Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|074560
Gene name
Locationscaffold_04:2060572..2063285
Strand-
Gene length (bp)2713
Transcript length (bp)2439
Coding sequence length (bp)2439
Protein length (aa) 813

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.3E-08 327 396
PF13637 Ank_4 Ankyrin repeats (many copies) 5.9E-10 345 392
PF00023 Ank Ankyrin repeat 4.9E-05 343 374
PF00023 Ank Ankyrin repeat 1.2E-04 462 494
PF13606 Ank_3 Ankyrin repeat 5.2E-04 343 370
PF13606 Ank_3 Ankyrin repeat 4.6E-03 462 490

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41412|RES2_SCHPO Cell division cycle-related protein res2/pct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res2 PE=1 SV=1 67 795 1.0E-102
sp|P33520|RES1_SCHPO Cell division cycle-related protein res1/sct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res1 PE=1 SV=1 73 503 2.0E-83
sp|P39679|MBP1_KLULA Transcription factor MBP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MBP1 PE=3 SV=2 305 794 4.0E-34
sp|P39678|MBP1_YEAST Transcription factor MBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MBP1 PE=1 SV=1 308 503 4.0E-32
sp|P39679|MBP1_KLULA Transcription factor MBP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MBP1 PE=3 SV=2 73 208 8.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41412|RES2_SCHPO Cell division cycle-related protein res2/pct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res2 PE=1 SV=1 67 795 1.0E-102
sp|P33520|RES1_SCHPO Cell division cycle-related protein res1/sct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res1 PE=1 SV=1 73 503 2.0E-83
sp|P39679|MBP1_KLULA Transcription factor MBP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MBP1 PE=3 SV=2 305 794 4.0E-34
sp|P39678|MBP1_YEAST Transcription factor MBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MBP1 PE=1 SV=1 308 503 4.0E-32
sp|P39679|MBP1_KLULA Transcription factor MBP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MBP1 PE=3 SV=2 73 208 8.0E-32
sp|P39678|MBP1_YEAST Transcription factor MBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MBP1 PE=1 SV=1 73 236 1.0E-30
sp|P40418|SWI6_KLULA Regulatory protein SWI6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWI6 PE=3 SV=1 329 502 1.0E-26
sp|P25302|SWI4_YEAST Regulatory protein SWI4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI4 PE=1 SV=2 77 198 5.0E-23
sp|P09959|SWI6_YEAST Regulatory protein SWI6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI6 PE=1 SV=1 330 618 1.0E-21
sp|P25302|SWI4_YEAST Regulatory protein SWI4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI4 PE=1 SV=2 331 498 2.0E-19
sp|P01129|CDC10_SCHPO Start control protein cdc10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc10 PE=1 SV=1 72 217 2.0E-12
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 341 513 1.0E-11
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 304 513 1.0E-11
sp|Q6NY19|KANK3_HUMAN KN motif and ankyrin repeat domain-containing protein 3 OS=Homo sapiens GN=KANK3 PE=1 SV=1 337 508 1.0E-09
sp|P36011|STUA_EMENI Cell pattern formation-associated protein stuA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stuA PE=2 SV=2 84 169 6.0E-07
sp|Q5T7N3|KANK4_HUMAN KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens GN=KANK4 PE=2 SV=1 337 499 8.0E-07
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 289 496 9.0E-07
sp|Q59P39|EFH1_CANAL Transcriptional regulator EFH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFH1 PE=2 SV=1 85 169 1.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 343 498 1.0E-06
sp|Q6P9J5|KANK4_MOUSE KN motif and ankyrin repeat domain-containing protein 4 OS=Mus musculus GN=Kank4 PE=1 SV=1 337 504 1.0E-06
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 333 590 2.0E-06
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 341 502 2.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 339 498 2.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 343 498 3.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 339 498 5.0E-06
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 321 505 5.0E-06
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 316 493 5.0E-06
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 333 590 6.0E-06
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 333 499 7.0E-06
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 339 498 9.0E-06
sp|Q94B55|XB31_ARATH Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 343 487 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|074560
MGLTRLPAEQYEDLVAHTWTRFPTFPKLTLYDKRTRLSCIKLAFIRRREANLLPAPEIQLLKQDDAMPATDAQIF
KATYSGIPVYEMMCKGVAVMRRRDDSWLNATQILKVAGFDKPQRTRVLEREVQKGVHEKVQGGYGKYQGTWIPLE
RGLALAKQYNCDHILRPIIEFQPAAKSPPLAPKHLVSNASSATKPARKAAEQVPNNSVINTRSTRRNAPEVVEEE
SDHESLSVHGSEDGSMTPSPSEASSSSRTPSPINSPGPSYDSLAGEDDTMSARRNRYRRNDEDGYGDMNEDELRM
NGGDARTYGDQILEYFISDSNQIPPILINPPADFDPNMAIDDDGHTSLHWACAMGRIRIVKLLLSAGADIFKVNK
AGQTALMRSVMFANNYDVRKFQELYELLHRSTLNIDNYNRTVFHHVVDIAMTKGKTHAARYYMEIVLGRLSDYPR
ELSDVINFQDEDGETALTMAARCRSKRLVKLLIDNGADPKIVNNDGKSAEDYILEDEKFRSSPVPTTRTLPMSFR
NAQAAFPPPNADPGYVFAPSHGDRPPLHHSVVAQRASTRCVNDIASMLDSLAASFDQELREKERDMNQAHALLTN
IQAEILESQRTVNQLKNQAEGLMHTKSSLNLLENELSSKMGRRYRLGWEKWVKAEEAREKRIREAAEGELVVTEA
TAHYEIEDEVDGTASQSTEKNKGKRKATEDVSDLLFLHSNIPTESEELKNACDKLREEMADFRKRRKLMFDELVA
FQAEAGTGGRMSEYRRLIGAGCGGVPPSEVDQVLGMLLETLESEEPSSSSNAWNGSKPVPVG*
Coding >Agabi119p4|074560
ATGGGTTTGACCCGCTTACCTGCTGAGCAATATGAAGATTTAGTCGCGCATACTTGGACACGATTCCCTACTTTC
CCAAAGCTCACCTTGTACGATAAGCGAACCCGCCTATCTTGTATAAAATTGGCGTTTATTCGACGCCGTGAAGCG
AATTTGCTACCCGCACCAGAGATTCAATTACTGAAACAGGACGACGCCATGCCCGCAACGGACGCCCAGATCTTC
AAGGCTACGTACAGTGGTATACCTGTATATGAGATGATGTGTAAGGGTGTTGCAGTGATGCGGCGGCGAGATGAC
TCGTGGTTGAACGCGACACAAATACTTAAAGTCGCAGGATTCGATAAACCGCAACGTACTCGTGTGTTAGAACGC
GAAGTTCAAAAGGGTGTTCATGAGAAGGTGCAAGGAGGTTATGGCAAGTATCAAGGAACCTGGATTCCTCTAGAA
CGCGGATTGGCATTAGCCAAGCAATACAATTGCGATCATATTTTACGACCTATAATCGAATTTCAACCTGCTGCG
AAGAGTCCCCCACTTGCTCCAAAACATTTAGTCTCGAATGCGAGTAGTGCTACCAAACCCGCACGCAAGGCTGCG
GAACAAGTTCCTAATAACTCGGTAATAAATACACGATCGACACGGAGAAATGCGCCGGAGGTGGTTGAGGAAGAG
TCAGACCACGAAAGCCTTTCTGTCCATGGTTCGGAAGACGGCTCTATGACACCCTCACCATCCGAAGCGTCTTCA
AGTTCACGTACACCTTCTCCAATAAATAGTCCCGGGCCTTCTTATGACAGTCTGGCAGGAGAGGATGATACAATG
TCGGCTAGGAGGAATCGATATCGACGGAACGATGAAGACGGTTACGGGGATATGAACGAGGATGAGCTCCGAATG
AATGGTGGAGATGCTCGGACGTACGGAGATCAAATTTTGGAATATTTCATCTCAGATTCAAACCAAATCCCGCCC
ATTCTTATCAACCCTCCTGCGGATTTCGACCCCAACATGGCTATTGACGATGATGGACACACCTCTTTACACTGG
GCTTGTGCTATGGGACGCATCCGGATAGTCAAGCTACTCCTATCAGCCGGAGCAGACATTTTCAAAGTCAATAAA
GCTGGCCAAACTGCCCTTATGCGCAGCGTGATGTTCGCGAATAATTATGACGTCCGTAAATTTCAAGAGCTTTAT
GAACTACTTCACAGGTCGACGCTCAACATTGACAACTATAACCGGACCGTATTCCATCATGTAGTGGATATTGCA
ATGACCAAAGGAAAGACGCATGCGGCGCGATATTACATGGAAATTGTCCTGGGTCGACTTTCAGACTATCCAAGA
GAGCTGTCCGACGTCATCAACTTTCAGGACGAGGATGGGGAGACTGCACTAACTATGGCTGCTCGTTGTCGCAGT
AAACGACTGGTCAAGCTTCTTATTGATAATGGCGCCGACCCAAAAATAGTGAACAACGACGGCAAAAGCGCAGAG
GACTACATTTTAGAGGACGAAAAATTCCGTTCGTCGCCTGTACCTACTACGCGTACCCTCCCGATGTCATTCCGG
AATGCGCAGGCTGCTTTCCCGCCACCTAATGCAGATCCTGGCTATGTCTTCGCGCCTTCACATGGAGACCGGCCA
CCACTGCATCACTCGGTCGTTGCGCAACGCGCTAGTACGCGATGTGTAAATGACATCGCATCGATGTTGGATAGC
TTAGCAGCATCTTTCGACCAGGAATTGCGGGAGAAAGAGAGGGATATGAACCAGGCACATGCTTTGTTGACGAAT
ATCCAAGCGGAGATTTTGGAGAGTCAGAGAACAGTCAATCAGCTAAAAAATCAAGCGGAAGGGCTGATGCACACA
AAGTCCTCGTTAAATCTTCTTGAGAATGAGTTATCTTCGAAAATGGGAAGGCGGTATAGACTTGGGTGGGAGAAA
TGGGTCAAAGCTGAAGAAGCTCGGGAGAAACGTATTCGAGAAGCGGCAGAGGGAGAGTTGGTGGTGACAGAGGCT
ACGGCACATTATGAAATTGAGGATGAAGTGGATGGTACTGCCTCGCAGTCGACGGAAAAAAACAAAGGGAAGCGG
AAGGCCACAGAAGACGTTTCTGATCTCCTCTTTTTACATTCAAATATTCCCACAGAATCTGAAGAGTTGAAAAAC
GCCTGTGACAAGCTCAGGGAGGAGATGGCCGACTTTAGAAAGAGGCGAAAATTGATGTTTGATGAATTGGTTGCA
TTTCAAGCGGAGGCAGGGACAGGCGGGCGGATGAGTGAGTACAGGAGGTTGATTGGGGCAGGATGTGGAGGTGTG
CCCCCATCCGAAGTTGATCAAGTATTGGGTATGCTTTTGGAGACTCTTGAATCCGAGGAACCTAGTTCTTCATCA
AATGCATGGAACGGCTCAAAACCGGTGCCAGTTGGATAG
Transcript >Agabi119p4|074560
ATGGGTTTGACCCGCTTACCTGCTGAGCAATATGAAGATTTAGTCGCGCATACTTGGACACGATTCCCTACTTTC
CCAAAGCTCACCTTGTACGATAAGCGAACCCGCCTATCTTGTATAAAATTGGCGTTTATTCGACGCCGTGAAGCG
AATTTGCTACCCGCACCAGAGATTCAATTACTGAAACAGGACGACGCCATGCCCGCAACGGACGCCCAGATCTTC
AAGGCTACGTACAGTGGTATACCTGTATATGAGATGATGTGTAAGGGTGTTGCAGTGATGCGGCGGCGAGATGAC
TCGTGGTTGAACGCGACACAAATACTTAAAGTCGCAGGATTCGATAAACCGCAACGTACTCGTGTGTTAGAACGC
GAAGTTCAAAAGGGTGTTCATGAGAAGGTGCAAGGAGGTTATGGCAAGTATCAAGGAACCTGGATTCCTCTAGAA
CGCGGATTGGCATTAGCCAAGCAATACAATTGCGATCATATTTTACGACCTATAATCGAATTTCAACCTGCTGCG
AAGAGTCCCCCACTTGCTCCAAAACATTTAGTCTCGAATGCGAGTAGTGCTACCAAACCCGCACGCAAGGCTGCG
GAACAAGTTCCTAATAACTCGGTAATAAATACACGATCGACACGGAGAAATGCGCCGGAGGTGGTTGAGGAAGAG
TCAGACCACGAAAGCCTTTCTGTCCATGGTTCGGAAGACGGCTCTATGACACCCTCACCATCCGAAGCGTCTTCA
AGTTCACGTACACCTTCTCCAATAAATAGTCCCGGGCCTTCTTATGACAGTCTGGCAGGAGAGGATGATACAATG
TCGGCTAGGAGGAATCGATATCGACGGAACGATGAAGACGGTTACGGGGATATGAACGAGGATGAGCTCCGAATG
AATGGTGGAGATGCTCGGACGTACGGAGATCAAATTTTGGAATATTTCATCTCAGATTCAAACCAAATCCCGCCC
ATTCTTATCAACCCTCCTGCGGATTTCGACCCCAACATGGCTATTGACGATGATGGACACACCTCTTTACACTGG
GCTTGTGCTATGGGACGCATCCGGATAGTCAAGCTACTCCTATCAGCCGGAGCAGACATTTTCAAAGTCAATAAA
GCTGGCCAAACTGCCCTTATGCGCAGCGTGATGTTCGCGAATAATTATGACGTCCGTAAATTTCAAGAGCTTTAT
GAACTACTTCACAGGTCGACGCTCAACATTGACAACTATAACCGGACCGTATTCCATCATGTAGTGGATATTGCA
ATGACCAAAGGAAAGACGCATGCGGCGCGATATTACATGGAAATTGTCCTGGGTCGACTTTCAGACTATCCAAGA
GAGCTGTCCGACGTCATCAACTTTCAGGACGAGGATGGGGAGACTGCACTAACTATGGCTGCTCGTTGTCGCAGT
AAACGACTGGTCAAGCTTCTTATTGATAATGGCGCCGACCCAAAAATAGTGAACAACGACGGCAAAAGCGCAGAG
GACTACATTTTAGAGGACGAAAAATTCCGTTCGTCGCCTGTACCTACTACGCGTACCCTCCCGATGTCATTCCGG
AATGCGCAGGCTGCTTTCCCGCCACCTAATGCAGATCCTGGCTATGTCTTCGCGCCTTCACATGGAGACCGGCCA
CCACTGCATCACTCGGTCGTTGCGCAACGCGCTAGTACGCGATGTGTAAATGACATCGCATCGATGTTGGATAGC
TTAGCAGCATCTTTCGACCAGGAATTGCGGGAGAAAGAGAGGGATATGAACCAGGCACATGCTTTGTTGACGAAT
ATCCAAGCGGAGATTTTGGAGAGTCAGAGAACAGTCAATCAGCTAAAAAATCAAGCGGAAGGGCTGATGCACACA
AAGTCCTCGTTAAATCTTCTTGAGAATGAGTTATCTTCGAAAATGGGAAGGCGGTATAGACTTGGGTGGGAGAAA
TGGGTCAAAGCTGAAGAAGCTCGGGAGAAACGTATTCGAGAAGCGGCAGAGGGAGAGTTGGTGGTGACAGAGGCT
ACGGCACATTATGAAATTGAGGATGAAGTGGATGGTACTGCCTCGCAGTCGACGGAAAAAAACAAAGGGAAGCGG
AAGGCCACAGAAGACGTTTCTGATCTCCTCTTTTTACATTCAAATATTCCCACAGAATCTGAAGAGTTGAAAAAC
GCCTGTGACAAGCTCAGGGAGGAGATGGCCGACTTTAGAAAGAGGCGAAAATTGATGTTTGATGAATTGGTTGCA
TTTCAAGCGGAGGCAGGGACAGGCGGGCGGATGAGTGAGTACAGGAGGTTGATTGGGGCAGGATGTGGAGGTGTG
CCCCCATCCGAAGTTGATCAAGTATTGGGTATGCTTTTGGAGACTCTTGAATCCGAGGAACCTAGTTCTTCATCA
AATGCATGGAACGGCTCAAAACCGGTGCCAGTTGGATAG
Gene >Agabi119p4|074560
ATGGGTTTGACCCGCTTACCTGCTGAGCAATATGAAGATTTAGTCGCGCATACTTGGTATATTGTAAGTGGTGAC
CTTATTTGTGTTTGTTGCCCCACGCGCTCGCGTCAAGGACACGATTCCCTACTTTCCCAAAGCTCACCTTGTACG
ATAAGCGAACCCGCCTATCTTGTATAAAATTGGCGTTTATTCGACGCCGTGAAGCGAATTTGCTACCCGCACCAG
AGATTCAATTACTGAAACAGGACGACGCCATGCCCGCAACGGACGCCCAGATCTTCAAGGTAAATACCCCCCGCT
CTTGCAATTTACCACGGGTTTAGCTGATAATTGATTTCCAGGCTACGTACAGTGGTATACCTGTATATGAGATGT
AAGGCGGCCTATGCGTGAGACGCGTTACGCGTTGTTTGCTGAAAGGATGTTTACAGGATGTGTAAGGGTGTTGCA
GTGATGCGGCGGCGAGATGACTCGTGGTTGAACGCGACACAAATACTTAAAGTCGCAGGATTCGATAAACCGCAA
CGTACTCGTGTGTTAGAACGCGAAGTTCAAAAGGGTGTTCATGAGAAGGTGCAAGGAGGTTATGGCAAGTATCAA
GGTGGGTACCACTCAATCTAAAGCCATTGTTCTGGATTTATCATTCTTTGGTTGTAGGAACCTGGATTCCTCTAG
AACGCGGATTGGCATTAGCCAAGCAATACAATTGCGATCATATTTTACGACCTATAATCGAATTTCAACCTGCTG
CGAAGAGTCCCCCACTTGCTCCAAAACATTTAGTCTCGAATGCGAGTAGTGCTACCAAACCCGCACGCAAGGCTG
CGGAACAAGTTCCTAATAACTCGGTAATAAATACACGATCGACACGGAGAAATGCGCCGGAGGTGGTTGAGGAAG
AGTCAGACCACGAAAGCCTTTCTGTCCATGGTTCGGAAGACGGCTCTATGACACCCTCACCATCCGAAGCGTCTT
CAAGTTCACGTACACCTTCTCCAATAAATAGTCCCGGGCCTTCTTATGACAGTCTGGCAGGAGAGGATGATACAA
TGTCGGCTAGGAGGAATCGATATCGACGGAACGATGAAGACGGTTACGGGGATATGAACGAGGATGAGCTCCGAA
TGAATGGTGGAGATGCTCGGACGTACGGAGATCAAATTTTGGAATATTTCATCTCAGATTCAAACCAAATCCCGC
CCATTCTTATCAACCCTCCTGCGGATTTCGACCCCAACATGGCTATTGACGATGATGGACACACCTCTTTACACT
GGGCTTGTGCTATGGGACGCATCCGGATAGTCAAGCTACTCCTATCAGCCGGAGCAGACATTTTCAAAGTCAATA
AAGCTGGCCAAACTGCCCTTATGCGCAGCGTGATGTTCGCGAATAATTATGACGTCCGTAAATTTCAAGAGCTTT
ATGAACTACTTCACAGGTCGACGCTCAACATTGACAACTATAACCGGACCGTATTCCATCATGTAGTGGATATTG
CAATGACCAAAGGAAAGACGCATGCGGCGCGATATTACATGGAAATTGTCCTGGGTCGACTTTCAGACTATCCAA
GAGAGCTGTCCGACGTCATCAACTTTCAGGACGAGGATGGGGAGACTGCACTAACTATGGCTGCTCGTTGTCGCA
GTAAACGACTGGTCAAGCTTCTTATTGATAATGGCGCCGACCCAAAAATAGTGAACAACGACGGCAAAAGCGCAG
AGGACTACATTTTAGAGGACGAAAAATTCCGTTCGTCGCCTGTACCTACTACGCGTACCCTCCCGATGTCATTCC
GGAATGCGCAGGCTGCTTTCCCGCCACCTAATGCAGATCCTGGCTATGTCTTCGCGCCTTCACATGGAGACCGGC
CACCACTGCATCACTCGGTCGTTGCGCAACGCGCTAGTACGCGATGTGTAAATGACATCGCATCGATGTTGGATA
GCTTAGCAGCATCTTTCGACCAGGAATTGCGGGAGAAAGAGAGGGATATGAACCAGGCACATGCTTTGTTGACGA
ATATCCAAGCGGAGATTTTGGAGAGTCAGAGAACAGTCAATCAGCTAAAAAATCAAGCGGAAGGGCTGATGCACA
CAAAGTCCTCGTTAAATCTTCTTGAGAATGAGTTATCTTCGAAAATGGGAAGGCGGTATAGACTTGGGTGGGAGA
AATGGGTCAAAGCTGAAGAAGCTCGGGAGAAACGTATTCGAGAAGCGGCAGAGGGAGAGTTGGTGGTGACAGAGG
CTACGGCACATTATGAAATTGAGGATGAAGTGGATGGTACTGCCTCGCAGTCGACGGAAAAAAACAAAGGGAAGC
GGAAGGCCACAGAAGACGTTTCTGATCTCCTCTTTTTACATTCAAATATTCCCACAGAATCTGAAGAGTTGAAAA
ACGCCTGTGACAAGCTCAGGGAGGAGATGGCCGACTTTAGAAAGAGGCGAAAATTGATGTTTGATGAATTGGTTG
CATTTCAAGCGGAGGCAGGGACAGGCGGGCGGATGAGTGAGTACAGGAGGTTGATTGGGGCAGGATGTGGAGGTG
TGCCCCCATCCGAAGTTGATCAAGTATTGGGTATGCTTTTGGAGGTGCGTTGTCCCGCTGTCAACTGTTGTCTTA
TACTCATTGTCTACAGACTCTTGAATCCGAGGAACCTAGTTCTTCATCAAATGCATGGAACGGCTCAAAACCGGT
GCCAGTTGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail