© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|074170 |
| Gene name | |
| Location | scaffold_04:1974350..1975294 |
| Strand | - |
| Gene length (bp) | 944 |
| Transcript length (bp) | 735 |
| Coding sequence length (bp) | 735 |
| Protein length (aa) | 245 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00753 | Lactamase_B | Metallo-beta-lactamase superfamily | 3.3E-07 | 33 | 91 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A3PEI3|RNZ_PROM0 | Ribonuclease Z OS=Prochlorococcus marinus (strain MIT 9301) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-36 |
| sp|A8G6G0|RNZ_PROM2 | Ribonuclease Z OS=Prochlorococcus marinus (strain MIT 9215) GN=rnz PE=3 SV=1 | 16 | 222 | 2.0E-35 |
| sp|A2BSS2|RNZ_PROMS | Ribonuclease Z OS=Prochlorococcus marinus (strain AS9601) GN=rnz PE=3 SV=1 | 16 | 222 | 2.0E-35 |
| sp|Q29RY4|RNZ1_BOVIN | Zinc phosphodiesterase ELAC protein 1 OS=Bos taurus GN=ELAC1 PE=2 SV=1 | 16 | 222 | 3.0E-35 |
| sp|B0CE23|RNZ_ACAM1 | Ribonuclease Z OS=Acaryochloris marina (strain MBIC 11017) GN=rnz PE=3 SV=1 | 16 | 224 | 1.0E-34 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A3PEI3|RNZ_PROM0 | Ribonuclease Z OS=Prochlorococcus marinus (strain MIT 9301) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-36 |
| sp|A8G6G0|RNZ_PROM2 | Ribonuclease Z OS=Prochlorococcus marinus (strain MIT 9215) GN=rnz PE=3 SV=1 | 16 | 222 | 2.0E-35 |
| sp|A2BSS2|RNZ_PROMS | Ribonuclease Z OS=Prochlorococcus marinus (strain AS9601) GN=rnz PE=3 SV=1 | 16 | 222 | 2.0E-35 |
| sp|Q29RY4|RNZ1_BOVIN | Zinc phosphodiesterase ELAC protein 1 OS=Bos taurus GN=ELAC1 PE=2 SV=1 | 16 | 222 | 3.0E-35 |
| sp|B0CE23|RNZ_ACAM1 | Ribonuclease Z OS=Acaryochloris marina (strain MBIC 11017) GN=rnz PE=3 SV=1 | 16 | 224 | 1.0E-34 |
| sp|Q9H777|RNZ1_HUMAN | Zinc phosphodiesterase ELAC protein 1 OS=Homo sapiens GN=ELAC1 PE=1 SV=2 | 16 | 222 | 2.0E-34 |
| sp|Q319D8|RNZ_PROM9 | Ribonuclease Z OS=Prochlorococcus marinus (strain MIT 9312) GN=rnz PE=3 SV=1 | 16 | 222 | 1.0E-33 |
| sp|B2VHF1|RBN_ERWT9 | Ribonuclease BN OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rbn PE=3 SV=1 | 16 | 226 | 2.0E-33 |
| sp|B8HP81|RNZ_CYAP4 | Ribonuclease Z OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rnz PE=3 SV=1 | 16 | 224 | 8.0E-33 |
| sp|Q7V0B9|RNZ_PROMP | Ribonuclease Z OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rnz PE=3 SV=1 | 16 | 222 | 1.0E-32 |
| sp|A7Z6F0|RNZ_BACMF | Ribonuclease Z OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rnz PE=3 SV=1 | 16 | 218 | 2.0E-32 |
| sp|B0JGG3|RNZ_MICAN | Ribonuclease Z OS=Microcystis aeruginosa (strain NIES-843) GN=rnz PE=3 SV=1 | 16 | 219 | 3.0E-32 |
| sp|Q8VEB6|RNZ1_MOUSE | Zinc phosphodiesterase ELAC protein 1 OS=Mus musculus GN=Elac1 PE=2 SV=1 | 16 | 222 | 8.0E-32 |
| sp|B1WQW1|RNZ_CYAA5 | Ribonuclease Z OS=Cyanothece sp. (strain ATCC 51142) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-31 |
| sp|B7K1N1|RNZ_CYAP8 | Ribonuclease Z OS=Cyanothece sp. (strain PCC 8801) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-31 |
| sp|A2BY56|RNZ_PROM5 | Ribonuclease Z OS=Prochlorococcus marinus (strain MIT 9515) GN=rnz PE=3 SV=1 | 16 | 222 | 1.0E-31 |
| sp|B4EUI8|RBN_PROMH | Ribonuclease BN OS=Proteus mirabilis (strain HI4320) GN=rbn PE=3 SV=1 | 16 | 219 | 1.0E-31 |
| sp|B2J3C7|RNZ_NOSP7 | Ribonuclease Z OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rnz PE=3 SV=1 | 16 | 163 | 7.0E-31 |
| sp|Q55132|RNZ_SYNY3 | Ribonuclease Z OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rnz PE=3 SV=1 | 16 | 222 | 1.0E-30 |
| sp|Q0I7X5|RNZ_SYNS3 | Ribonuclease Z OS=Synechococcus sp. (strain CC9311) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-30 |
| sp|Q7U8S4|RNZ_SYNPX | Ribonuclease Z OS=Synechococcus sp. (strain WH8102) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-30 |
| sp|B7K762|RNZ_CYAP7 | Ribonuclease Z OS=Cyanothece sp. (strain PCC 7424) GN=rnz PE=3 SV=1 | 16 | 219 | 2.0E-30 |
| sp|Q3AZH7|RNZ_SYNS9 | Ribonuclease Z OS=Synechococcus sp. (strain CC9902) GN=rnz PE=3 SV=1 | 16 | 219 | 3.0E-30 |
| sp|B2GBD1|RNZ_LACF3 | Ribonuclease Z OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rnz PE=3 SV=1 | 16 | 218 | 4.0E-30 |
| sp|Q8YLZ0|RNZ_NOSS1 | Ribonuclease Z OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rnz PE=3 SV=1 | 16 | 219 | 5.0E-30 |
| sp|Q88VG6|RNZ_LACPL | Ribonuclease Z OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rnz PE=3 SV=1 | 16 | 218 | 5.0E-30 |
| sp|C5D428|RNZ_GEOSW | Ribonuclease Z OS=Geobacillus sp. (strain WCH70) GN=rnz PE=3 SV=1 | 16 | 218 | 6.0E-30 |
| sp|B7GHJ4|RNZ_ANOFW | Ribonuclease Z OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rnz PE=3 SV=1 | 16 | 218 | 8.0E-30 |
| sp|A5GN87|RNZ_SYNPW | Ribonuclease Z OS=Synechococcus sp. (strain WH7803) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-29 |
| sp|Q5KXG8|RNZ_GEOKA | Ribonuclease Z OS=Geobacillus kaustophilus (strain HTA426) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-29 |
| sp|Q03K89|RNZ_STRTD | Ribonuclease Z OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-29 |
| sp|Q5M3Y3|RNZ_STRT2 | Ribonuclease Z OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-29 |
| sp|Q5LZD1|RNZ_STRT1 | Ribonuclease Z OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-29 |
| sp|Q8DKE4|RNZ_THEEB | Ribonuclease Z OS=Thermosynechococcus elongatus (strain BP-1) GN=rnz PE=3 SV=1 | 16 | 218 | 2.0E-29 |
| sp|Q65HN6|RNZ_BACLD | Ribonuclease Z OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rnz PE=3 SV=1 | 16 | 221 | 2.0E-29 |
| sp|B2G6S0|RNZ_LACRJ | Ribonuclease Z OS=Lactobacillus reuteri (strain JCM 1112) GN=rnz PE=3 SV=1 | 16 | 218 | 2.0E-29 |
| sp|A5VJA0|RNZ_LACRD | Ribonuclease Z OS=Lactobacillus reuteri (strain DSM 20016) GN=rnz PE=3 SV=1 | 16 | 218 | 2.0E-29 |
| sp|P54548|RNZ_BACSU | Ribonuclease Z OS=Bacillus subtilis (strain 168) GN=rnz PE=1 SV=1 | 16 | 218 | 4.0E-29 |
| sp|Q3AHP8|RNZ_SYNSC | Ribonuclease Z OS=Synechococcus sp. (strain CC9605) GN=rnz PE=3 SV=1 | 16 | 219 | 5.0E-29 |
| sp|A4VVZ0|RNZ_STRSY | Ribonuclease Z OS=Streptococcus suis (strain 05ZYH33) GN=rnz PE=3 SV=1 | 16 | 221 | 6.0E-29 |
| sp|A4W299|RNZ_STRS2 | Ribonuclease Z OS=Streptococcus suis (strain 98HAH33) GN=rnz PE=3 SV=1 | 16 | 221 | 6.0E-29 |
| sp|A7MHT9|RBN_CROS8 | Ribonuclease BN OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rbn PE=3 SV=1 | 16 | 219 | 6.0E-29 |
| sp|Q7V5W1|RNZ_PROMM | Ribonuclease Z OS=Prochlorococcus marinus (strain MIT 9313) GN=rnz PE=3 SV=2 | 16 | 219 | 7.0E-29 |
| sp|A2C725|RNZ_PROM3 | Ribonuclease Z OS=Prochlorococcus marinus (strain MIT 9303) GN=rnz PE=3 SV=1 | 16 | 219 | 7.0E-29 |
| sp|Q46JB7|RNZ_PROMT | Ribonuclease Z OS=Prochlorococcus marinus (strain NATL2A) GN=rnz PE=3 SV=1 | 16 | 219 | 8.0E-29 |
| sp|Q118J2|RNZ_TRIEI | Ribonuclease Z OS=Trichodesmium erythraeum (strain IMS101) GN=rnz PE=3 SV=1 | 16 | 219 | 8.0E-29 |
| sp|A2C4C2|RNZ_PROM1 | Ribonuclease Z OS=Prochlorococcus marinus (strain NATL1A) GN=rnz PE=3 SV=1 | 16 | 219 | 8.0E-29 |
| sp|B7HB12|RNZ_BACC4 | Ribonuclease Z OS=Bacillus cereus (strain B4264) GN=rnz PE=3 SV=1 | 16 | 218 | 8.0E-29 |
| sp|Q818V3|RNZ_BACCR | Ribonuclease Z OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|A8AWX4|RNZ_STRGC | Ribonuclease Z OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-28 |
| sp|B7IWQ5|RNZ_BACC2 | Ribonuclease Z OS=Bacillus cereus (strain G9842) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|Q6HE20|RNZ_BACHK | Ribonuclease Z OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|C1ER14|RNZ_BACC3 | Ribonuclease Z OS=Bacillus cereus (strain 03BB102) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|A0RID9|RNZ_BACAH | Ribonuclease Z OS=Bacillus thuringiensis (strain Al Hakam) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|B9IXD7|RNZ_BACCQ | Ribonuclease Z OS=Bacillus cereus (strain Q1) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|B7HNQ7|RNZ_BACC7 | Ribonuclease Z OS=Bacillus cereus (strain AH187) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|Q731F6|RNZ_BACC1 | Ribonuclease Z OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|B7JLZ5|RNZ_BACC0 | Ribonuclease Z OS=Bacillus cereus (strain AH820) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|Q81M88|RNZ_BACAN | Ribonuclease Z OS=Bacillus anthracis GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|C3LJR8|RNZ_BACAC | Ribonuclease Z OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|C3P7S4|RNZ_BACAA | Ribonuclease Z OS=Bacillus anthracis (strain A0248) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|Q635E2|RNZ_BACCZ | Ribonuclease Z OS=Bacillus cereus (strain ZK / E33L) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-28 |
| sp|A3CNR9|RNZ_STRSV | Ribonuclease Z OS=Streptococcus sanguinis (strain SK36) GN=rnz PE=3 SV=1 | 16 | 219 | 3.0E-28 |
| sp|Q9CHT8|RNZ_LACLA | Ribonuclease Z OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnz PE=3 SV=1 | 16 | 219 | 5.0E-28 |
| sp|B8DBV5|RNZ_LISMH | Ribonuclease Z OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rnz PE=3 SV=1 | 16 | 224 | 6.0E-28 |
| sp|Q7VAN0|RNZ_PROMA | Ribonuclease Z OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rnz PE=3 SV=1 | 16 | 219 | 8.0E-28 |
| sp|A7GSG2|RNZ_BACCN | Ribonuclease Z OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rnz PE=3 SV=1 | 16 | 216 | 1.0E-27 |
| sp|Q03QP5|RNZ_LACBA | Ribonuclease Z OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-27 |
| sp|Q9KC61|RNZ_BACHD | Ribonuclease Z OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rnz PE=3 SV=1 | 16 | 152 | 1.0E-27 |
| sp|Q8Y5S8|RNZ_LISMO | Ribonuclease Z OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rnz PE=3 SV=1 | 16 | 222 | 1.0E-27 |
| sp|P0DF23|RNZ_STRPQ | Ribonuclease Z OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-27 |
| sp|Q1JM42|RNZ_STRPC | Ribonuclease Z OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-27 |
| sp|Q1JC59|RNZ_STRPB | Ribonuclease Z OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-27 |
| sp|P0DF22|RNZ_STRP3 | Ribonuclease Z OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-27 |
| sp|P60199|RNZ_STRP1 | Ribonuclease Z OS=Streptococcus pyogenes serotype M1 GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-27 |
| sp|A0AK82|RNZ_LISW6 | Ribonuclease Z OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rnz PE=3 SV=1 | 16 | 150 | 1.0E-27 |
| sp|Q04EZ9|RNZ_OENOB | Ribonuclease Z OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rnz PE=3 SV=1 | 16 | 218 | 2.0E-27 |
| sp|Q71Y44|RNZ_LISMF | Ribonuclease Z OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rnz PE=3 SV=1 | 16 | 222 | 2.0E-27 |
| sp|C1KWS1|RNZ_LISMC | Ribonuclease Z OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rnz PE=3 SV=1 | 16 | 222 | 2.0E-27 |
| sp|B5XL36|RNZ_STRPZ | Ribonuclease Z OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rnz PE=3 SV=1 | 16 | 221 | 3.0E-27 |
| sp|Q48TY8|RNZ_STRPM | Ribonuclease Z OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rnz PE=3 SV=1 | 16 | 221 | 3.0E-27 |
| sp|A2REY2|RNZ_STRPG | Ribonuclease Z OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rnz PE=3 SV=1 | 16 | 221 | 3.0E-27 |
| sp|Q1J705|RNZ_STRPF | Ribonuclease Z OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rnz PE=3 SV=1 | 16 | 221 | 3.0E-27 |
| sp|Q1JH87|RNZ_STRPD | Ribonuclease Z OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rnz PE=3 SV=1 | 16 | 221 | 3.0E-27 |
| sp|Q8P1A6|RNZ_STRP8 | Ribonuclease Z OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rnz PE=3 SV=1 | 16 | 221 | 3.0E-27 |
| sp|Q5XCH7|RNZ_STRP6 | Ribonuclease Z OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rnz PE=3 SV=1 | 16 | 221 | 3.0E-27 |
| sp|B9DUP5|RNZ_STRU0 | Ribonuclease Z OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rnz PE=3 SV=1 | 16 | 221 | 3.0E-27 |
| sp|B1XN66|RNZ_SYNP2 | Ribonuclease Z OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rnz PE=3 SV=1 | 16 | 219 | 4.0E-27 |
| sp|Q04B09|RNZ_LACDB | Ribonuclease Z OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rnz PE=3 SV=1 | 16 | 140 | 4.0E-27 |
| sp|Q1GAM2|RNZ_LACDA | Ribonuclease Z OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rnz PE=3 SV=1 | 16 | 140 | 4.0E-27 |
| sp|Q03W55|RNZ_LEUMM | Ribonuclease Z OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rnz PE=3 SV=1 | 16 | 218 | 5.0E-27 |
| sp|Q92A38|RNZ_LISIN | Ribonuclease Z OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rnz PE=3 SV=1 | 16 | 222 | 5.0E-27 |
| sp|B5E2R6|RNZ_STRP4 | Ribonuclease Z OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rnz PE=3 SV=1 | 16 | 222 | 8.0E-27 |
| sp|A9VG79|RNZ_BACWK | Ribonuclease Z OS=Bacillus weihenstephanensis (strain KBAB4) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-26 |
| sp|Q7NDW3|RNZ_GLOVI | Ribonuclease Z OS=Gloeobacter violaceus (strain PCC 7421) GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-26 |
| sp|B4U3M1|RNZ_STREM | Ribonuclease Z OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-26 |
| sp|Q834G2|RNZ_ENTFA | Ribonuclease Z OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-26 |
| sp|Q03F36|RNZ_PEDPA | Ribonuclease Z OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-26 |
| sp|Q8DZ99|RNZ_STRA5 | Ribonuclease Z OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rnz PE=3 SV=1 | 16 | 221 | 2.0E-26 |
| sp|C1CD41|RNZ_STRZJ | Ribonuclease Z OS=Streptococcus pneumoniae (strain JJA) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-26 |
| sp|Q8DQN1|RNZ_STRR6 | Ribonuclease Z OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-26 |
| sp|Q97RW2|RNZ_STRPN | Ribonuclease Z OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-26 |
| sp|B8ZMQ6|RNZ_STRPJ | Ribonuclease Z OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-26 |
| sp|Q04LL3|RNZ_STRP2 | Ribonuclease Z OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-26 |
| sp|C1CQF2|RNZ_STRZT | Ribonuclease Z OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-26 |
| sp|C1CJE0|RNZ_STRZP | Ribonuclease Z OS=Streptococcus pneumoniae (strain P1031) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-26 |
| sp|B2IMY3|RNZ_STRPS | Ribonuclease Z OS=Streptococcus pneumoniae (strain CGSP14) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-26 |
| sp|B1IAL2|RNZ_STRPI | Ribonuclease Z OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-26 |
| sp|C1C636|RNZ_STRP7 | Ribonuclease Z OS=Streptococcus pneumoniae (strain 70585) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-26 |
| sp|B1MZQ4|RNZ_LEUCK | Ribonuclease Z OS=Leuconostoc citreum (strain KM20) GN=rnz PE=3 SV=1 | 16 | 149 | 4.0E-26 |
| sp|C0MDJ9|RNZ_STRS7 | Ribonuclease Z OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rnz PE=3 SV=1 | 16 | 221 | 5.0E-26 |
| sp|C0MAM9|RNZ_STRE4 | Ribonuclease Z OS=Streptococcus equi subsp. equi (strain 4047) GN=rnz PE=3 SV=1 | 16 | 221 | 5.0E-26 |
| sp|Q031A3|RNZ_LACLS | Ribonuclease Z OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rnz PE=3 SV=1 | 16 | 219 | 5.0E-26 |
| sp|Q8E4W1|RNZ_STRA3 | Ribonuclease Z OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rnz PE=3 SV=1 | 16 | 221 | 7.0E-26 |
| sp|Q3K0P4|RNZ_STRA1 | Ribonuclease Z OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rnz PE=3 SV=1 | 16 | 221 | 7.0E-26 |
| sp|Q8EQ58|RNZ_OCEIH | Ribonuclease Z OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rnz PE=3 SV=1 | 16 | 149 | 9.0E-26 |
| sp|B7N5N4|RBN_ECOLU | Ribonuclease BN OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rbn PE=3 SV=1 | 16 | 221 | 1.0E-25 |
| sp|B7NNU8|RBN_ECO7I | Ribonuclease BN OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rbn PE=3 SV=1 | 16 | 221 | 2.0E-25 |
| sp|Q1WT50|RNZ_LACS1 | Ribonuclease Z OS=Lactobacillus salivarius (strain UCC118) GN=rnz PE=3 SV=1 | 16 | 218 | 2.0E-25 |
| sp|Q0TFH3|RBN_ECOL5 | Ribonuclease BN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rbn PE=3 SV=1 | 16 | 221 | 3.0E-25 |
| sp|O27859|RNZ_METTH | Ribonuclease Z OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rnz PE=3 SV=1 | 16 | 160 | 4.0E-25 |
| sp|B5XNW7|RBN_KLEP3 | Ribonuclease BN OS=Klebsiella pneumoniae (strain 342) GN=rbn PE=3 SV=1 | 16 | 224 | 4.0E-25 |
| sp|B7UFT1|RBN_ECO27 | Ribonuclease BN OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rbn PE=3 SV=1 | 16 | 221 | 5.0E-25 |
| sp|Q74JN5|RNZ_LACJO | Ribonuclease Z OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rnz PE=3 SV=1 | 16 | 218 | 5.0E-25 |
| sp|Q1R9E5|RBN_ECOUT | Ribonuclease BN OS=Escherichia coli (strain UTI89 / UPEC) GN=rbn PE=3 SV=1 | 16 | 221 | 6.0E-25 |
| sp|Q8FFK8|RBN_ECOL6 | Ribonuclease BN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rbn PE=3 SV=1 | 16 | 221 | 6.0E-25 |
| sp|A1ADC0|RBN_ECOK1 | Ribonuclease BN OS=Escherichia coli O1:K1 / APEC GN=rbn PE=3 SV=1 | 16 | 221 | 6.0E-25 |
| sp|B7MG36|RBN_ECO45 | Ribonuclease BN OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rbn PE=3 SV=1 | 16 | 221 | 6.0E-25 |
| sp|B7MXV1|RBN_ECO81 | Ribonuclease BN OS=Escherichia coli O81 (strain ED1a) GN=rbn PE=3 SV=1 | 16 | 221 | 6.0E-25 |
| sp|Q5FKH3|RNZ_LACAC | Ribonuclease Z OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rnz PE=3 SV=1 | 16 | 152 | 6.0E-25 |
| sp|Q38WT6|RNZ_LACSS | Ribonuclease Z OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rnz PE=3 SV=1 | 16 | 218 | 7.0E-25 |
| sp|A2RIV7|RNZ_LACLM | Ribonuclease Z OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rnz PE=3 SV=1 | 16 | 219 | 8.0E-25 |
| sp|B3WE54|RNZ_LACCB | Ribonuclease Z OS=Lactobacillus casei (strain BL23) GN=rnz PE=3 SV=1 | 16 | 140 | 8.0E-25 |
| sp|Q039J0|RNZ_LACC3 | Ribonuclease Z OS=Lactobacillus casei (strain ATCC 334) GN=rnz PE=3 SV=1 | 16 | 140 | 8.0E-25 |
| sp|A6TBW1|RBN_KLEP7 | Ribonuclease BN OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rbn PE=3 SV=1 | 16 | 224 | 9.0E-25 |
| sp|P0A8V1|RBN_SHIFL | Ribonuclease BN OS=Shigella flexneri GN=rbn PE=3 SV=1 | 16 | 221 | 1.0E-24 |
| sp|B6I7L2|RBN_ECOSE | Ribonuclease BN OS=Escherichia coli (strain SE11) GN=rbn PE=3 SV=1 | 16 | 221 | 1.0E-24 |
| sp|P0A8V0|RBN_ECOLI | Ribonuclease BN OS=Escherichia coli (strain K12) GN=rbn PE=1 SV=1 | 16 | 221 | 1.0E-24 |
| sp|B1IXR8|RBN_ECOLC | Ribonuclease BN OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rbn PE=3 SV=1 | 16 | 221 | 1.0E-24 |
| sp|A8A2D6|RBN_ECOHS | Ribonuclease BN OS=Escherichia coli O9:H4 (strain HS) GN=rbn PE=3 SV=1 | 16 | 221 | 1.0E-24 |
| sp|C4ZUB1|RBN_ECOBW | Ribonuclease BN OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rbn PE=3 SV=1 | 16 | 221 | 1.0E-24 |
| sp|B7M5V1|RBN_ECO8A | Ribonuclease BN OS=Escherichia coli O8 (strain IAI1) GN=rbn PE=3 SV=1 | 16 | 221 | 1.0E-24 |
| sp|B7LAT4|RBN_ECO55 | Ribonuclease BN OS=Escherichia coli (strain 55989 / EAEC) GN=rbn PE=3 SV=1 | 16 | 221 | 1.0E-24 |
| sp|A7ZP87|RBN_ECO24 | Ribonuclease BN OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rbn PE=3 SV=1 | 16 | 221 | 1.0E-24 |
| sp|B2TW54|RBN_SHIB3 | Ribonuclease BN OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rbn PE=3 SV=1 | 16 | 221 | 1.0E-24 |
| sp|Q5WGC3|RNZ_BACSK | Ribonuclease Z OS=Bacillus clausii (strain KSM-K16) GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-24 |
| sp|Q8XCZ0|RBN_ECO57 | Ribonuclease BN OS=Escherichia coli O157:H7 GN=rbn PE=3 SV=2 | 16 | 221 | 1.0E-24 |
| sp|B9DNT1|RNZ_STACT | Ribonuclease Z OS=Staphylococcus carnosus (strain TM300) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-24 |
| sp|A4WCQ3|RBN_ENT38 | Ribonuclease BN OS=Enterobacter sp. (strain 638) GN=rbn PE=3 SV=1 | 16 | 216 | 1.0E-24 |
| sp|A8YV16|RNZ_LACH4 | Ribonuclease Z OS=Lactobacillus helveticus (strain DPC 4571) GN=rnz PE=3 SV=1 | 16 | 152 | 2.0E-24 |
| sp|Q043V9|RNZ_LACGA | Ribonuclease Z OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rnz PE=3 SV=1 | 16 | 218 | 2.0E-24 |
| sp|A6UUY8|RNZ_META3 | Ribonuclease Z OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rnz PE=3 SV=1 | 16 | 211 | 3.0E-24 |
| sp|Q49XV1|RNZ_STAS1 | Ribonuclease Z OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rnz PE=3 SV=1 | 16 | 219 | 4.0E-24 |
| sp|A8ADW5|RBN_CITK8 | Ribonuclease BN OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rbn PE=3 SV=1 | 16 | 219 | 5.0E-24 |
| sp|Q5HP47|RNZ_STAEQ | Ribonuclease Z OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rnz PE=3 SV=1 | 16 | 141 | 7.0E-24 |
| sp|Q8CSG7|RNZ_STAES | Ribonuclease Z OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rnz PE=3 SV=1 | 16 | 141 | 7.0E-24 |
| sp|Q8DT90|RNZ_STRMU | Ribonuclease Z OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rnz PE=3 SV=1 | 16 | 222 | 7.0E-23 |
| sp|Q4L6K4|RNZ_STAHJ | Ribonuclease Z OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rnz PE=3 SV=1 | 16 | 219 | 2.0E-22 |
| sp|P60197|RNZ_STAAN | Ribonuclease Z OS=Staphylococcus aureus (strain N315) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|P60196|RNZ_STAAM | Ribonuclease Z OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|A5IT32|RNZ_STAA9 | Ribonuclease Z OS=Staphylococcus aureus (strain JH9) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|A6U1X3|RNZ_STAA2 | Ribonuclease Z OS=Staphylococcus aureus (strain JH1) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|A7X2M2|RNZ_STAA1 | Ribonuclease Z OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|Q6GGJ4|RNZ_STAAR | Ribonuclease Z OS=Staphylococcus aureus (strain MRSA252) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|Q2YYA2|RNZ_STAAB | Ribonuclease Z OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|Q8NWE6|RNZ_STAAW | Ribonuclease Z OS=Staphylococcus aureus (strain MW2) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|Q6G960|RNZ_STAAS | Ribonuclease Z OS=Staphylococcus aureus (strain MSSA476) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|A8Z2D7|RNZ_STAAT | Ribonuclease Z OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|A6QH51|RNZ_STAAE | Ribonuclease Z OS=Staphylococcus aureus (strain Newman) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|Q5HFR8|RNZ_STAAC | Ribonuclease Z OS=Staphylococcus aureus (strain COL) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|Q2FY67|RNZ_STAA8 | Ribonuclease Z OS=Staphylococcus aureus (strain NCTC 8325) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|Q2FGM9|RNZ_STAA3 | Ribonuclease Z OS=Staphylococcus aureus (strain USA300) GN=rnz PE=3 SV=1 | 16 | 141 | 3.0E-22 |
| sp|C0ZBP8|RNZ_BREBN | Ribonuclease Z OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rnz PE=3 SV=1 | 16 | 211 | 4.0E-22 |
| sp|A4FXT9|RNZ_METM5 | Ribonuclease Z OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rnz PE=3 SV=1 | 16 | 215 | 1.0E-21 |
| sp|Q6LYT2|RNZ_METMP | Ribonuclease Z OS=Methanococcus maripaludis (strain S2 / LL) GN=rnz PE=3 SV=1 | 16 | 215 | 1.0E-21 |
| sp|Q58897|RNZ_METJA | Ribonuclease Z OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rnz PE=1 SV=2 | 16 | 215 | 2.0E-21 |
| sp|A6VFJ7|RNZ_METM7 | Ribonuclease Z OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rnz PE=3 SV=1 | 16 | 215 | 2.0E-21 |
| sp|B5R2Z4|RBN_SALEP | Ribonuclease BN OS=Salmonella enteritidis PT4 (strain P125109) GN=rbn PE=3 SV=1 | 16 | 221 | 3.0E-21 |
| sp|B5RCD8|RBN_SALG2 | Ribonuclease BN OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rbn PE=3 SV=1 | 16 | 221 | 3.0E-21 |
| sp|P60195|RBN_SALTY | Ribonuclease BN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rbn PE=3 SV=1 | 16 | 221 | 4.0E-21 |
| sp|P60194|RBN_SALTI | Ribonuclease BN OS=Salmonella typhi GN=rbn PE=3 SV=1 | 16 | 221 | 4.0E-21 |
| sp|B5BCN2|RBN_SALPK | Ribonuclease BN OS=Salmonella paratyphi A (strain AKU_12601) GN=rbn PE=3 SV=1 | 16 | 221 | 4.0E-21 |
| sp|A9N598|RBN_SALPB | Ribonuclease BN OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rbn PE=3 SV=1 | 16 | 221 | 4.0E-21 |
| sp|Q5PN69|RBN_SALPA | Ribonuclease BN OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rbn PE=3 SV=1 | 16 | 221 | 4.0E-21 |
| sp|B4TBI0|RBN_SALHS | Ribonuclease BN OS=Salmonella heidelberg (strain SL476) GN=rbn PE=3 SV=1 | 16 | 221 | 4.0E-21 |
| sp|B5FPF2|RBN_SALDC | Ribonuclease BN OS=Salmonella dublin (strain CT_02021853) GN=rbn PE=3 SV=1 | 16 | 221 | 4.0E-21 |
| sp|Q57M43|RBN_SALCH | Ribonuclease BN OS=Salmonella choleraesuis (strain SC-B67) GN=rbn PE=3 SV=2 | 16 | 221 | 4.0E-21 |
| sp|B5EZJ2|RBN_SALA4 | Ribonuclease BN OS=Salmonella agona (strain SL483) GN=rbn PE=3 SV=1 | 16 | 221 | 4.0E-21 |
| sp|A9AB37|RNZ_METM6 | Ribonuclease Z OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rnz PE=3 SV=1 | 16 | 215 | 6.0E-21 |
| sp|C0Q055|RBN_SALPC | Ribonuclease BN OS=Salmonella paratyphi C (strain RKS4594) GN=rbn PE=3 SV=1 | 16 | 221 | 1.0E-20 |
| sp|B9E6P2|RNZ_MACCJ | Ribonuclease Z OS=Macrococcus caseolyticus (strain JCSC5402) GN=rnz PE=3 SV=1 | 16 | 141 | 1.0E-20 |
| sp|A6UN58|RNZ_METVS | Ribonuclease Z OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rnz PE=3 SV=1 | 16 | 153 | 1.0E-20 |
| sp|C4L3C2|RNZ_EXISA | Ribonuclease Z OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rnz PE=3 SV=1 | 16 | 224 | 9.0E-20 |
| sp|B1YLU8|RNZ_EXIS2 | Ribonuclease Z OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rnz PE=3 SV=1 | 16 | 154 | 1.0E-19 |
| sp|Q8TLK5|RNZ_METAC | Ribonuclease Z OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rnz PE=3 SV=1 | 16 | 224 | 7.0E-18 |
| sp|A1U2M9|RNZ_MARHV | Ribonuclease Z OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rnz PE=3 SV=1 | 16 | 211 | 2.0E-17 |
| sp|Q11TT4|RNZ_CYTH3 | Ribonuclease Z OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-16 |
| sp|Q8Q032|RNZ_METMA | Ribonuclease Z OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rnz PE=3 SV=1 | 16 | 224 | 2.0E-16 |
| sp|Q73LB4|RNZ_TREDE | Ribonuclease Z OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rnz PE=3 SV=1 | 16 | 221 | 2.0E-16 |
| sp|A1R0H8|RNZ_BORT9 | Ribonuclease Z OS=Borrelia turicatae (strain 91E135) GN=rnz PE=3 SV=1 | 16 | 222 | 3.0E-16 |
| sp|Q5UZJ9|RNZ_HALMA | Ribonuclease Z OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rnz PE=3 SV=1 | 16 | 219 | 7.0E-16 |
| sp|A9A3X2|RNZ_NITMS | Ribonuclease Z OS=Nitrosopumilus maritimus (strain SCM1) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-15 |
| sp|O58883|RNZ_PYRHO | Ribonuclease Z OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rnz PE=3 SV=1 | 16 | 211 | 2.0E-15 |
| sp|Q3IRM5|RNZ_NATPD | Ribonuclease Z OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rnz PE=3 SV=1 | 16 | 89 | 2.0E-15 |
| sp|Q64XI2|RNZ_BACFR | Ribonuclease Z OS=Bacteroides fragilis (strain YCH46) GN=rnz PE=3 SV=1 | 16 | 218 | 3.0E-15 |
| sp|Q5LGN7|RNZ_BACFN | Ribonuclease Z OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rnz PE=3 SV=1 | 16 | 218 | 3.0E-15 |
| sp|B5RMU7|RNZ_BORDL | Ribonuclease Z OS=Borrelia duttonii (strain Ly) GN=rnz PE=3 SV=1 | 16 | 219 | 4.0E-15 |
| sp|B5RQ92|RNZ_BORRA | Ribonuclease Z OS=Borrelia recurrentis (strain A1) GN=rnz PE=3 SV=1 | 16 | 222 | 5.0E-15 |
| sp|Q9HN60|RNZ_HALSA | Ribonuclease Z OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rnz PE=3 SV=1 | 16 | 89 | 5.0E-15 |
| sp|B0R7E2|RNZ_HALS3 | Ribonuclease Z OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rnz PE=3 SV=1 | 16 | 89 | 5.0E-15 |
| sp|Q89ZN1|RNZ_BACTN | Ribonuclease Z OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-14 |
| sp|B1J6H3|RNZ_PSEPW | Ribonuclease Z OS=Pseudomonas putida (strain W619) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-14 |
| sp|Q8U182|RNZ_PYRFU | Ribonuclease Z OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rnz PE=1 SV=1 | 16 | 219 | 2.0E-14 |
| sp|B0KMS1|RNZ_PSEPG | Ribonuclease Z OS=Pseudomonas putida (strain GB-1) GN=rnz PE=3 SV=1 | 16 | 221 | 2.0E-14 |
| sp|Q2S0L2|RNZ_SALRD | Ribonuclease Z OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rnz PE=3 SV=1 | 21 | 91 | 2.0E-14 |
| sp|Q1IA50|RNZ_PSEE4 | Ribonuclease Z OS=Pseudomonas entomophila (strain L48) GN=rnz PE=3 SV=1 | 16 | 92 | 3.0E-14 |
| sp|B2S197|RNZ_BORHD | Ribonuclease Z OS=Borrelia hermsii (strain HS1 / DAH) GN=rnz PE=3 SV=1 | 16 | 222 | 4.0E-14 |
| sp|Q88FQ4|RNZ_PSEPK | Ribonuclease Z OS=Pseudomonas putida (strain KT2440) GN=rnz PE=3 SV=1 | 16 | 219 | 4.0E-14 |
| sp|A5W1E8|RNZ_PSEP1 | Ribonuclease Z OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rnz PE=3 SV=1 | 16 | 219 | 7.0E-14 |
| sp|Q660C0|RNZ_BORBP | Ribonuclease Z OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-13 |
| sp|Q6KZJ4|RNZ_PICTO | Ribonuclease Z OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rnz PE=3 SV=1 | 16 | 140 | 1.0E-13 |
| sp|Q9UZP4|RNZ_PYRAB | Ribonuclease Z OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rnz PE=3 SV=1 | 16 | 219 | 2.0E-13 |
| sp|C5A5S2|RNZ_THEGJ | Ribonuclease Z OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rnz PE=3 SV=1 | 16 | 239 | 3.0E-13 |
| sp|A6LFA6|RNZ_PARD8 | Ribonuclease Z OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rnz PE=3 SV=1 | 13 | 211 | 3.0E-13 |
| sp|B6YT50|RNZ_THEON | Ribonuclease Z OS=Thermococcus onnurineus (strain NA1) GN=rnz PE=3 SV=1 | 16 | 222 | 4.0E-13 |
| sp|Q0SMA2|RNZ_BORAP | Ribonuclease Z OS=Borrelia afzelii (strain PKo) GN=rnz PE=3 SV=1 | 16 | 222 | 4.0E-13 |
| sp|B6YQ90|RNZ_AZOPC | Ribonuclease Z OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rnz PE=3 SV=1 | 16 | 214 | 4.0E-13 |
| sp|O29323|RNZ_ARCFU | Ribonuclease Z OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rnz PE=3 SV=1 | 16 | 146 | 1.0E-12 |
| sp|B7J0K1|RNZ_BORBZ | Ribonuclease Z OS=Borrelia burgdorferi (strain ZS7) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-12 |
| sp|O51696|RNZ_BORBU | Ribonuclease Z OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rnz PE=3 SV=1 | 16 | 219 | 1.0E-12 |
| sp|A6L3H3|RNZ_BACV8 | Ribonuclease Z OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rnz PE=3 SV=1 | 16 | 218 | 1.0E-12 |
| sp|Q1DEJ2|RNZ_MYXXD | Ribonuclease Z OS=Myxococcus xanthus (strain DK 1622) GN=rnz PE=3 SV=1 | 16 | 219 | 2.0E-12 |
| sp|Q0ST77|RNZ_CLOPS | Ribonuclease Z OS=Clostridium perfringens (strain SM101 / Type A) GN=rnz PE=3 SV=1 | 16 | 207 | 2.0E-12 |
| sp|Q5JE70|RNZ_THEKO | Ribonuclease Z OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rnz PE=3 SV=1 | 16 | 218 | 2.0E-12 |
| sp|A0RYQ9|RNZ_CENSY | Ribonuclease Z OS=Cenarchaeum symbiosum (strain A) GN=rnz PE=3 SV=1 | 16 | 129 | 2.0E-12 |
| sp|C6A2P3|RNZ_THESM | Ribonuclease Z OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rnz PE=3 SV=1 | 16 | 91 | 3.0E-12 |
| sp|Q9HJ19|RNZ_THEAC | Ribonuclease Z OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rnz PE=3 SV=2 | 16 | 149 | 4.0E-12 |
| sp|Q8XKN1|RNZ_CLOPE | Ribonuclease Z OS=Clostridium perfringens (strain 13 / Type A) GN=rnz PE=3 SV=1 | 16 | 210 | 4.0E-12 |
| sp|D4GZ88|RNZ_HALVD | Ribonuclease Z OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=rnz PE=1 SV=1 | 16 | 89 | 7.0E-12 |
| sp|Q89NF8|RNZ_BRADU | Ribonuclease Z OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rnz PE=3 SV=1 | 18 | 91 | 1.0E-11 |
| sp|A8MGK0|RNZ_ALKOO | Ribonuclease Z OS=Alkaliphilus oremlandii (strain OhILAs) GN=rnz PE=3 SV=1 | 16 | 226 | 2.0E-11 |
| sp|Q182M7|RNZ_PEPD6 | Ribonuclease Z OS=Peptoclostridium difficile (strain 630) GN=rnz PE=3 SV=1 | 16 | 207 | 2.0E-11 |
| sp|Q979A8|RNZ_THEVO | Ribonuclease Z OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rnz PE=3 SV=2 | 16 | 149 | 3.0E-11 |
| sp|C1AAD9|RNZ_GEMAT | Ribonuclease Z OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=rnz PE=3 SV=1 | 15 | 89 | 4.0E-11 |
| sp|Q0TQN4|RNZ_CLOP1 | Ribonuclease Z OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rnz PE=3 SV=1 | 16 | 210 | 5.0E-11 |
| sp|Q6ME16|RNZ_PARUW | Ribonuclease Z OS=Protochlamydia amoebophila (strain UWE25) GN=rnz PE=3 SV=1 | 18 | 89 | 5.0E-11 |
| sp|C3NDQ2|RNZ_SULIY | Ribonuclease Z OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rnz PE=3 SV=1 | 16 | 136 | 5.0E-11 |
| sp|C3NHZ9|RNZ_SULIN | Ribonuclease Z OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rnz PE=3 SV=1 | 16 | 136 | 5.0E-11 |
| sp|B9LQT0|RNZ_HALLT | Ribonuclease Z OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rnz PE=3 SV=1 | 16 | 89 | 5.0E-11 |
| sp|C3MYG0|RNZ_SULIM | Ribonuclease Z OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rnz PE=3 SV=1 | 16 | 136 | 5.0E-11 |
| sp|C3MPH2|RNZ_SULIL | Ribonuclease Z OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rnz PE=3 SV=1 | 16 | 136 | 5.0E-11 |
| sp|C4KGQ7|RNZ_SULIK | Ribonuclease Z OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rnz PE=3 SV=1 | 16 | 136 | 5.0E-11 |
| sp|C3N554|RNZ_SULIA | Ribonuclease Z OS=Sulfolobus islandicus (strain M.16.27) GN=rnz PE=3 SV=1 | 16 | 136 | 5.0E-11 |
| sp|A6WFU4|RNZ_KINRD | Ribonuclease Z OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rnz PE=3 SV=1 | 13 | 89 | 8.0E-11 |
| sp|B6IRV8|RNZ_RHOCS | Ribonuclease Z OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rnz PE=3 SV=1 | 16 | 91 | 1.0E-10 |
| sp|B2S457|RNZ_TREPS | Ribonuclease Z OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-10 |
| sp|O07896|RNZ_TREPA | Ribonuclease Z OS=Treponema pallidum (strain Nichols) GN=rnz PE=3 SV=1 | 16 | 221 | 1.0E-10 |
| sp|A8M3K2|RNZ_SALAI | Ribonuclease Z OS=Salinispora arenicola (strain CNS-205) GN=rnz PE=3 SV=1 | 17 | 85 | 1.0E-10 |
| sp|A0Q1D1|RNZ_CLONN | Ribonuclease Z OS=Clostridium novyi (strain NT) GN=rnz PE=3 SV=1 | 16 | 207 | 2.0E-10 |
| sp|A4YN80|RNZ_BRASO | Ribonuclease Z OS=Bradyrhizobium sp. (strain ORS278) GN=rnz PE=3 SV=1 | 16 | 92 | 2.0E-10 |
| sp|Q9PK48|RNZ_CHLMU | Ribonuclease Z OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rnz PE=3 SV=1 | 18 | 89 | 2.0E-10 |
| sp|O84350|RNZ_CHLTR | Ribonuclease Z OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rnz PE=3 SV=1 | 18 | 89 | 2.0E-10 |
| sp|Q3KM12|RNZ_CHLTA | Ribonuclease Z OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rnz PE=3 SV=1 | 18 | 89 | 2.0E-10 |
| sp|B0BBY0|RNZ_CHLTB | Ribonuclease Z OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rnz PE=3 SV=1 | 18 | 89 | 2.0E-10 |
| sp|B0B7R5|RNZ_CHLT2 | Ribonuclease Z OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rnz PE=3 SV=1 | 18 | 89 | 2.0E-10 |
| sp|Q97Z88|RNZ_SULSO | Ribonuclease Z OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rnz PE=3 SV=1 | 16 | 136 | 3.0E-10 |
| sp|Q51834|RNZ_PORGI | Ribonuclease Z OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rnz PE=3 SV=2 | 13 | 211 | 4.0E-10 |
| sp|B2RIU4|RNZ_PORG3 | Ribonuclease Z OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rnz PE=3 SV=1 | 13 | 211 | 4.0E-10 |
| sp|B1VY42|RNZ_STRGG | Ribonuclease Z OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rnz PE=3 SV=1 | 17 | 89 | 7.0E-10 |
| sp|Q9RDE4|RNZ_STRCO | Ribonuclease Z OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rnz PE=3 SV=1 | 17 | 89 | 1.0E-09 |
| sp|Q892B5|RNZ_CLOTE | Ribonuclease Z OS=Clostridium tetani (strain Massachusetts / E88) GN=rnz PE=3 SV=2 | 16 | 130 | 2.0E-09 |
| sp|Q82BX8|RNZ_STRAW | Ribonuclease Z OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rnz PE=3 SV=1 | 17 | 89 | 2.0E-09 |
| sp|Q9Z9F6|RNZ_CHLPN | Ribonuclease Z OS=Chlamydia pneumoniae GN=rnz PE=3 SV=1 | 17 | 89 | 2.0E-09 |
| sp|Q97IQ6|RNZ_CLOAB | Ribonuclease Z OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rnz PE=3 SV=2 | 16 | 207 | 6.0E-09 |
| sp|Q5YQ00|RNZ_NOCFA | Ribonuclease Z OS=Nocardia farcinica (strain IFM 10152) GN=rnz PE=3 SV=1 | 17 | 85 | 7.0E-09 |
| sp|Q5L6G2|RNZ_CHLAB | Ribonuclease Z OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rnz PE=3 SV=1 | 17 | 89 | 1.0E-08 |
| sp|A6LU82|RNZ_CLOB8 | Ribonuclease Z OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rnz PE=3 SV=1 | 16 | 210 | 2.0E-08 |
| sp|P51208|YCF56_PORPU | Uncharacterized protein ycf56 OS=Porphyra purpurea GN=ycf56 PE=3 SV=1 | 44 | 198 | 2.0E-08 |
| sp|Q8TWK0|RNZ_METKA | Ribonuclease Z OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rnz PE=3 SV=1 | 16 | 88 | 2.0E-08 |
| sp|Q253T0|RNZ_CHLFF | Ribonuclease Z OS=Chlamydophila felis (strain Fe/C-56) GN=rnz PE=3 SV=1 | 17 | 89 | 2.0E-08 |
| sp|A8ABB4|RNZ_IGNH4 | Ribonuclease Z OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rnz PE=3 SV=1 | 17 | 91 | 2.0E-08 |
| sp|Q823T8|RNZ_CHLCV | Ribonuclease Z OS=Chlamydophila caviae (strain GPIC) GN=rnz PE=3 SV=1 | 17 | 89 | 6.0E-08 |
| sp|Q47PQ7|RNZ_THEFY | Ribonuclease Z OS=Thermobifida fusca (strain YX) GN=rnz PE=3 SV=1 | 17 | 211 | 1.0E-07 |
| sp|Q74MH2|RNZ_NANEQ | Ribonuclease Z OS=Nanoarchaeum equitans (strain Kin4-M) GN=rnz PE=3 SV=1 | 21 | 149 | 3.0E-07 |
| sp|Q973F1|RNZ_SULTO | Ribonuclease Z OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rnz PE=3 SV=1 | 20 | 91 | 2.0E-06 |
| sp|C4ZFN9|RNZ_EUBR3 | Ribonuclease Z OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rnz PE=3 SV=1 | 16 | 95 | 2.0E-06 |
| sp|Q1B671|RNZ_MYCSS | Ribonuclease Z OS=Mycobacterium sp. (strain MCS) GN=rnz PE=3 SV=1 | 16 | 89 | 2.0E-06 |
| sp|A1UIW4|RNZ_MYCSK | Ribonuclease Z OS=Mycobacterium sp. (strain KMS) GN=rnz PE=3 SV=1 | 16 | 89 | 2.0E-06 |
| sp|A3Q2B8|RNZ_MYCSJ | Ribonuclease Z OS=Mycobacterium sp. (strain JLS) GN=rnz PE=3 SV=1 | 16 | 89 | 2.0E-06 |
| sp|B2V377|RNZ_CLOBA | Ribonuclease Z OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rnz PE=3 SV=1 | 16 | 210 | 2.0E-06 |
| sp|A4T2G4|RNZ_MYCGI | Ribonuclease Z OS=Mycobacterium gilvum (strain PYR-GCK) GN=rnz PE=3 SV=1 | 16 | 89 | 3.0E-06 |
| sp|A9KSU3|RNZ_CLOPH | Ribonuclease Z OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rnz PE=3 SV=1 | 16 | 95 | 3.0E-06 |
| sp|Q9YAV8|RNZ_AERPE | Ribonuclease Z OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rnz PE=3 SV=2 | 13 | 89 | 5.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 27 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|074170 MTTTIPKASVETIGPMQLTFLGTASAQPSSTRNHSSLALRLGGDVWLFDCGEATQHQIQKSSTVKMGRIRKIFIT HMHGDHIFGIAPLLASCLNGAGGTAEGYEDPRSQHSGMTPMVEIYGPLGIRAYVRTALSYTHTKLDGTYVVHELR SPSDPQRGDYTTVLQLPLEKEGTNFIQVNGIWNDIYKDARLSVSAAPILHSVPCVGYVLHEFPIPGKIDPKEYIP HIKRTKTSMARLEEKAAKS* |
| Coding | >Agabi119p4|074170 ATGACAACCACAATCCCGAAAGCATCGGTGGAAACCATTGGTCCAATGCAGCTCACCTTTCTGGGAACTGCATCT GCTCAGCCGTCATCGACAAGGAATCACTCTTCATTGGCATTACGACTCGGCGGCGACGTATGGCTATTCGATTGT GGTGAAGCTACACAACATCAAATTCAGAAATCGAGTACCGTCAAGATGGGCAGGATTAGAAAGATTTTCATTACA CATATGCACGGTGATCACATTTTCGGAATTGCACCTTTGCTAGCAAGTTGTCTCAACGGGGCTGGAGGCACAGCA GAGGGATATGAAGATCCACGATCTCAACATTCTGGTATGACACCTATGGTGGAGATCTACGGACCGCTCGGTATT CGGGCTTATGTCCGGACAGCATTGTCATACACACACACAAAATTAGACGGTACATACGTCGTTCATGAACTACGT TCCCCTTCGGATCCGCAACGCGGGGATTACACGACCGTCCTACAGTTGCCCTTAGAAAAAGAGGGAACTAACTTC ATTCAAGTCAATGGCATTTGGAACGACATATACAAAGATGCTCGTTTATCGGTTTCCGCAGCGCCGATCCTACAT TCCGTACCCTGTGTCGGTTACGTCTTGCATGAATTCCCGATTCCTGGAAAGATTGATCCCAAGGAATACATCCCA CATATCAAAAGAACCAAGACATCGATGGCCCGCCTAGAAGAGAAGGCCGCAAAGTCGTAA |
| Transcript | >Agabi119p4|074170 ATGACAACCACAATCCCGAAAGCATCGGTGGAAACCATTGGTCCAATGCAGCTCACCTTTCTGGGAACTGCATCT GCTCAGCCGTCATCGACAAGGAATCACTCTTCATTGGCATTACGACTCGGCGGCGACGTATGGCTATTCGATTGT GGTGAAGCTACACAACATCAAATTCAGAAATCGAGTACCGTCAAGATGGGCAGGATTAGAAAGATTTTCATTACA CATATGCACGGTGATCACATTTTCGGAATTGCACCTTTGCTAGCAAGTTGTCTCAACGGGGCTGGAGGCACAGCA GAGGGATATGAAGATCCACGATCTCAACATTCTGGTATGACACCTATGGTGGAGATCTACGGACCGCTCGGTATT CGGGCTTATGTCCGGACAGCATTGTCATACACACACACAAAATTAGACGGTACATACGTCGTTCATGAACTACGT TCCCCTTCGGATCCGCAACGCGGGGATTACACGACCGTCCTACAGTTGCCCTTAGAAAAAGAGGGAACTAACTTC ATTCAAGTCAATGGCATTTGGAACGACATATACAAAGATGCTCGTTTATCGGTTTCCGCAGCGCCGATCCTACAT TCCGTACCCTGTGTCGGTTACGTCTTGCATGAATTCCCGATTCCTGGAAAGATTGATCCCAAGGAATACATCCCA CATATCAAAAGAACCAAGACATCGATGGCCCGCCTAGAAGAGAAGGCCGCAAAGTCGTAA |
| Gene | >Agabi119p4|074170 ATGACAACCACAATCCCGAAAGCATCGGTGGAAACCATTGGTCCAATGCAGCTCACCTTTCTGGGAACTGCATCT GCTCAGCCGTCATCGACAAGGAATCACTCTTCATTGGCATTACGACTCGGCGGCGACGTATGGCTATTCGATTGT GGTGAAGCTACACAACATCAAATTCAGAAATCGAGTACCGTCAAGATGGGCAGGATTAGAAAGATTTTCATTACA CATATGCACGGTATGTACTGCAATGTCTGATTTAACACAGCGTTTCGTGTCCTATCTGCAACTCGGATTACTCAC GGAACTCTTTGACGATCCTAGGTGATCACATTTTCGGAATTGCACCTTTGCTAGCAAGTTGTCTCAACGGGGCTG GAGGCACAGCAGAGGGATATGAAGATCCACGATCTCAACATTCTGGTATGACACCTGTGAGCCACATACAACCCG ACAATAACACTCAAAGACATCTTTAATTTATCGACCCTAGATGGTGGAGATCTACGGACCGCTCGGTATTCGGGC TTATGTCCGGACAGCATTGTCATACACACACACAAAATTAGACGGTACATACGTCGTTCATGAACTACGTTCCCC TTCGGATCCGCAACGCGGGGATTACACGACCGTCCTACAGTTGCCCTTAGAAAAAGAGGGAACTAACTTCATTCA AGTCAATGGCATTTGGAACGACATATACAAAGATGCTCGTTTATCGGTTTCCGCAGCGCCGATCCTACATTCCGT ACCCTGTGTCGGTTACGTCTTGCATGAATTCCCGATTCCTGGAAAGATTGATCCCAAGGAATACATCCCACATAT CAAAAGAACCAAGACATCGATGTCGGTTATGCAACAGCTGCAACAAGGCTCATCCGTGGAATTAACAGACGGTAC TGTCTTACAGGGCCCGCCTAGAAGAGAAGGCCGCAAAGTCGTAA |