFRPLIRP
HTDPSLGHCSYLNTCYSEPTYAQSPSIPAYPGSTSSRGPVSLPSGLGAGGRGKEKAPCRYLHYEVDWDPTDAENE
KTKERVAVKGKPHRLEIGLGPPGREATPLPPQWINCDLRKFDYSVLGKFHVIMADPPWDIHMSLPYGTMTDDEMR
AMPIPALQDEGLLFLWVTGRAMEVGRECLRVWGYTRVDEVIWVKTNQLQRVIRTGRTGHWLNHTKEHMLVGVKTP
SSPSDGPETELKFPKWVNRGVDTDVIVSEVRETSRKPDEVYGLIERMCPGGRKVEIFGRKHNARPGWLTLGNQLG
PADQIWEEDLLERVRAKYPERKVNVPPIPTSNF*
Coding >Agabi119p4|075040
ATGTCCGACGATGAACTCTACCTGATCACCAAAACTGCACTCAGAGTCATTTTGGGCGATGAACGCACTACGTTC
GCGACACCAATAACGTCAATGGCATTATTGACCAAGATAATGACTACCGATCTACCCAACGGCCTCTTTCCTGCA
TCTTCAAAACCTACCCCGAGATTTAGACTTACGGACGTACACAGGCTTGAAAGCATACTAGAAGGTCTTTCGCAA
CCTCAGGCATGGGACGAGGGCTATATATCTGTCTCGCGTGACAATGACACGGGTGAATTGACGATATGGGAATTA
GGACTTGGACCTCGGAAGATTGTCTCGGGGACGAAGAGGAAGAGAATTATCGATGAAGAAGCGGACTCTGCTGCT
GGAAGTGACAATGAAGAGGATGAGGAGGGGAGTATGGCCGGAGCCACAGGATGGGCAAAGTCTACCTTGGGTGGA
TTGAGTAGGGAGATGAGGGACGTGTATGCTCTGCTGCAAAGAGGTACCGCCAAAGGGAAACTACTCGCAGAACAC
TTCCGGACTATACAAGACGGATTTGAGCCAATATGTTCCCACATAACCAAGGAAGATTGCGCTAAAGCTCGACTA
GCAGCATCGCCTAACCCTATCTCGACGACACCTACCATCTGCGATCGTGTTCATTTTCGTCCTCTTATTCGTCCT
CACACAGATCCCAGTTTGGGTCACTGTTCTTATCTTAATACCTGCTATTCTGAGCCTACTTACGCCCAGTCACCT
TCAATACCCGCATATCCTGGTAGTACATCTTCCAGGGGTCCCGTCTCTCTTCCCTCCGGTCTCGGGGCAGGAGGC
CGCGGGAAAGAGAAAGCGCCATGCCGTTATCTGCACTATGAAGTAGATTGGGATCCCACTGACGCTGAGAACGAG
AAAACAAAAGAACGCGTCGCTGTCAAAGGCAAGCCACATCGTTTGGAGATTGGTTTGGGTCCTCCAGGACGTGAA
GCCACCCCACTTCCGCCGCAATGGATCAACTGCGATCTGCGCAAGTTTGATTATTCAGTGCTAGGCAAGTTTCAT
GTCATTATGGCAGATCCGCCTTGGGATATTCATATGAGCTTACCCTATGGGACAATGACCGATGATGAAATGCGT
GCGATGCCAATTCCAGCATTGCAAGACGAAGGTCTTCTCTTCCTATGGGTAACAGGCCGCGCCATGGAGGTTGGA
CGCGAATGTTTACGTGTCTGGGGATACACACGTGTAGACGAAGTCATCTGGGTGAAAACCAATCAACTTCAACGA
GTCATACGCACCGGAAGGACTGGTCATTGGCTCAATCACACTAAAGAACACATGCTCGTCGGTGTCAAAACTCCA
TCCTCCCCTTCAGATGGCCCCGAGACGGAACTCAAGTTTCCAAAGTGGGTAAACCGGGGAGTAGACACAGACGTT
ATTGTGAGTGAGGTAAGAGAGACAAGTCGAAAGCCGGATGAAGTGTATGGATTGATTGAGAGGATGTGTCCGGGT
GGAAGGAAAGTTGAGATATTTGGGAGGAAACATAATGCCCGACCAGGGTGGTTGACGTTGGGCAATCAATTAGGA
CCCGCAGATCAGATTTGGGAGGAGGATTTATTGGAAAGAGTGCGAGCGAAATACCCAGAAAGGAAGGTCAATGTA
CCGCCGATACCTACCTCGAATTTCTGA
Transcript >Agabi119p4|075040
ATGTCCGACGATGAACTCTACCTGATCACCAAAACTGCACTCAGAGTCATTTTGGGCGATGAACGCACTACGTTC
GCGACACCAATAACGTCAATGGCATTATTGACCAAGATAATGACTACCGATCTACCCAACGGCCTCTTTCCTGCA
TCTTCAAAACCTACCCCGAGATTTAGACTTACGGACGTACACAGGCTTGAAAGCATACTAGAAGGTCTTTCGCAA
CCTCAGGCATGGGACGAGGGCTATATATCTGTCTCGCGTGACAATGACACGGGTGAATTGACGATATGGGAATTA
GGACTTGGACCTCGGAAGATTGTCTCGGGGACGAAGAGGAAGAGAATTATCGATGAAGAAGCGGACTCTGCTGCT
GGAAGTGACAATGAAGAGGATGAGGAGGGGAGTATGGCCGGAGCCACAGGATGGGCAAAGTCTACCTTGGGTGGA
TTGAGTAGGGAGATGAGGGACGTGTATGCTCTGCTGCAAAGAGGTACCGCCAAAGGGAAACTACTCGCAGAACAC
TTCCGGACTATACAAGACGGATTTGAGCCAATATGTTCCCACATAACCAAGGAAGATTGCGCTAAAGCTCGACTA
GCAGCATCGCCTAACCCTATCTCGACGACACCTACCATCTGCGATCGTGTTCATTTTCGTCCTCTTATTCGTCCT
CACACAGATCCCAGTTTGGGTCACTGTTCTTATCTTAATACCTGCTATTCTGAGCCTACTTACGCCCAGTCACCT
TCAATACCCGCATATCCTGGTAGTACATCTTCCAGGGGTCCCGTCTCTCTTCCCTCCGGTCTCGGGGCAGGAGGC
CGCGGGAAAGAGAAAGCGCCATGCCGTTATCTGCACTATGAAGTAGATTGGGATCCCACTGACGCTGAGAACGAG
AAAACAAAAGAACGCGTCGCTGTCAAAGGCAAGCCACATCGTTTGGAGATTGGTTTGGGTCCTCCAGGACGTGAA
GCCACCCCACTTCCGCCGCAATGGATCAACTGCGATCTGCGCAAGTTTGATTATTCAGTGCTAGGCAAGTTTCAT
GTCATTATGGCAGATCCGCCTTGGGATATTCATATGAGCTTACCCTATGGGACAATGACCGATGATGAAATGCGT
GCGATGCCAATTCCAGCATTGCAAGACGAAGGTCTTCTCTTCCTATGGGTAACAGGCCGCGCCATGGAGGTTGGA
CGCGAATGTTTACGTGTCTGGGGATACACACGTGTAGACGAAGTCATCTGGGTGAAAACCAATCAACTTCAACGA
GTCATACGCACCGGAAGGACTGGTCATTGGCTCAATCACACTAAAGAACACATGCTCGTCGGTGTCAAAACTCCA
TCCTCCCCTTCAGATGGCCCCGAGACGGAACTCAAGTTTCCAAAGTGGGTAAACCGGGGAGTAGACACAGACGTT
ATTGTGAGTGAGGTAAGAGAGACAAGTCGAAAGCCGGATGAAGTGTATGGATTGATTGAGAGGATGTGTCCGGGT
GGAAGGAAAGTTGAGATATTTGGGAGGAAACATAATGCCCGACCAGGGTGGTTGACGTTGGGCAATCAATTAGGA
CCCGCAGATCAGATTTGGGAGGAGGATTTATTGGAAAGAGTGCGAGCGAAATACCCAGAAAGGAAGGTCAATGTA
CCGCCGATACCTACCTCGAATTTCTGA
Gene >Agabi119p4|075040
ATGTCCGACGATGAACTCTACCTGATCACCAAAACTGCACTCAGAGTCATTTTGGGCGATGAACGCACTACGTTC
GCGACACCAATAACGTCAATGGCATTATTGACCAAGATAATGACTACCGATCTACCCAACGGCCTCTTTCCTGCA
TCTTCAAAACCTACCCCGAGATTTAGACTTACGGACGTACACAGGCTTGAAAGCATACTAGAAGGTCTTTCGCAA
CCTCAGGCATGGGACGAGGGCTATATATCTGTCTCGCGTGACAATGACACGGGTGAATTGACGATATGGGAATTA
GGACTTGGACCTCGGAAGATTGTCTCGGGGACGAAGAGGAAGAGAATTATCGATGAAGAAGCGGACTCTGCTGCT
GGAAGTGACAATGAAGAGGATGAGGAGGGGAGTATGGCCGGAGCCACAGGATGGGCAAAGTCTACCTTGGGTGGA
TTGAGTAGGGAGATGAGGGACGTGTATGCTCTGCTGCAAAGAGGTACCGCCAAAGGGAAACTACTCGCAGAACAC
GTCAGTTCATTCTAATTCTTCCTTTCGCACTATCTGAATGCTTGCTTGCCCTAGTTCCGGACTATACAAGACGGA
TTTGAGCCAATATGTTCCCACATAACCAAGGAAGATTGCGCTAAAGCTCGACTAGCAGCATCGCCTAACCCTATC
TCGACGACACCTACCATCTGCGATCGTGTTCATTTTCGTCCTCTTATTCGTCCTCACACAGATCCCAGTTTGGGT
CACTGTTCTTATCTTAATACCTGCTATTCTGAGCCTACTTACGCCCAGTCACCTTCAATACCCGCATATCCTGGT
AGTACATCTTCCAGGGGTCCCGTCTCTCTTCCCTCCGGTCTCGGGGCAGGAGGCCGCGGGAAAGAGAAAGCGCCA
TGCCGTTATCTGCACTATGAAGTAGATTGGGATCCCACTGACGCTGAGAACGAGAAAACAAAAGAACGCGTCGCT
GTCAAAGGCAAGCCACATCGTTTGGAGATTGGTTTGGGTCCTCCAGGACGTGAAGCCACCCCAGTTCGTTCCCTC
TTTCCCTCGATTTTCACGGTAGTACCATTTAACCTCATCCTCTATGGTATAGCTTCCGCCGCAATGGATCAACTG
CGATCTGCGCAAGTTTGATTATTCAGTGCTAGGCAAGTTTCATGTCATTATGGCAGATCCGCCTTGGGATATTCA
TATGAGCGTAAGTGGTTTAAACTTGTTATTAAAAGGTACCTGAATAATCCTCCAGTTACCCTATGGGACAATGAC
CGATGATGAAATGCGTGCGATGCCAATTCCAGCATTGCAAGACGAAGGTCTTCTCTTCCTATGGGTAACAGGCCG
CGCCATGGAGGTTGGACGCGAATGTTTACGTGTCTGGGGATACACACGTGTAGACGAAGTCATCTGGGTGAAAAC
CAATCAACTTCAACGAGTCATACGCACCGGAAGGACTGGTCATTGGCTCAATCACACTAAAGAACACATGCTCGT
CGGTGTCAAAACTCCATCCTCCCCTTCAGATGGCCCCGAGACGGAACTCAAGTTTCCAAAGTGGGTAAACCGGGG
AGTAGACACAGACGTTATTGTGAGTGAGGTAAGAGAGACAAGTCGAAAGCCGGATGAAGTGTATGGATTGATTGA
GAGGATGTGTCCGGGTGGAAGGAAAGTTGAGATATTTGGGAGGAAACATAATGCCCGACCAGGGTGGTTGACGTT
GGGCAATCAATTAGGACCCGCAGATCAGATTTGGGAGGAGGATTTATTGGAAAGAGTGCGAGCGAAGTAAGATAT
TTTTTGATTAATCGCTGCGAACGGAGTCTCATTCTCGTTCGATTTGCACAGATACCCAGAAAGGAAGGTCAATGT
ACCGCCGATACCTACCTCGAATTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail