Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|074200
Gene name
Locationscaffold_04:1982514..1984285
Strand-
Gene length (bp)1771
Transcript length (bp)1200
Coding sequence length (bp)1200
Protein length (aa) 400

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17 5.0E-10 309 389

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B8NTP7|BTGC_ASPFN Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgC PE=3 SV=2 94 396 2.0E-45
sp|Q2U492|BTGC_ASPOR Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgC PE=3 SV=1 94 396 2.0E-45
sp|Q0CI96|BTGC_ASPTN Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=btgC PE=3 SV=2 94 396 3.0E-41
sp|Q4WUK5|BTGC_ASPFU Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgC PE=3 SV=1 94 396 3.0E-40
sp|B0Y429|BTGC_ASPFC Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgC PE=3 SV=1 94 396 4.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B8NTP7|BTGC_ASPFN Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgC PE=3 SV=2 94 396 2.0E-45
sp|Q2U492|BTGC_ASPOR Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgC PE=3 SV=1 94 396 2.0E-45
sp|Q0CI96|BTGC_ASPTN Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=btgC PE=3 SV=2 94 396 3.0E-41
sp|Q4WUK5|BTGC_ASPFU Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgC PE=3 SV=1 94 396 3.0E-40
sp|B0Y429|BTGC_ASPFC Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgC PE=3 SV=1 94 396 4.0E-40
sp|Q5B430|BTGC_EMENI Glucan endo-1,3-beta-glucosidase btgC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=btgC PE=2 SV=1 94 396 8.0E-40
sp|A1DEV5|BTGC_NEOFI Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgC PE=3 SV=1 94 396 1.0E-39
sp|A1CAI0|BTGC_ASPCL Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=btgC PE=3 SV=1 94 396 1.0E-38
sp|A2QN74|BTGC_ASPNC Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=btgC PE=3 SV=2 94 396 6.0E-38
sp|O13990|BGL2_SCHPO Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgl2 PE=2 SV=4 118 389 1.0E-20
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 100 385 7.0E-14
sp|D4B2W4|BGL2_ARTBC Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02797 PE=1 SV=1 122 389 7.0E-14
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 100 383 2.0E-12
sp|P15703|BGL2_YEAST Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BGL2 PE=1 SV=1 123 389 2.0E-10
sp|Q59XX2|MP65_CANAL Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MP65 PE=1 SV=2 134 383 1.0E-09
sp|Q4WC60|BTGE_ASPFU Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgE PE=3 SV=2 100 383 6.0E-07
sp|B0Y9Q9|BTGE_ASPFC Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgE PE=3 SV=2 100 383 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|074200
MEEKYQHLEGSGGMAQALEKEKSRRKRSIWIVVASVVGILVLVAVAVIAWYFSTHKNNGSNGSGGNPGKSGDSTG
NNTPNDGSDPSIFELDSRLHKSFYGMAYTPEGSQLPNCGNSLENVIKDIQILSQLTTRVRLYGADCNQSALVLEA
IKQTKVDMQVFLGNYPIPDDNTPYERQRDIIKEALQTYGADHVAGVTVGNEFMLNYLTGQGVQDPNGIIGQQGAA
ILKANIEDTRQMIDGLQLSKHIPVGNSDAGSFFSNSVLTDVEYGMSNVHAWFANTTAEGAAPWVFQFFDENNVQP
AALLPNKPKMYIAETGWPTKSSDAGNANNGGSDASVPNLQVFIDNFVCQANSNNVGYFFFEYFDEQWKDAMFGGV
EGWWGLFNADRTLKDITIPDCPAP*
Coding >Agabi119p4|074200
ATGGAGGAAAAATATCAGCATCTTGAAGGATCGGGTGGGATGGCCCAAGCACTGGAAAAGGAGAAATCTCGACGA
AAGAGATCGATATGGATTGTCGTCGCTTCCGTAGTGGGAATTCTAGTTCTCGTCGCTGTAGCCGTCATAGCTTGG
TATTTCTCCACCCACAAAAACAACGGCTCTAATGGCAGTGGCGGCAACCCGGGGAAGTCTGGTGACAGCACCGGC
AATAACACCCCGAACGATGGTAGTGACCCGAGTATATTCGAGCTTGATTCGCGGTTACATAAGTCATTTTATGGT
ATGGCATATACCCCGGAAGGTTCTCAGCTACCGAATTGTGGAAATTCACTGGAAAATGTTATCAAAGATATACAG
ATACTCTCCCAGCTCACCACCCGTGTTCGACTATATGGTGCCGACTGCAACCAAAGCGCACTTGTTCTGGAAGCG
ATTAAACAAACAAAGGTCGATATGCAAGTCTTCCTCGGTAACTACCCCATTCCCGATGACAATACACCATACGAG
AGACAGCGAGACATCATCAAAGAGGCTCTCCAAACTTACGGTGCCGACCATGTTGCTGGGGTCACCGTTGGTAAC
GAATTTATGCTCAATTACCTGACCGGTCAAGGCGTTCAGGATCCTAATGGTATTATAGGCCAACAAGGTGCTGCT
ATCCTCAAGGCTAACATTGAGGATACACGTCAAATGATTGATGGTCTGCAATTATCCAAACATATTCCTGTCGGA
AATTCCGATGCCGGAAGTTTCTTCAGCAACTCTGTGCTAACTGACGTCGAATATGGTATGTCGAACGTGCACGCC
TGGTTCGCCAATACGACAGCAGAGGGTGCAGCGCCTTGGGTTTTCCAGTTCTTTGATGAGAACAATGTCCAGCCT
GCTGCTCTATTACCGAACAAACCCAAGATGTACATTGCGGAGACCGGTTGGCCTACGAAATCCTCGGACGCAGGA
AATGCCAACAACGGTGGTTCCGATGCCTCCGTACCTAATCTTCAGGTATTCATCGACAACTTCGTCTGTCAGGCC
AATTCCAACAATGTCGGATATTTCTTCTTCGAATACTTTGATGAACAATGGAAGGATGCTATGTTTGGCGGAGTT
GAAGGCTGGTGGGGTCTTTTCAACGCGGATCGTACGTTGAAGGATATCACAATACCTGACTGCCCTGCTCCTTGA
Transcript >Agabi119p4|074200
ATGGAGGAAAAATATCAGCATCTTGAAGGATCGGGTGGGATGGCCCAAGCACTGGAAAAGGAGAAATCTCGACGA
AAGAGATCGATATGGATTGTCGTCGCTTCCGTAGTGGGAATTCTAGTTCTCGTCGCTGTAGCCGTCATAGCTTGG
TATTTCTCCACCCACAAAAACAACGGCTCTAATGGCAGTGGCGGCAACCCGGGGAAGTCTGGTGACAGCACCGGC
AATAACACCCCGAACGATGGTAGTGACCCGAGTATATTCGAGCTTGATTCGCGGTTACATAAGTCATTTTATGGT
ATGGCATATACCCCGGAAGGTTCTCAGCTACCGAATTGTGGAAATTCACTGGAAAATGTTATCAAAGATATACAG
ATACTCTCCCAGCTCACCACCCGTGTTCGACTATATGGTGCCGACTGCAACCAAAGCGCACTTGTTCTGGAAGCG
ATTAAACAAACAAAGGTCGATATGCAAGTCTTCCTCGGTAACTACCCCATTCCCGATGACAATACACCATACGAG
AGACAGCGAGACATCATCAAAGAGGCTCTCCAAACTTACGGTGCCGACCATGTTGCTGGGGTCACCGTTGGTAAC
GAATTTATGCTCAATTACCTGACCGGTCAAGGCGTTCAGGATCCTAATGGTATTATAGGCCAACAAGGTGCTGCT
ATCCTCAAGGCTAACATTGAGGATACACGTCAAATGATTGATGGTCTGCAATTATCCAAACATATTCCTGTCGGA
AATTCCGATGCCGGAAGTTTCTTCAGCAACTCTGTGCTAACTGACGTCGAATATGGTATGTCGAACGTGCACGCC
TGGTTCGCCAATACGACAGCAGAGGGTGCAGCGCCTTGGGTTTTCCAGTTCTTTGATGAGAACAATGTCCAGCCT
GCTGCTCTATTACCGAACAAACCCAAGATGTACATTGCGGAGACCGGTTGGCCTACGAAATCCTCGGACGCAGGA
AATGCCAACAACGGTGGTTCCGATGCCTCCGTACCTAATCTTCAGGTATTCATCGACAACTTCGTCTGTCAGGCC
AATTCCAACAATGTCGGATATTTCTTCTTCGAATACTTTGATGAACAATGGAAGGATGCTATGTTTGGCGGAGTT
GAAGGCTGGTGGGGTCTTTTCAACGCGGATCGTACGTTGAAGGATATCACAATACCTGACTGCCCTGCTCCTTGA
Gene >Agabi119p4|074200
ATGGAGGAAAAATATCAGCATCTTGAAGGATCGGGTGGGATGGCCCAAGCACTGGAAAAGGAGAAATCTCGACGA
AAGAGATCGATATGGATTGTATGTTTCTCAGAAAATTCTCGTCGCCGACTTTTGACTCACTACCGCTTCAAATTC
TATTCGGTTGTTGCTAGGTCGTCGCTTCCGTAGTGGGAATTCTAGTTCTCGTCGCTGTAGCCGTCATAGCTTGGT
ATTTCTCCACCCACAAAAACAACGGCTCTAATGGCAGTGGCGGCAACCCGGGGAAGTCTGGTGACAGCACCGGCA
ATAACACCCCGAACGATGGTAGTGACCCGAGTATATTCGAGCTTGATTCGCGGTTACATAAGTCATTTTATGGTA
TGGCATATACCCCGGAAGGTTCTCAGCTACCGAATTGTGGAAATTCACTGGGTAAGTGGAGCTTGCCACTCTCCC
ATGCTTCTGATTCTGATTCCTCTTGACTAGAAAATGTTATCAAAGATATACAGGTGGGGCCCAGCCCTTGTACAC
TACCAAGATGAACCGGGCTCATTTTCTTTTAGATACTCTCCCAGCTCACCACCCGTGTTCGACTATATGGTGCCG
ACTGCAACCAAAGCGCACTTGTTGTACGTCAATTCACCTGCTATTTTTACTGTCTCCAAAGAATAATTTCCTTGG
CAGCTGGAAGCGATTAAACAAACAAAGGTCGATATGCAAGTCTTCCTCGGTAACTACCCCATTCCCGATGACAAT
ACACCATACGAGAGACAGCGAGACATCATCAAAGAGGCTCTCCAAACTTACGGTGCCGACCATGTTGCTGGGGTC
ACCGTTGGTAACGAATTTATGCTCAAGTATGTGAGAATGCAGCATCATAGACATTGCTTGGCTTATGTCCTCGCT
TAGTTACCTGACCGGTCAAGGCGTTCAGGATCCTAATGGTATTATAGGCCAACAAGGTGAAATTTGACCATTAGT
GTGGAAGCTGTGGTGGCTCAATATACTTATAGGTGCTGCTATCCTCAAGGCTAACATTGAGGATACACGTCAAAT
GATTGATGGTCTGCAATTATCCAAACATATTCCTGTCGGAAATTCCGATGCCGGAAGTTTCTTCAGCAACTCTGT
GCTAACTGACGTCGAATATGGTGTATGTATTCATCATTCATGCATGCATGCCAGTTACACGAGATGGCTTATGAT
TACGGACAGATGTCGAACGTGCACGCCTGGTTCGCCAATACGACAGCAGAGGGTGCAGCGCCTTGGGTTTTCCAG
TTCTTTGATGAGAACAATGTCCAGCCTGCTGCTCTATTACCGAACAAACCCAAGATGTACATTGCGGAGACCGGT
TGGCCTACGGTTTGTTATTTGGTCTCCAGCATATAGTGCTCCTTTCACTTACAAAACTCAATCTAGAAATCCTCG
GACGCAGGAAATGCCAACAACGGTGGTTCCGATGCCTCCGTACCTAATCTTCAGGTACAATCTATCTTTTCATCA
AATATGAGTATATGCACTGATAGGCGTCTCTGTGTTAGGTATTCATCGACAACTTCGTCTGTCAGGCCAATTCCA
ACAATGTCGGATATTTCTTCTTCGAATACTTTGATGAACAATGGAAGGATGCTATGTTTGGCGGAGTTGAAGGCT
GGTGGGGTCTTTTCAACGCGGAGTAAGTATGCAACATCACATCCGAGTTCATTTTCCTGACGTTGTTTTCCTTAG
TCGTACGTTGAAGGATATCACAATACCTGACTGCCCTGCTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail