Protein ID | Agabi119p4|073870 |
Gene name | |
Location | scaffold_04:1916289..1919711 |
Strand | - |
Gene length (bp) | 3422 |
Transcript length (bp) | 2847 |
Coding sequence length (bp) | 2847 |
Protein length (aa) | 949 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00400 | WD40 | WD domain, G-beta repeat | 1.3E-05 | 55 | 87 |
PF00400 | WD40 | WD domain, G-beta repeat | 9.0E-06 | 92 | 129 |
PF00400 | WD40 | WD domain, G-beta repeat | 1.1E-02 | 188 | 224 |
PF00400 | WD40 | WD domain, G-beta repeat | 2.6E-04 | 396 | 427 |
PF00400 | WD40 | WD domain, G-beta repeat | 7.2E-03 | 474 | 508 |
PF00400 | WD40 | WD domain, G-beta repeat | 2.6E-04 | 574 | 606 |
PF00400 | WD40 | WD domain, G-beta repeat | 4.0E-06 | 656 | 690 |
PF12894 | ANAPC4_WD40 | Anaphase-promoting complex subunit 4 WD40 domain | 7.7E-06 | 42 | 110 |
PF04003 | Utp12 | Dip2/Utp12 Family | 1.7E-20 | 808 | 909 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P87177|YB1C_SCHPO | Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.12 PE=1 SV=1 | 1 | 941 | 0.0E+00 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 1 | 923 | 0.0E+00 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 1 | 923 | 0.0E+00 |
sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 1 | 924 | 0.0E+00 |
sp|Q12220|UTP12_YEAST | U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 | 1 | 936 | 0.0E+00 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P87177|YB1C_SCHPO | Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.12 PE=1 SV=1 | 1 | 941 | 0.0E+00 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 1 | 923 | 0.0E+00 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 1 | 923 | 0.0E+00 |
sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 1 | 924 | 0.0E+00 |
sp|Q12220|UTP12_YEAST | U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 | 1 | 936 | 0.0E+00 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 16 | 659 | 4.0E-52 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 37 | 659 | 1.0E-48 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 57 | 691 | 8.0E-46 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 88 | 691 | 3.0E-39 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 27 | 690 | 9.0E-39 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 97 | 691 | 2.0E-35 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 39 | 609 | 3.0E-35 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 57 | 564 | 2.0E-34 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 86 | 617 | 8.0E-34 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 39 | 516 | 1.0E-33 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 396 | 691 | 3.0E-33 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 73 | 691 | 5.0E-33 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 39 | 728 | 6.0E-31 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 396 | 691 | 3.0E-30 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 426 | 693 | 3.0E-28 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 5 | 540 | 2.0E-27 |
sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 399 | 693 | 2.0E-27 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 29 | 522 | 2.0E-26 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 379 | 690 | 4.0E-25 |
sp|Q05946|UTP13_YEAST | U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 | 71 | 723 | 6.0E-25 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 396 | 690 | 2.0E-24 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 396 | 690 | 2.0E-24 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 396 | 690 | 3.0E-24 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 402 | 706 | 3.0E-24 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 402 | 706 | 3.0E-24 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 138 | 698 | 7.0E-24 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 396 | 690 | 2.0E-23 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 443 | 691 | 4.0E-23 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 399 | 690 | 4.0E-23 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 396 | 693 | 4.0E-23 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 396 | 690 | 4.0E-23 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 56 | 288 | 5.0E-23 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 386 | 690 | 8.0E-23 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 450 | 691 | 1.0E-22 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 379 | 690 | 2.0E-22 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 402 | 706 | 2.0E-22 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 399 | 691 | 4.0E-22 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 442 | 691 | 4.0E-22 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 57 | 287 | 4.0E-22 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 450 | 691 | 5.0E-22 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 56 | 264 | 5.0E-22 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 57 | 289 | 6.0E-22 |
sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 370 | 691 | 8.0E-22 |
sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 370 | 691 | 8.0E-22 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 57 | 240 | 1.0E-21 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 104 | 710 | 3.0E-21 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 56 | 236 | 3.0E-21 |
sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 425 | 691 | 6.0E-21 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 57 | 508 | 6.0E-21 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 30 | 300 | 8.0E-21 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 41 | 285 | 8.0E-21 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 450 | 691 | 1.0E-20 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 463 | 691 | 2.0E-20 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 450 | 691 | 2.0E-20 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 398 | 609 | 2.0E-20 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 56 | 240 | 2.0E-20 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 57 | 701 | 2.0E-20 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 39 | 227 | 3.0E-20 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 57 | 508 | 4.0E-20 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 57 | 508 | 4.0E-20 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 23 | 294 | 5.0E-20 |
sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 57 | 228 | 6.0E-20 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 56 | 294 | 6.0E-20 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 56 | 289 | 7.0E-20 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 57 | 228 | 7.0E-20 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 57 | 508 | 9.0E-20 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 450 | 691 | 1.0E-19 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 396 | 691 | 1.0E-19 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 443 | 698 | 1.0E-19 |
sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 57 | 228 | 2.0E-19 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 56 | 276 | 2.0E-19 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 396 | 649 | 3.0E-19 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 39 | 279 | 3.0E-19 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 39 | 227 | 3.0E-19 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 41 | 189 | 4.0E-19 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 39 | 227 | 4.0E-19 |
sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 449 | 691 | 4.0E-19 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 60 | 228 | 5.0E-19 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 23 | 247 | 5.0E-19 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 56 | 294 | 5.0E-19 |
sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 449 | 691 | 5.0E-19 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 56 | 276 | 5.0E-19 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 39 | 246 | 6.0E-19 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 56 | 275 | 6.0E-19 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 56 | 275 | 7.0E-19 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 56 | 276 | 7.0E-19 |
sp|Q05946|UTP13_YEAST | U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 | 19 | 648 | 8.0E-19 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 56 | 275 | 9.0E-19 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 56 | 275 | 9.0E-19 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 56 | 275 | 9.0E-19 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 56 | 275 | 9.0E-19 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 56 | 275 | 9.0E-19 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 56 | 275 | 9.0E-19 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 56 | 275 | 9.0E-19 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 23 | 247 | 1.0E-18 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 56 | 289 | 1.0E-18 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 56 | 275 | 1.0E-18 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 57 | 246 | 1.0E-18 |
sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 455 | 691 | 1.0E-18 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 23 | 294 | 2.0E-18 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 30 | 288 | 2.0E-18 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 39 | 227 | 2.0E-18 |
sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 460 | 691 | 2.0E-18 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 444 | 698 | 2.0E-18 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 56 | 275 | 2.0E-18 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 455 | 691 | 2.0E-18 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 57 | 426 | 2.0E-18 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 396 | 691 | 2.0E-18 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 41 | 189 | 2.0E-18 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 396 | 651 | 2.0E-18 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 396 | 651 | 2.0E-18 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 396 | 651 | 2.0E-18 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 396 | 651 | 3.0E-18 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 56 | 275 | 3.0E-18 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 38 | 225 | 4.0E-18 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 30 | 288 | 4.0E-18 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 455 | 691 | 4.0E-18 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 23 | 294 | 5.0E-18 |
sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 455 | 691 | 5.0E-18 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 56 | 289 | 5.0E-18 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 56 | 276 | 5.0E-18 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 41 | 228 | 6.0E-18 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 57 | 246 | 8.0E-18 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 57 | 246 | 8.0E-18 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 57 | 246 | 8.0E-18 |
sp|A7RWD2|CIAO1_NEMVE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 | 477 | 691 | 8.0E-18 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 57 | 246 | 8.0E-18 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 396 | 649 | 1.0E-17 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 382 | 691 | 1.0E-17 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 57 | 246 | 1.0E-17 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 396 | 651 | 1.0E-17 |
sp|Q9SZQ5|VIP3_ARATH | WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 | 414 | 691 | 1.0E-17 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 56 | 240 | 1.0E-17 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 56 | 240 | 1.0E-17 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 39 | 227 | 1.0E-17 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 56 | 240 | 1.0E-17 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 56 | 240 | 1.0E-17 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 56 | 240 | 1.0E-17 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 39 | 225 | 2.0E-17 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 41 | 294 | 2.0E-17 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 51 | 225 | 2.0E-17 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 58 | 288 | 2.0E-17 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 57 | 285 | 2.0E-17 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 56 | 287 | 2.0E-17 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 56 | 240 | 2.0E-17 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 56 | 240 | 2.0E-17 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 396 | 651 | 2.0E-17 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 56 | 226 | 2.0E-17 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 58 | 288 | 2.0E-17 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 30 | 288 | 3.0E-17 |
sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 444 | 691 | 3.0E-17 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 452 | 698 | 3.0E-17 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 39 | 227 | 3.0E-17 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 56 | 240 | 3.0E-17 |
sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 41 | 241 | 3.0E-17 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 57 | 294 | 3.0E-17 |
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 396 | 691 | 3.0E-17 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 454 | 694 | 3.0E-17 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 56 | 240 | 3.0E-17 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 520 | 691 | 4.0E-17 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 100 | 698 | 4.0E-17 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 56 | 237 | 4.0E-17 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 398 | 691 | 4.0E-17 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 56 | 240 | 4.0E-17 |
sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 398 | 714 | 4.0E-17 |
sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 56 | 707 | 4.0E-17 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 392 | 648 | 4.0E-17 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 39 | 225 | 5.0E-17 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 447 | 691 | 5.0E-17 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 444 | 698 | 5.0E-17 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 39 | 290 | 5.0E-17 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 382 | 691 | 6.0E-17 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 382 | 691 | 7.0E-17 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 382 | 691 | 7.0E-17 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 382 | 691 | 7.0E-17 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 56 | 273 | 7.0E-17 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 382 | 691 | 8.0E-17 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 57 | 246 | 8.0E-17 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 382 | 691 | 9.0E-17 |
sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 57 | 293 | 9.0E-17 |
sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 57 | 293 | 9.0E-17 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 382 | 691 | 1.0E-16 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 382 | 691 | 1.0E-16 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 540 | 691 | 1.0E-16 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 382 | 691 | 1.0E-16 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 447 | 691 | 1.0E-16 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 447 | 691 | 1.0E-16 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 447 | 691 | 1.0E-16 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 447 | 691 | 1.0E-16 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 396 | 648 | 1.0E-16 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 443 | 691 | 1.0E-16 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 57 | 246 | 1.0E-16 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 56 | 240 | 1.0E-16 |
sp|Q99KN2|CIAO1_MOUSE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 | 473 | 692 | 1.0E-16 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 97 | 289 | 1.0E-16 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 39 | 225 | 2.0E-16 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 382 | 691 | 2.0E-16 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 392 | 648 | 2.0E-16 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 396 | 691 | 2.0E-16 |
sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 399 | 688 | 2.0E-16 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 56 | 295 | 2.0E-16 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 398 | 651 | 2.0E-16 |
sp|Q5M7T1|CIAO1_RAT | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 | 473 | 692 | 2.0E-16 |
sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 407 | 696 | 2.0E-16 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 398 | 691 | 2.0E-16 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 449 | 694 | 2.0E-16 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 447 | 691 | 2.0E-16 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 382 | 691 | 3.0E-16 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 447 | 691 | 3.0E-16 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 57 | 246 | 3.0E-16 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 57 | 226 | 3.0E-16 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 41 | 208 | 4.0E-16 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 396 | 691 | 4.0E-16 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 407 | 696 | 4.0E-16 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 454 | 690 | 5.0E-16 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 30 | 288 | 5.0E-16 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 56 | 321 | 5.0E-16 |
sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 407 | 696 | 5.0E-16 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 57 | 285 | 5.0E-16 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 382 | 691 | 6.0E-16 |
sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 39 | 289 | 6.0E-16 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 396 | 690 | 6.0E-16 |
sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 407 | 696 | 6.0E-16 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 454 | 690 | 7.0E-16 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 447 | 698 | 7.0E-16 |
sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 58 | 288 | 7.0E-16 |
sp|Q9UTN4|PFS2_SCHPO | Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 | 447 | 706 | 7.0E-16 |
sp|B3MC74|CIAO1_DROAN | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 | 473 | 691 | 8.0E-16 |
sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 58 | 288 | 8.0E-16 |
sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 58 | 224 | 9.0E-16 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 57 | 288 | 1.0E-15 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 382 | 691 | 1.0E-15 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 396 | 691 | 1.0E-15 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 537 | 691 | 1.0E-15 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 537 | 691 | 1.0E-15 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 537 | 691 | 1.0E-15 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 382 | 691 | 1.0E-15 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 447 | 691 | 1.0E-15 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 454 | 690 | 1.0E-15 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 447 | 691 | 1.0E-15 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 57 | 246 | 1.0E-15 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 472 | 697 | 1.0E-15 |
sp|O76071|CIAO1_HUMAN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 | 470 | 692 | 1.0E-15 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 449 | 694 | 1.0E-15 |
sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 58 | 226 | 1.0E-15 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 447 | 694 | 1.0E-15 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 57 | 303 | 1.0E-15 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 57 | 228 | 1.0E-15 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 396 | 649 | 2.0E-15 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 284 | 691 | 2.0E-15 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 396 | 691 | 2.0E-15 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 142 | 692 | 2.0E-15 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 454 | 690 | 2.0E-15 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 537 | 691 | 2.0E-15 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 447 | 691 | 2.0E-15 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 537 | 691 | 2.0E-15 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 57 | 224 | 2.0E-15 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 58 | 356 | 2.0E-15 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 58 | 356 | 2.0E-15 |
sp|B4GDM7|CIAO1_DROPE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 | 473 | 690 | 2.0E-15 |
sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 361 | 607 | 2.0E-15 |
sp|Q292E8|CIAO1_DROPS | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 | 473 | 690 | 2.0E-15 |
sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 444 | 691 | 2.0E-15 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 19 | 225 | 3.0E-15 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 57 | 294 | 3.0E-15 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 392 | 649 | 3.0E-15 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 30 | 287 | 3.0E-15 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 429 | 691 | 3.0E-15 |
sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 444 | 742 | 3.0E-15 |
sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 406 | 690 | 3.0E-15 |
sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 56 | 288 | 3.0E-15 |
sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 58 | 288 | 3.0E-15 |
sp|Q20168|COPB2_CAEEL | Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 | 414 | 696 | 3.0E-15 |
sp|Q32PJ6|CIAO1_BOVIN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 | 470 | 692 | 3.0E-15 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 39 | 293 | 3.0E-15 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 58 | 288 | 3.0E-15 |
sp|B3NQR5|CIAO1_DROER | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 | 473 | 691 | 3.0E-15 |
sp|B0XAF3|CIAO1_CULQU | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 | 472 | 692 | 3.0E-15 |
sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 58 | 288 | 3.0E-15 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 30 | 288 | 4.0E-15 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 447 | 691 | 4.0E-15 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 454 | 690 | 4.0E-15 |
sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 396 | 691 | 4.0E-15 |
sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 39 | 216 | 4.0E-15 |
sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 39 | 216 | 4.0E-15 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 40 | 224 | 5.0E-15 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 41 | 227 | 5.0E-15 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 41 | 285 | 5.0E-15 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 30 | 224 | 5.0E-15 |
sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 407 | 696 | 5.0E-15 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 57 | 183 | 5.0E-15 |
sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 100 | 698 | 5.0E-15 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 39 | 193 | 6.0E-15 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 423 | 690 | 6.0E-15 |
sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 407 | 696 | 6.0E-15 |
sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 57 | 228 | 6.0E-15 |
sp|O80990|CIA1_ARATH | Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 | 474 | 690 | 6.0E-15 |
sp|Q05946|UTP13_YEAST | U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 | 57 | 225 | 7.0E-15 |
sp|B4KTK4|CIAO1_DROMO | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 | 473 | 690 | 7.0E-15 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 57 | 510 | 7.0E-15 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 398 | 651 | 8.0E-15 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 398 | 691 | 8.0E-15 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 398 | 651 | 8.0E-15 |
sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 41 | 224 | 8.0E-15 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 41 | 295 | 8.0E-15 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 473 | 691 | 8.0E-15 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 57 | 183 | 8.0E-15 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 398 | 691 | 8.0E-15 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 473 | 691 | 8.0E-15 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 39 | 225 | 1.0E-14 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 41 | 224 | 1.0E-14 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 9 | 230 | 1.0E-14 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 382 | 691 | 1.0E-14 |
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 41 | 295 | 1.0E-14 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 16 | 511 | 1.0E-14 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 537 | 691 | 1.0E-14 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 395 | 716 | 1.0E-14 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 41 | 295 | 1.0E-14 |
sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 16 | 511 | 1.0E-14 |
sp|B4JW81|CIAO1_DROGR | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 | 473 | 690 | 1.0E-14 |
sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 58 | 226 | 1.0E-14 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 39 | 216 | 1.0E-14 |
sp|B4LJT7|CIAO1_DROVI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 | 473 | 690 | 1.0E-14 |
sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 56 | 224 | 1.0E-14 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 58 | 288 | 1.0E-14 |
sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 58 | 226 | 1.0E-14 |
sp|B4QFZ8|CIAO1_DROSI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 | 473 | 691 | 1.0E-14 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 39 | 216 | 1.0E-14 |
sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 39 | 221 | 1.0E-14 |
sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 39 | 221 | 1.0E-14 |
sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 39 | 216 | 1.0E-14 |
sp|A8IZG4|CIAO1_CHLRE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 | 474 | 696 | 1.0E-14 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 39 | 225 | 2.0E-14 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 540 | 691 | 2.0E-14 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 520 | 691 | 2.0E-14 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 56 | 224 | 2.0E-14 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 30 | 288 | 2.0E-14 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 396 | 690 | 2.0E-14 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 392 | 649 | 2.0E-14 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 30 | 224 | 2.0E-14 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 30 | 224 | 2.0E-14 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 30 | 224 | 2.0E-14 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 39 | 287 | 2.0E-14 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 537 | 691 | 2.0E-14 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 378 | 690 | 2.0E-14 |
sp|Q7K1Y4|CIAO1_DROME | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 | 473 | 690 | 2.0E-14 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 473 | 691 | 2.0E-14 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 57 | 303 | 2.0E-14 |
sp|B4MY77|CIAO1_DROWI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 | 473 | 690 | 2.0E-14 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 39 | 216 | 2.0E-14 |
sp|B4P7Q3|CIAO1_DROYA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 | 473 | 690 | 2.0E-14 |
sp|P38011|GBLP_YEAST | Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 | 80 | 305 | 2.0E-14 |
sp|B4HRQ6|CIAO1_DROSE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 | 473 | 690 | 2.0E-14 |
sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 39 | 224 | 3.0E-14 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 398 | 652 | 3.0E-14 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 30 | 224 | 3.0E-14 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 30 | 224 | 3.0E-14 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 30 | 224 | 3.0E-14 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 30 | 224 | 3.0E-14 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 30 | 224 | 3.0E-14 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 540 | 691 | 3.0E-14 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 41 | 231 | 3.0E-14 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 58 | 215 | 3.0E-14 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 41 | 224 | 3.0E-14 |
sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 39 | 216 | 3.0E-14 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 41 | 224 | 3.0E-14 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 39 | 216 | 3.0E-14 |
sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 57 | 226 | 3.0E-14 |
sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 39 | 216 | 3.0E-14 |
sp|Q7PS24|CIAO1_ANOGA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 | 473 | 692 | 3.0E-14 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 414 | 696 | 3.0E-14 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 58 | 230 | 4.0E-14 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 396 | 691 | 4.0E-14 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 30 | 224 | 4.0E-14 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 30 | 224 | 4.0E-14 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 58 | 288 | 4.0E-14 |
sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 57 | 228 | 4.0E-14 |
sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 57 | 228 | 4.0E-14 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 58 | 228 | 4.0E-14 |
sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 58 | 288 | 4.0E-14 |
sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 58 | 288 | 4.0E-14 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 405 | 690 | 4.0E-14 |
sp|B6K1G6|CFD1_SCHJY | Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 | 465 | 693 | 4.0E-14 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 58 | 230 | 5.0E-14 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 447 | 691 | 5.0E-14 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 398 | 652 | 5.0E-14 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 30 | 224 | 5.0E-14 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 457 | 691 | 5.0E-14 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 398 | 710 | 5.0E-14 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 540 | 691 | 5.0E-14 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 444 | 694 | 5.0E-14 |
sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 444 | 748 | 5.0E-14 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 403 | 660 | 5.0E-14 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 57 | 272 | 5.0E-14 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 57 | 299 | 5.0E-14 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 414 | 696 | 5.0E-14 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 414 | 696 | 5.0E-14 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 39 | 239 | 5.0E-14 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 414 | 696 | 5.0E-14 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 414 | 696 | 5.0E-14 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 473 | 691 | 6.0E-14 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 58 | 253 | 7.0E-14 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 57 | 211 | 7.0E-14 |
sp|P87314|HIR1_SCHPO | Protein hir1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hip1 PE=1 SV=1 | 478 | 694 | 7.0E-14 |
sp|Q6C553|HIR1_YARLI | Protein HIR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HIR1 PE=3 SV=2 | 465 | 690 | 7.0E-14 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 57 | 184 | 7.0E-14 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 440 | 691 | 7.0E-14 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 542 | 690 | 8.0E-14 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 398 | 673 | 8.0E-14 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 396 | 690 | 8.0E-14 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 41 | 224 | 8.0E-14 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 479 | 691 | 8.0E-14 |
sp|Q4IBR4|HIR1_GIBZE | Protein HIR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HIR1 PE=3 SV=1 | 484 | 690 | 8.0E-14 |
sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 71 | 238 | 8.0E-14 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 30 | 224 | 9.0E-14 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 30 | 288 | 9.0E-14 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 457 | 691 | 9.0E-14 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 542 | 716 | 9.0E-14 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 57 | 224 | 9.0E-14 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 57 | 224 | 9.0E-14 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 41 | 224 | 9.0E-14 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 41 | 224 | 9.0E-14 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 57 | 508 | 9.0E-14 |
sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 39 | 225 | 1.0E-13 |
sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 39 | 225 | 1.0E-13 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 30 | 224 | 1.0E-13 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 398 | 692 | 1.0E-13 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 398 | 692 | 1.0E-13 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 398 | 692 | 1.0E-13 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 540 | 690 | 1.0E-13 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 398 | 692 | 1.0E-13 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 27 | 285 | 1.0E-13 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 398 | 652 | 1.0E-13 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 447 | 691 | 1.0E-13 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 29 | 287 | 1.0E-13 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 408 | 690 | 1.0E-13 |
sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 71 | 238 | 1.0E-13 |
sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 58 | 288 | 1.0E-13 |
sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 58 | 288 | 1.0E-13 |
sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 391 | 690 | 1.0E-13 |
sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 391 | 690 | 1.0E-13 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 349 | 690 | 1.0E-13 |
sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 475 | 699 | 1.0E-13 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 54 | 294 | 2.0E-13 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 57 | 289 | 2.0E-13 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 396 | 648 | 2.0E-13 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 454 | 690 | 2.0E-13 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 37 | 232 | 2.0E-13 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 470 | 691 | 2.0E-13 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 392 | 649 | 2.0E-13 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 392 | 649 | 2.0E-13 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 392 | 649 | 2.0E-13 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 392 | 649 | 2.0E-13 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 392 | 649 | 2.0E-13 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 30 | 224 | 2.0E-13 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 392 | 649 | 2.0E-13 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 392 | 649 | 2.0E-13 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 537 | 691 | 2.0E-13 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 396 | 691 | 2.0E-13 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 392 | 649 | 2.0E-13 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 447 | 691 | 2.0E-13 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 396 | 631 | 2.0E-13 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 381 | 711 | 2.0E-13 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 403 | 660 | 2.0E-13 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 447 | 690 | 2.0E-13 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 57 | 235 | 2.0E-13 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 447 | 690 | 2.0E-13 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 447 | 690 | 2.0E-13 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 475 | 691 | 2.0E-13 |
sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 41 | 241 | 2.0E-13 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 58 | 226 | 2.0E-13 |
sp|O35142|COPB2_RAT | Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 | 414 | 696 | 2.0E-13 |
sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 58 | 226 | 2.0E-13 |
sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 27 | 226 | 3.0E-13 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 72 | 226 | 3.0E-13 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 396 | 691 | 3.0E-13 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 396 | 691 | 3.0E-13 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 396 | 691 | 3.0E-13 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 30 | 224 | 3.0E-13 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 476 | 691 | 3.0E-13 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 39 | 287 | 3.0E-13 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 41 | 236 | 3.0E-13 |
sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 71 | 238 | 3.0E-13 |
sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 58 | 288 | 3.0E-13 |
sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 71 | 238 | 3.0E-13 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 58 | 226 | 3.0E-13 |
sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 391 | 690 | 3.0E-13 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 42 | 244 | 4.0E-13 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 396 | 691 | 4.0E-13 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 396 | 691 | 4.0E-13 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 56 | 227 | 4.0E-13 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 457 | 691 | 4.0E-13 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 54 | 294 | 4.0E-13 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 381 | 711 | 4.0E-13 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 56 | 226 | 4.0E-13 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 383 | 695 | 4.0E-13 |
sp|Q54D08|LST8_DICDI | Protein LST8 homolog OS=Dictyostelium discoideum GN=lst8 PE=1 SV=1 | 452 | 672 | 4.0E-13 |
sp|Q17GR9|CIAO1_AEDAE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 | 473 | 692 | 4.0E-13 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 58 | 228 | 5.0E-13 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 41 | 241 | 5.0E-13 |
sp|Q6FT96|MDV1_CANGA | Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 | 14 | 272 | 5.0E-13 |
sp|P27612|PLAP_MOUSE | Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 | 393 | 759 | 5.0E-13 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 58 | 228 | 6.0E-13 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 58 | 466 | 6.0E-13 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 37 | 226 | 6.0E-13 |
sp|Q9Y6I7|WSB1_HUMAN | WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 | 544 | 700 | 6.0E-13 |
sp|Q6P0D9|CIAO1_DANRE | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 | 477 | 692 | 6.0E-13 |
sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 73 | 238 | 6.0E-13 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 41 | 313 | 6.0E-13 |
sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 58 | 226 | 6.0E-13 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 52 | 224 | 6.0E-13 |
sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 73 | 238 | 6.0E-13 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 39 | 287 | 7.0E-13 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 474 | 691 | 7.0E-13 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 470 | 691 | 7.0E-13 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 398 | 692 | 7.0E-13 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 392 | 649 | 7.0E-13 |
sp|Q54D08|LST8_DICDI | Protein LST8 homolog OS=Dictyostelium discoideum GN=lst8 PE=1 SV=1 | 414 | 691 | 7.0E-13 |
sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 73 | 238 | 7.0E-13 |
sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 440 | 691 | 7.0E-13 |
sp|Q7RZI0|HIR1_NEUCR | Protein hir-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hir-1 PE=3 SV=2 | 484 | 690 | 7.0E-13 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 457 | 691 | 8.0E-13 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 457 | 691 | 8.0E-13 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 446 | 691 | 8.0E-13 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 396 | 690 | 8.0E-13 |
sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 440 | 691 | 8.0E-13 |
sp|O43818|U3IP2_HUMAN | U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1 | 57 | 230 | 8.0E-13 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 398 | 609 | 9.0E-13 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 57 | 224 | 9.0E-13 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 392 | 649 | 9.0E-13 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 476 | 691 | 9.0E-13 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 396 | 632 | 9.0E-13 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 37 | 226 | 9.0E-13 |
sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 74 | 231 | 9.0E-13 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 74 | 304 | 9.0E-13 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 58 | 226 | 9.0E-13 |
sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 58 | 226 | 9.0E-13 |
sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 440 | 691 | 9.0E-13 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 476 | 691 | 1.0E-12 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 30 | 224 | 1.0E-12 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 395 | 644 | 1.0E-12 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 30 | 224 | 1.0E-12 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 30 | 224 | 1.0E-12 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 30 | 224 | 1.0E-12 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 30 | 224 | 1.0E-12 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 30 | 224 | 1.0E-12 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 30 | 224 | 1.0E-12 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 30 | 224 | 1.0E-12 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 30 | 224 | 1.0E-12 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 568 | 691 | 1.0E-12 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 457 | 691 | 1.0E-12 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 457 | 691 | 1.0E-12 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 457 | 691 | 1.0E-12 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 457 | 691 | 1.0E-12 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 457 | 691 | 1.0E-12 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 447 | 691 | 1.0E-12 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 39 | 287 | 1.0E-12 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 392 | 649 | 1.0E-12 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 39 | 287 | 1.0E-12 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 41 | 236 | 1.0E-12 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 447 | 691 | 1.0E-12 |
sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 474 | 700 | 1.0E-12 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 57 | 293 | 1.0E-12 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 57 | 293 | 1.0E-12 |
sp|Q8RXA7|SCD1_ARATH | DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 | 39 | 285 | 1.0E-12 |
sp|Q59WJ4|PFS2_CANAL | Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1 | 528 | 691 | 1.0E-12 |
sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 58 | 226 | 1.0E-12 |
sp|O54927|WSB1_MOUSE | WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 | 544 | 700 | 1.0E-12 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 57 | 293 | 1.0E-12 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 14 | 228 | 1.0E-12 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 41 | 185 | 1.0E-12 |
sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 476 | 699 | 1.0E-12 |
sp|A0AUS0|WSDU1_DANRE | WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 | 396 | 611 | 1.0E-12 |
sp|Q6P1V3|WSB1_XENTR | WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 | 551 | 691 | 1.0E-12 |
sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 475 | 699 | 1.0E-12 |
sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 475 | 699 | 1.0E-12 |
sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 475 | 699 | 1.0E-12 |
sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 475 | 699 | 1.0E-12 |
sp|Q09150|REC14_SCHPO | Meiotic recombination protein rec14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rec14 PE=3 SV=1 | 480 | 690 | 1.0E-12 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 39 | 224 | 2.0E-12 |
sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 444 | 690 | 2.0E-12 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 447 | 691 | 2.0E-12 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 396 | 648 | 2.0E-12 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 42 | 226 | 2.0E-12 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 30 | 224 | 2.0E-12 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 574 | 691 | 2.0E-12 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 41 | 298 | 2.0E-12 |
sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 451 | 691 | 2.0E-12 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 457 | 691 | 2.0E-12 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 392 | 649 | 2.0E-12 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 492 | 694 | 2.0E-12 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 492 | 694 | 2.0E-12 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 447 | 694 | 2.0E-12 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 396 | 690 | 2.0E-12 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 39 | 200 | 2.0E-12 |
sp|P79959|GBB1_XENLA | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 | 475 | 699 | 2.0E-12 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 63 | 224 | 2.0E-12 |
sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 41 | 224 | 2.0E-12 |
sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 41 | 224 | 2.0E-12 |
sp|B5X212|CIO1B_SALSA | Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 | 473 | 693 | 2.0E-12 |
sp|P54319|PLAP_RAT | Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 | 393 | 759 | 2.0E-12 |
sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 63 | 224 | 2.0E-12 |
sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 57 | 245 | 2.0E-12 |
sp|Q5GIS3|GBB_PINFU | Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 | 41 | 224 | 2.0E-12 |
sp|Q6TMK6|GBB1_CRIGR | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 | 475 | 698 | 2.0E-12 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 58 | 228 | 2.0E-12 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 58 | 228 | 2.0E-12 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 574 | 773 | 3.0E-12 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 573 | 691 | 3.0E-12 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 447 | 691 | 3.0E-12 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 394 | 651 | 3.0E-12 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 39 | 224 | 3.0E-12 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 539 | 691 | 3.0E-12 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 539 | 691 | 3.0E-12 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 539 | 691 | 3.0E-12 |
sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 57 | 226 | 3.0E-12 |
sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 447 | 691 | 3.0E-12 |
sp|P25635|PWP2_YEAST | Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 | 57 | 226 | 3.0E-12 |
sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 414 | 687 | 3.0E-12 |
sp|Q08706|GBB_LYMST | Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 | 476 | 691 | 3.0E-12 |
sp|P54311|GBB1_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 | 475 | 698 | 3.0E-12 |
sp|P62874|GBB1_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 | 475 | 698 | 3.0E-12 |
sp|P62873|GBB1_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 | 475 | 698 | 3.0E-12 |
sp|P62872|GBB1_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 | 475 | 698 | 3.0E-12 |
sp|P62871|GBB1_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 | 475 | 698 | 3.0E-12 |
sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 56 | 224 | 3.0E-12 |
sp|O48847|LUH_ARATH | Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 | 401 | 691 | 3.0E-12 |
sp|Q5R5W8|GBB1_PONAB | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 | 475 | 698 | 3.0E-12 |
sp|Q6CBI8|CIAO1_YARLI | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1 | 473 | 692 | 3.0E-12 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 56 | 224 | 3.0E-12 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 539 | 691 | 4.0E-12 |
sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 97 | 294 | 4.0E-12 |
sp|P38011|GBLP_YEAST | Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 | 476 | 691 | 4.0E-12 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 57 | 226 | 4.0E-12 |
sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 58 | 226 | 4.0E-12 |
sp|Q26544|WSL17_SCHMA | WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 | 455 | 691 | 4.0E-12 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 398 | 691 | 4.0E-12 |
sp|P41318|LST8_YEAST | Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 | 403 | 663 | 4.0E-12 |
sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 476 | 697 | 4.0E-12 |
sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 58 | 224 | 4.0E-12 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 41 | 224 | 4.0E-12 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 574 | 691 | 5.0E-12 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 57 | 288 | 5.0E-12 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 473 | 649 | 5.0E-12 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 56 | 196 | 5.0E-12 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 57 | 230 | 5.0E-12 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 39 | 200 | 5.0E-12 |
sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 476 | 697 | 5.0E-12 |
sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 476 | 697 | 5.0E-12 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 356 | 691 | 6.0E-12 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 16 | 282 | 6.0E-12 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 58 | 228 | 6.0E-12 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 444 | 676 | 6.0E-12 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 312 | 690 | 6.0E-12 |
sp|Q5GIS3|GBB_PINFU | Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 | 476 | 691 | 6.0E-12 |
sp|B5X9P2|CIO1A_SALSA | Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 | 473 | 693 | 6.0E-12 |
sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 396 | 649 | 7.0E-12 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 454 | 691 | 7.0E-12 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 479 | 691 | 7.0E-12 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 30 | 224 | 7.0E-12 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 473 | 691 | 7.0E-12 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 447 | 691 | 7.0E-12 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 447 | 691 | 7.0E-12 |
sp|Q9D0I6|WSDU1_MOUSE | WD repeat, SAM and U-box domain-containing protein 1 OS=Mus musculus GN=Wdsub1 PE=2 SV=1 | 390 | 651 | 7.0E-12 |
sp|Q9W5Z5|WSB1_TAKRU | WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 | 551 | 700 | 7.0E-12 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 39 | 215 | 8.0E-12 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 393 | 614 | 8.0E-12 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 39 | 287 | 8.0E-12 |
sp|Q7T2F6|WSB1_DANRE | WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 | 551 | 700 | 8.0E-12 |
sp|Q27GK7|TPR4_ARATH | Topless-related protein 4 OS=Arabidopsis thaliana GN=TPR4 PE=1 SV=2 | 27 | 540 | 8.0E-12 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 573 | 691 | 9.0E-12 |
sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 39 | 287 | 9.0E-12 |
sp|O60508|PRP17_HUMAN | Pre-mRNA-processing factor 17 OS=Homo sapiens GN=CDC40 PE=1 SV=1 | 398 | 649 | 9.0E-12 |
sp|Q2GSJ9|HIR1_CHAGB | Protein HIR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HIR1 PE=3 SV=1 | 484 | 696 | 9.0E-12 |
sp|Q0CQ54|HIR1_ASPTN | Protein hir1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hir1 PE=3 SV=1 | 458 | 646 | 9.0E-12 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 414 | 690 | 1.0E-11 |
sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 396 | 649 | 1.0E-11 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 394 | 633 | 1.0E-11 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 394 | 633 | 1.0E-11 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 97 | 227 | 1.0E-11 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 97 | 294 | 1.0E-11 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 97 | 294 | 1.0E-11 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 447 | 691 | 1.0E-11 |
sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 39 | 218 | 1.0E-11 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 54 | 287 | 1.0E-11 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 39 | 287 | 1.0E-11 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 540 | 690 | 1.0E-11 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 539 | 691 | 1.0E-11 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 56 | 182 | 1.0E-11 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 465 | 693 | 1.0E-11 |
sp|B4P7Q3|CIAO1_DROYA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 | 57 | 286 | 1.0E-11 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 39 | 156 | 1.0E-11 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 474 | 706 | 1.0E-11 |
sp|Q08706|GBB_LYMST | Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 | 41 | 224 | 1.0E-11 |
sp|Q9DC48|PRP17_MOUSE | Pre-mRNA-processing factor 17 OS=Mus musculus GN=Cdc40 PE=2 SV=1 | 398 | 649 | 1.0E-11 |
sp|Q4P5F5|CIAO1_USTMA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CIA1 PE=3 SV=1 | 468 | 694 | 1.0E-11 |
sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 57 | 245 | 1.0E-11 |
sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 57 | 245 | 1.0E-11 |
sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 57 | 245 | 1.0E-11 |
sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 57 | 245 | 1.0E-11 |
sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 57 | 245 | 1.0E-11 |
sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 57 | 245 | 1.0E-11 |
sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 57 | 245 | 1.0E-11 |
sp|Q55DA2|CIAO1_DICDI | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 | 450 | 692 | 1.0E-11 |
sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 56 | 254 | 1.0E-11 |
sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 440 | 691 | 1.0E-11 |
sp|Q8N9V3|WSDU1_HUMAN | WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens GN=WDSUB1 PE=1 SV=3 | 6 | 320 | 1.0E-11 |
sp|Q5ZMC3|WSDU1_CHICK | WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2 | 444 | 695 | 1.0E-11 |
sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 58 | 298 | 1.0E-11 |
sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 57 | 294 | 1.0E-11 |
sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 56 | 254 | 1.0E-11 |
sp|Q91WM3|U3IP2_MOUSE | U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1 | 57 | 230 | 1.0E-11 |
sp|Q9XW12|CIAO1_CAEEL | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Caenorhabditis elegans GN=Y18D10A.9 PE=1 SV=2 | 478 | 690 | 1.0E-11 |
sp|Q6FJS0|PFS2_CANGA | Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 | 528 | 691 | 1.0E-11 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 444 | 649 | 1.0E-11 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 573 | 691 | 2.0E-11 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 398 | 610 | 2.0E-11 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 73 | 282 | 2.0E-11 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 540 | 690 | 2.0E-11 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 396 | 691 | 2.0E-11 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 542 | 691 | 2.0E-11 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 393 | 610 | 2.0E-11 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 396 | 649 | 2.0E-11 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 393 | 614 | 2.0E-11 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 96 | 226 | 2.0E-11 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 12 | 258 | 2.0E-11 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 465 | 693 | 2.0E-11 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 39 | 228 | 2.0E-11 |
sp|B4MY77|CIAO1_DROWI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 | 57 | 286 | 2.0E-11 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 443 | 695 | 2.0E-11 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 537 | 691 | 2.0E-11 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 56 | 294 | 2.0E-11 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 10 | 224 | 2.0E-11 |
sp|Q9Y6I7|WSB1_HUMAN | WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 | 454 | 690 | 2.0E-11 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 41 | 288 | 2.0E-11 |
sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 57 | 227 | 2.0E-11 |
sp|Q6H8D6|COB23_ORYSJ | Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 | 414 | 689 | 2.0E-11 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 449 | 691 | 2.0E-11 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 56 | 235 | 2.0E-11 |
sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 412 | 691 | 2.0E-11 |
sp|P42841|PFS2_YEAST | Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 | 528 | 691 | 2.0E-11 |
sp|Q6FJZ9|PRP46_CANGA | Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 | 53 | 224 | 2.0E-11 |
sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 56 | 279 | 2.0E-11 |
sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 396 | 708 | 2.0E-11 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 574 | 691 | 3.0E-11 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 73 | 285 | 3.0E-11 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 444 | 695 | 3.0E-11 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 573 | 691 | 3.0E-11 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 97 | 226 | 3.0E-11 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 97 | 226 | 3.0E-11 |
sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 41 | 244 | 3.0E-11 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 39 | 224 | 3.0E-11 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 97 | 240 | 3.0E-11 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 532 | 648 | 3.0E-11 |
sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 57 | 224 | 3.0E-11 |
sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 57 | 226 | 3.0E-11 |
sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 41 | 224 | 3.0E-11 |
sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 41 | 224 | 3.0E-11 |
sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 475 | 699 | 3.0E-11 |
sp|Q9UT57|CFD1_SCHPO | Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 | 474 | 693 | 3.0E-11 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 56 | 224 | 3.0E-11 |
sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 41 | 224 | 3.0E-11 |
sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 41 | 224 | 3.0E-11 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 396 | 609 | 3.0E-11 |
sp|P0CS38|HIR1_CRYNJ | Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HIR1 PE=3 SV=1 | 535 | 694 | 3.0E-11 |
sp|P0CS39|HIR1_CRYNB | Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HIR1 PE=3 SV=1 | 535 | 694 | 3.0E-11 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 559 | 691 | 4.0E-11 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 58 | 437 | 4.0E-11 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 58 | 224 | 4.0E-11 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 39 | 223 | 4.0E-11 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 398 | 707 | 4.0E-11 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 396 | 651 | 4.0E-11 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 474 | 691 | 4.0E-11 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 58 | 293 | 4.0E-11 |
sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 476 | 691 | 4.0E-11 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 476 | 691 | 4.0E-11 |
sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 41 | 224 | 4.0E-11 |
sp|C4R6H3|LIS1_PICPG | Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1 | 56 | 265 | 4.0E-11 |
sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 41 | 224 | 4.0E-11 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 41 | 224 | 4.0E-11 |
sp|Q6FJ73|CIAO1_CANGA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 | 473 | 693 | 4.0E-11 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 41 | 224 | 4.0E-11 |
sp|Q6FLI3|CAF4_CANGA | CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1 | 28 | 272 | 4.0E-11 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 443 | 691 | 5.0E-11 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 474 | 691 | 5.0E-11 |
sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 396 | 649 | 5.0E-11 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 540 | 690 | 5.0E-11 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 477 | 691 | 5.0E-11 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 73 | 282 | 5.0E-11 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 39 | 224 | 5.0E-11 |
sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 454 | 691 | 5.0E-11 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 472 | 691 | 5.0E-11 |
sp|P36408|GBB_DICDI | Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 | 39 | 224 | 5.0E-11 |
sp|Q6GM65|PLAP_XENLA | Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 | 41 | 286 | 5.0E-11 |
sp|Q6H8D5|COB22_ORYSJ | Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 | 414 | 689 | 5.0E-11 |
sp|O74184|WAT1_SCHPO | WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 | 401 | 674 | 5.0E-11 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 57 | 226 | 5.0E-11 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 398 | 691 | 5.0E-11 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 444 | 695 | 6.0E-11 |
sp|B3NQR5|CIAO1_DROER | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 | 57 | 286 | 6.0E-11 |
sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 56 | 224 | 6.0E-11 |
sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 56 | 224 | 6.0E-11 |
sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 56 | 224 | 6.0E-11 |
sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 58 | 228 | 6.0E-11 |
sp|Q6CXX3|HIR1_KLULA | Protein HIR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIR1 PE=3 SV=1 | 484 | 690 | 6.0E-11 |
sp|Q75C26|CIAO1_ASHGO | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIA1 PE=3 SV=1 | 473 | 701 | 6.0E-11 |
sp|P26308|GBB1_DROME | Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 | 476 | 699 | 6.0E-11 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 58 | 285 | 7.0E-11 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 572 | 694 | 7.0E-11 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 97 | 226 | 7.0E-11 |
sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 444 | 695 | 7.0E-11 |
sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 444 | 695 | 7.0E-11 |
sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 56 | 224 | 7.0E-11 |
sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 444 | 691 | 7.0E-11 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 380 | 695 | 7.0E-11 |
sp|P36408|GBB_DICDI | Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 | 476 | 691 | 7.0E-11 |
sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 384 | 690 | 7.0E-11 |
sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 447 | 690 | 7.0E-11 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 476 | 691 | 8.0E-11 |
sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 477 | 662 | 8.0E-11 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 392 | 608 | 8.0E-11 |
sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 443 | 695 | 8.0E-11 |
sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 41 | 224 | 8.0E-11 |
sp|Q8N9V3|WSDU1_HUMAN | WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens GN=WDSUB1 PE=1 SV=3 | 390 | 651 | 8.0E-11 |
sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 398 | 660 | 8.0E-11 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 56 | 293 | 8.0E-11 |
sp|P23232|GBB_LOLFO | Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 | 476 | 691 | 8.0E-11 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 56 | 224 | 8.0E-11 |
sp|Q0V8J1|WSB2_BOVIN | WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 | 454 | 690 | 8.0E-11 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 398 | 691 | 8.0E-11 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 396 | 690 | 9.0E-11 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 58 | 288 | 9.0E-11 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 413 | 650 | 9.0E-11 |
sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 414 | 689 | 9.0E-11 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 27 | 221 | 9.0E-11 |
sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 56 | 226 | 9.0E-11 |
sp|P74598|Y1491_SYNY3 | Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 | 406 | 649 | 9.0E-11 |
sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 56 | 224 | 9.0E-11 |
sp|Q6BYU4|HIR1_DEBHA | Protein HIR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HIR1 PE=3 SV=2 | 485 | 695 | 9.0E-11 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 396 | 691 | 9.0E-11 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 473 | 694 | 1.0E-10 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 41 | 182 | 1.0E-10 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 68 | 289 | 1.0E-10 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 39 | 254 | 1.0E-10 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 68 | 289 | 1.0E-10 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 9 | 203 | 1.0E-10 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 444 | 684 | 1.0E-10 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 56 | 286 | 1.0E-10 |
sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 27 | 606 | 1.0E-10 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 396 | 690 | 1.0E-10 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 537 | 691 | 1.0E-10 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 39 | 287 | 1.0E-10 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 57 | 288 | 1.0E-10 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 18 | 224 | 1.0E-10 |
sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 444 | 695 | 1.0E-10 |
sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 443 | 695 | 1.0E-10 |
sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 79 | 228 | 1.0E-10 |
sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 444 | 695 | 1.0E-10 |
sp|B4KTK4|CIAO1_DROMO | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 | 57 | 286 | 1.0E-10 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 56 | 215 | 1.0E-10 |
sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 444 | 691 | 1.0E-10 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 415 | 691 | 1.0E-10 |
sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 41 | 224 | 1.0E-10 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 398 | 691 | 1.0E-10 |
sp|Q8N9V3|WSDU1_HUMAN | WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens GN=WDSUB1 PE=1 SV=3 | 441 | 847 | 1.0E-10 |
sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 57 | 310 | 1.0E-10 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 27 | 221 | 1.0E-10 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 27 | 221 | 1.0E-10 |
sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 447 | 698 | 1.0E-10 |
sp|Q28DW0|CIAO1_XENTR | Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 | 472 | 693 | 1.0E-10 |
sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 58 | 226 | 1.0E-10 |
sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 58 | 226 | 1.0E-10 |
sp|Q9NYS7|WSB2_HUMAN | WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 | 454 | 690 | 1.0E-10 |
sp|Q4P4R3|HIR1_USTMA | Protein HIR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HIR1 PE=3 SV=1 | 478 | 694 | 1.0E-10 |
sp|A8Q2R5|WDR48_BRUMA | WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 | 39 | 221 | 1.0E-10 |
sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 447 | 690 | 1.0E-10 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 57 | 254 | 1.0E-10 |
sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 58 | 226 | 1.0E-10 |
sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 39 | 227 | 1.0E-10 |
sp|Q6BVZ3|PFS2_DEBHA | Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 | 528 | 691 | 1.0E-10 |
sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 475 | 699 | 1.0E-10 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 473 | 694 | 2.0E-10 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 39 | 237 | 2.0E-10 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 396 | 648 | 2.0E-10 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 396 | 648 | 2.0E-10 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 477 | 691 | 2.0E-10 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 396 | 648 | 2.0E-10 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 39 | 234 | 2.0E-10 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 56 | 286 | 2.0E-10 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 56 | 286 | 2.0E-10 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 56 | 286 | 2.0E-10 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 540 | 690 | 2.0E-10 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 477 | 691 | 2.0E-10 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 540 | 690 | 2.0E-10 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 540 | 690 | 2.0E-10 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 61 | 226 | 2.0E-10 |
sp|B3MC74|CIAO1_DROAN | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 | 57 | 286 | 2.0E-10 |
sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 476 | 691 | 2.0E-10 |
sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 380 | 645 | 2.0E-10 |
sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 380 | 645 | 2.0E-10 |
sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 62 | 224 | 2.0E-10 |
sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 477 | 691 | 2.0E-10 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 396 | 610 | 2.0E-10 |
sp|B4JW81|CIAO1_DROGR | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 | 57 | 286 | 2.0E-10 |
sp|B4LJT7|CIAO1_DROVI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 | 57 | 286 | 2.0E-10 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 57 | 286 | 2.0E-10 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 41 | 224 | 2.0E-10 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 57 | 224 | 2.0E-10 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 447 | 652 | 2.0E-10 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 57 | 224 | 2.0E-10 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 57 | 224 | 2.0E-10 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 92 | 288 | 2.0E-10 |
sp|O54927|WSB1_MOUSE | WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 | 454 | 690 | 2.0E-10 |
sp|P25635|PWP2_YEAST | Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 | 100 | 611 | 2.0E-10 |
sp|Q5ZMC3|WSDU1_CHICK | WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2 | 390 | 652 | 2.0E-10 |
sp|Q6H8D6|COB23_ORYSJ | Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 | 57 | 224 | 2.0E-10 |
sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 440 | 647 | 2.0E-10 |
sp|P26308|GBB1_DROME | Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 | 41 | 224 | 2.0E-10 |
sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 57 | 224 | 2.0E-10 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 57 | 200 | 2.0E-10 |
sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 447 | 687 | 2.0E-10 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 27 | 221 | 2.0E-10 |
sp|Q8C0J2|A16L1_MOUSE | Autophagy-related protein 16-1 OS=Mus musculus GN=Atg16l1 PE=1 SV=1 | 57 | 231 | 2.0E-10 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 56 | 224 | 2.0E-10 |
sp|O95170|CDRT1_HUMAN | CMT1A duplicated region transcript 1 protein OS=Homo sapiens GN=CDRT1 PE=2 SV=3 | 57 | 226 | 2.0E-10 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 27 | 221 | 2.0E-10 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 27 | 221 | 2.0E-10 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 27 | 221 | 2.0E-10 |
sp|Q8W117|SMU1_ARATH | Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 | 482 | 691 | 2.0E-10 |
sp|Q2UBU2|HIR1_ASPOR | Protein HIR1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=HIR1 PE=3 SV=1 | 484 | 690 | 2.0E-10 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 57 | 224 | 2.0E-10 |
sp|B7QKS1|CIAO1_IXOSC | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 | 477 | 670 | 2.0E-10 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 473 | 694 | 3.0E-10 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 18 | 151 | 3.0E-10 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 470 | 691 | 3.0E-10 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 396 | 648 | 3.0E-10 |
sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 396 | 649 | 3.0E-10 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 396 | 629 | 3.0E-10 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 56 | 286 | 3.0E-10 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 540 | 690 | 3.0E-10 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 540 | 690 | 3.0E-10 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 540 | 690 | 3.0E-10 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 79 | 228 | 3.0E-10 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 31 | 253 | 3.0E-10 |
sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 97 | 472 | 3.0E-10 |
sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 27 | 224 | 3.0E-10 |
sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 27 | 224 | 3.0E-10 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 476 | 693 | 3.0E-10 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 476 | 693 | 3.0E-10 |
sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 476 | 691 | 3.0E-10 |
sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 27 | 224 | 3.0E-10 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 380 | 645 | 3.0E-10 |
sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 478 | 758 | 3.0E-10 |
sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 478 | 758 | 3.0E-10 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 380 | 645 | 3.0E-10 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 57 | 235 | 3.0E-10 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 57 | 235 | 3.0E-10 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 57 | 235 | 3.0E-10 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 57 | 235 | 3.0E-10 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 57 | 235 | 3.0E-10 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 41 | 224 | 3.0E-10 |
sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 476 | 692 | 3.0E-10 |
sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 41 | 224 | 3.0E-10 |
sp|Q6FJS0|PFS2_CANGA | Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 | 62 | 288 | 3.0E-10 |
sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 54 | 230 | 3.0E-10 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 561 | 691 | 3.0E-10 |
sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 57 | 236 | 3.0E-10 |
sp|Q5XX13|FBW10_HUMAN | F-box/WD repeat-containing protein 10 OS=Homo sapiens GN=FBXW10 PE=2 SV=2 | 57 | 226 | 3.0E-10 |
sp|Q9AUR7|COPA2_ORYSJ | Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 | 81 | 287 | 3.0E-10 |
sp|Q4PHV3|IPI3_USTMA | Pre-rRNA-processing protein IPI3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=IPI3 PE=3 SV=1 | 60 | 194 | 3.0E-10 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 57 | 200 | 3.0E-10 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 57 | 200 | 3.0E-10 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 440 | 692 | 3.0E-10 |
sp|Q676U5|A16L1_HUMAN | Autophagy-related protein 16-1 OS=Homo sapiens GN=ATG16L1 PE=1 SV=2 | 57 | 231 | 3.0E-10 |
sp|Q6FVD3|HIR1_CANGA | Protein HIR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HIR1 PE=3 SV=1 | 539 | 702 | 3.0E-10 |
sp|Q96WV5|COPA_SCHPO | Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 | 49 | 287 | 3.0E-10 |
sp|O14435|GBB_CRYPA | Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 | 39 | 224 | 3.0E-10 |
sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 26 | 200 | 3.0E-10 |
sp|Q5RAC9|A16L1_PONAB | Autophagy-related protein 16-1 OS=Pongo abelii GN=ATG16L1 PE=2 SV=1 | 57 | 231 | 3.0E-10 |
sp|Q9C270|PWP2_NEUCR | Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 | 58 | 226 | 3.0E-10 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 540 | 690 | 4.0E-10 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 396 | 629 | 4.0E-10 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 454 | 690 | 4.0E-10 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 14 | 225 | 4.0E-10 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 540 | 690 | 4.0E-10 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 540 | 690 | 4.0E-10 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 540 | 690 | 4.0E-10 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 540 | 690 | 4.0E-10 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 540 | 690 | 4.0E-10 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 540 | 690 | 4.0E-10 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 1 | 187 | 4.0E-10 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 33 | 225 | 4.0E-10 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 39 | 226 | 4.0E-10 |
sp|B4GDM7|CIAO1_DROPE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 | 57 | 286 | 4.0E-10 |
sp|Q292E8|CIAO1_DROPS | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 | 57 | 286 | 4.0E-10 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 444 | 695 | 4.0E-10 |
sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 27 | 224 | 4.0E-10 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 380 | 645 | 4.0E-10 |
sp|Q7K1Y4|CIAO1_DROME | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 | 57 | 286 | 4.0E-10 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 380 | 645 | 4.0E-10 |
sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 477 | 691 | 4.0E-10 |
sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 477 | 691 | 4.0E-10 |
sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 444 | 712 | 4.0E-10 |
sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 408 | 690 | 4.0E-10 |
sp|O74184|WAT1_SCHPO | WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 | 64 | 305 | 4.0E-10 |
sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 39 | 224 | 4.0E-10 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 57 | 224 | 4.0E-10 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 27 | 221 | 4.0E-10 |
sp|Q8SQS4|TAF5_ENCCU | Transcription initiation factor TFIID subunit 5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TAF5 PE=1 SV=1 | 441 | 655 | 4.0E-10 |
sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 57 | 200 | 4.0E-10 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 398 | 691 | 4.0E-10 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 56 | 224 | 4.0E-10 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 540 | 691 | 4.0E-10 |
sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 447 | 712 | 4.0E-10 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 41 | 182 | 5.0E-10 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 57 | 224 | 5.0E-10 |
sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 396 | 649 | 5.0E-10 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 57 | 228 | 5.0E-10 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 444 | 691 | 5.0E-10 |
sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 380 | 645 | 5.0E-10 |
sp|Q6H8D5|COB22_ORYSJ | Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 | 57 | 224 | 5.0E-10 |
sp|P23232|GBB_LOLFO | Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 | 41 | 224 | 5.0E-10 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 449 | 691 | 5.0E-10 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 57 | 200 | 5.0E-10 |
sp|O94620|CWF17_SCHPO | Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 | 57 | 226 | 5.0E-10 |
sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 412 | 691 | 5.0E-10 |
sp|A7TNS8|CAF4_VANPO | CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 | 47 | 193 | 5.0E-10 |
sp|Q9CAA0|COB21_ARATH | Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 | 57 | 235 | 5.0E-10 |
sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 39 | 225 | 6.0E-10 |
sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 57 | 224 | 6.0E-10 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 57 | 226 | 6.0E-10 |
sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 41 | 224 | 6.0E-10 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 37 | 224 | 6.0E-10 |
sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 396 | 648 | 6.0E-10 |
sp|Q8W117|SMU1_ARATH | Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 | 58 | 193 | 6.0E-10 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 57 | 226 | 6.0E-10 |
sp|Q6DH44|WDR83_DANRE | WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1 | 540 | 691 | 6.0E-10 |
sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 477 | 662 | 7.0E-10 |
sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 57 | 226 | 7.0E-10 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 540 | 690 | 7.0E-10 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 393 | 610 | 7.0E-10 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 477 | 691 | 7.0E-10 |
sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 447 | 691 | 7.0E-10 |
sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 380 | 645 | 7.0E-10 |
sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 30 | 221 | 7.0E-10 |
sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 41 | 224 | 7.0E-10 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 398 | 691 | 7.0E-10 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 561 | 691 | 7.0E-10 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 387 | 691 | 7.0E-10 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 387 | 691 | 7.0E-10 |
sp|O62621|COPB2_DROME | Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 | 57 | 235 | 7.0E-10 |
sp|O62621|COPB2_DROME | Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 | 414 | 696 | 7.0E-10 |
sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 56 | 224 | 7.0E-10 |
sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 528 | 691 | 7.0E-10 |
sp|Q0J3D9|COPA3_ORYSJ | Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 | 81 | 287 | 7.0E-10 |
sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 81 | 287 | 7.0E-10 |
sp|Q5BDU4|HIR1_EMENI | Protein hir1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hir1 PE=3 SV=2 | 484 | 690 | 7.0E-10 |
sp|Q9C827|COB22_ARATH | Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 | 57 | 236 | 7.0E-10 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 473 | 691 | 8.0E-10 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 575 | 691 | 8.0E-10 |
sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 515 | 691 | 8.0E-10 |
sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 77 | 224 | 8.0E-10 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 57 | 246 | 8.0E-10 |
sp|Q59WJ4|PFS2_CANAL | Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1 | 62 | 293 | 8.0E-10 |
sp|Q6GM65|PLAP_XENLA | Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 | 449 | 692 | 8.0E-10 |
sp|Q75AV4|PFS2_ASHGO | Polyadenylation factor subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSF2 PE=3 SV=1 | 528 | 691 | 8.0E-10 |
sp|Q9AUR8|COPA1_ORYSJ | Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 | 81 | 287 | 8.0E-10 |
sp|Q9DAJ4|WDR83_MOUSE | WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 | 376 | 654 | 8.0E-10 |
sp|Q9UTN4|PFS2_SCHPO | Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 | 57 | 322 | 9.0E-10 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 520 | 691 | 9.0E-10 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 449 | 691 | 9.0E-10 |
sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 540 | 691 | 9.0E-10 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 531 | 699 | 1.0E-09 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 56 | 196 | 1.0E-09 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 73 | 282 | 1.0E-09 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 56 | 182 | 1.0E-09 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 469 | 712 | 1.0E-09 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 573 | 691 | 1.0E-09 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 573 | 691 | 1.0E-09 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 573 | 691 | 1.0E-09 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 56 | 289 | 1.0E-09 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 573 | 691 | 1.0E-09 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 574 | 691 | 1.0E-09 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 27 | 227 | 1.0E-09 |
sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 380 | 645 | 1.0E-09 |
sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 380 | 645 | 1.0E-09 |
sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 379 | 645 | 1.0E-09 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 472 | 684 | 1.0E-09 |
sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 414 | 686 | 1.0E-09 |
sp|O35142|COPB2_RAT | Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 | 57 | 235 | 1.0E-09 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 387 | 561 | 1.0E-09 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 57 | 200 | 1.0E-09 |
sp|O14435|GBB_CRYPA | Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 | 476 | 691 | 1.0E-09 |
sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 398 | 691 | 1.0E-09 |
sp|Q9CAA0|COB21_ARATH | Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 | 414 | 689 | 1.0E-09 |
sp|Q55FR9|COPA_DICDI | Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 | 81 | 287 | 1.0E-09 |
sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 39 | 204 | 1.0E-09 |
sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 81 | 287 | 1.0E-09 |
sp|Q04727|TLE4_HUMAN | Transducin-like enhancer protein 4 OS=Homo sapiens GN=TLE4 PE=1 SV=3 | 388 | 643 | 1.0E-09 |
sp|Q9W328|LST8_DROME | Protein LST8 homolog OS=Drosophila melanogaster GN=Lst8 PE=2 SV=2 | 394 | 632 | 1.0E-09 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 94 | 470 | 1.0E-09 |
sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 57 | 200 | 1.0E-09 |
sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 62 | 249 | 1.0E-09 |
sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 57 | 200 | 1.0E-09 |
sp|Q62441|TLE4_MOUSE | Transducin-like enhancer protein 4 OS=Mus musculus GN=Tle4 PE=1 SV=4 | 388 | 643 | 1.0E-09 |
sp|P91341|PWP2_CAEEL | Periodic tryptophan protein 2 homolog OS=Caenorhabditis elegans GN=F55F8.3 PE=3 SV=2 | 55 | 230 | 1.0E-09 |
sp|O42478|TLE4_XENLA | Transducin-like enhancer protein 4 OS=Xenopus laevis GN=tle4 PE=1 SV=2 | 388 | 643 | 1.0E-09 |
sp|Q28I90|DCAF8_XENTR | DDB1- and CUL4-associated factor 8 OS=Xenopus tropicalis GN=dcaf8 PE=2 SV=1 | 93 | 221 | 1.0E-09 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 18 | 151 | 2.0E-09 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 39 | 228 | 2.0E-09 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 56 | 182 | 2.0E-09 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 27 | 226 | 2.0E-09 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 56 | 182 | 2.0E-09 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 56 | 182 | 2.0E-09 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 489 | 700 | 2.0E-09 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 496 | 691 | 2.0E-09 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 439 | 614 | 2.0E-09 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 396 | 649 | 2.0E-09 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 573 | 691 | 2.0E-09 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 573 | 691 | 2.0E-09 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 574 | 691 | 2.0E-09 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 574 | 691 | 2.0E-09 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 574 | 691 | 2.0E-09 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 30 | 288 | 2.0E-09 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 573 | 691 | 2.0E-09 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 94 | 285 | 2.0E-09 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 570 | 691 | 2.0E-09 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 397 | 654 | 2.0E-09 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 570 | 691 | 2.0E-09 |
sp|P38011|GBLP_YEAST | Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 | 96 | 239 | 2.0E-09 |
sp|B4HRQ6|CIAO1_DROSE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 | 57 | 286 | 2.0E-09 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 394 | 606 | 2.0E-09 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 57 | 224 | 2.0E-09 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 394 | 606 | 2.0E-09 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 394 | 606 | 2.0E-09 |
sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 477 | 691 | 2.0E-09 |
sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 447 | 691 | 2.0E-09 |
sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 477 | 691 | 2.0E-09 |
sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 447 | 691 | 2.0E-09 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 444 | 695 | 2.0E-09 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 449 | 733 | 2.0E-09 |
sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 37 | 224 | 2.0E-09 |
sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 37 | 224 | 2.0E-09 |
sp|A0AUS0|WSDU1_DANRE | WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 | 12 | 320 | 2.0E-09 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 396 | 672 | 2.0E-09 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 396 | 672 | 2.0E-09 |
sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 57 | 226 | 2.0E-09 |
sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 395 | 606 | 2.0E-09 |
sp|Q6H8D5|COB22_ORYSJ | Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 | 37 | 221 | 2.0E-09 |
sp|Q0V8J1|WSB2_BOVIN | WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 | 61 | 293 | 2.0E-09 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 57 | 228 | 2.0E-09 |
sp|Q9NYS7|WSB2_HUMAN | WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 | 61 | 293 | 2.0E-09 |
sp|Q6BVZ3|PFS2_DEBHA | Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 | 59 | 293 | 2.0E-09 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 41 | 224 | 2.0E-09 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 449 | 691 | 2.0E-09 |
sp|Q9C827|COB22_ARATH | Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 | 414 | 689 | 2.0E-09 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 57 | 200 | 2.0E-09 |
sp|Q6CMA2|CIAO1_KLULA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CIA1 PE=3 SV=1 | 526 | 706 | 2.0E-09 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 56 | 236 | 2.0E-09 |
sp|Q9AV81|PRP19_ORYSJ | Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica GN=PRP19 PE=2 SV=1 | 69 | 285 | 2.0E-09 |
sp|Q6NRH1|DCAF8_XENLA | DDB1- and CUL4-associated factor 8 OS=Xenopus laevis GN=dcaf8 PE=2 SV=1 | 93 | 221 | 2.0E-09 |
sp|O22785|PR19B_ARATH | Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 | 58 | 292 | 2.0E-09 |
sp|O43071|PRP17_SCHPO | Pre-mRNA-processing factor 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp17 PE=1 SV=1 | 398 | 649 | 2.0E-09 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 79 | 229 | 2.0E-09 |
sp|P29387|GBB4_MOUSE | Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4 | 475 | 699 | 2.0E-09 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 27 | 228 | 3.0E-09 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 443 | 691 | 3.0E-09 |
sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 68 | 230 | 3.0E-09 |
sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 68 | 230 | 3.0E-09 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 56 | 182 | 3.0E-09 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 38 | 227 | 3.0E-09 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 439 | 613 | 3.0E-09 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 38 | 227 | 3.0E-09 |
sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 23 | 235 | 3.0E-09 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 396 | 649 | 3.0E-09 |
sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 396 | 649 | 3.0E-09 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 574 | 691 | 3.0E-09 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 444 | 691 | 3.0E-09 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 398 | 648 | 3.0E-09 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 41 | 219 | 3.0E-09 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 398 | 690 | 3.0E-09 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 38 | 235 | 3.0E-09 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 57 | 200 | 3.0E-09 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 444 | 695 | 3.0E-09 |
sp|Q8RXA7|SCD1_ARATH | DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 | 389 | 692 | 3.0E-09 |
sp|P79959|GBB1_XENLA | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 | 58 | 224 | 3.0E-09 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 444 | 691 | 3.0E-09 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 444 | 691 | 3.0E-09 |
sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 444 | 691 | 3.0E-09 |
sp|Q9W5Z5|WSB1_TAKRU | WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 | 454 | 691 | 3.0E-09 |
sp|Q55DA2|CIAO1_DICDI | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 | 27 | 229 | 3.0E-09 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 79 | 240 | 3.0E-09 |
sp|Q6H8D6|COB23_ORYSJ | Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 | 37 | 221 | 3.0E-09 |
sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 30 | 221 | 3.0E-09 |
sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 398 | 691 | 3.0E-09 |
sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 398 | 691 | 3.0E-09 |
sp|Q55AR8|SNR40_DICDI | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 | 30 | 288 | 3.0E-09 |
sp|O35353|GBB4_RAT | Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4 | 475 | 699 | 3.0E-09 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 376 | 654 | 3.0E-09 |
sp|P0CS47|PFS2_CRYNB | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 | 399 | 663 | 3.0E-09 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 18 | 151 | 4.0E-09 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 73 | 285 | 4.0E-09 |
sp|Q9SZQ5|VIP3_ARATH | WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 | 39 | 230 | 4.0E-09 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 574 | 691 | 4.0E-09 |
sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 511 | 691 | 4.0E-09 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 297 | 689 | 4.0E-09 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 57 | 194 | 4.0E-09 |
sp|B4QFZ8|CIAO1_DROSI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 | 57 | 286 | 4.0E-09 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 394 | 606 | 4.0E-09 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 56 | 225 | 4.0E-09 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 476 | 691 | 4.0E-09 |
sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 37 | 224 | 4.0E-09 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 39 | 229 | 4.0E-09 |
sp|Q6P1V3|WSB1_XENTR | WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 | 454 | 724 | 4.0E-09 |
sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 41 | 224 | 4.0E-09 |
sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 41 | 224 | 4.0E-09 |
sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 41 | 224 | 4.0E-09 |
sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 41 | 224 | 4.0E-09 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 60 | 227 | 4.0E-09 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 39 | 226 | 4.0E-09 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 37 | 224 | 4.0E-09 |
sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 41 | 224 | 4.0E-09 |
sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 39 | 224 | 4.0E-09 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 37 | 224 | 4.0E-09 |
sp|Q9C270|PWP2_NEUCR | Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 | 36 | 307 | 4.0E-09 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 57 | 338 | 5.0E-09 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 540 | 691 | 5.0E-09 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 80 | 289 | 5.0E-09 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 73 | 282 | 5.0E-09 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 474 | 691 | 5.0E-09 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 574 | 691 | 5.0E-09 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 41 | 219 | 5.0E-09 |
sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 62 | 228 | 5.0E-09 |
sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 72 | 226 | 5.0E-09 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 39 | 131 | 5.0E-09 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 52 | 224 | 5.0E-09 |
sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 396 | 691 | 5.0E-09 |
sp|Q9D0I6|WSDU1_MOUSE | WD repeat, SAM and U-box domain-containing protein 1 OS=Mus musculus GN=Wdsub1 PE=2 SV=1 | 11 | 320 | 5.0E-09 |
sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 57 | 226 | 5.0E-09 |
sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 97 | 294 | 5.0E-09 |
sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 440 | 691 | 5.0E-09 |
sp|Q8SQS4|TAF5_ENCCU | Transcription initiation factor TFIID subunit 5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TAF5 PE=1 SV=1 | 60 | 183 | 5.0E-09 |
sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 57 | 227 | 5.0E-09 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 100 | 437 | 6.0E-09 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 68 | 227 | 6.0E-09 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 398 | 610 | 6.0E-09 |
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 41 | 219 | 6.0E-09 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 96 | 253 | 6.0E-09 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 472 | 691 | 6.0E-09 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 575 | 691 | 6.0E-09 |
sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 39 | 239 | 6.0E-09 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 40 | 216 | 6.0E-09 |
sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 478 | 690 | 6.0E-09 |
sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 396 | 691 | 6.0E-09 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 427 | 627 | 6.0E-09 |
sp|Q6FJ73|CIAO1_CANGA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 | 46 | 275 | 6.0E-09 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 41 | 224 | 6.0E-09 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 96 | 246 | 7.0E-09 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 37 | 225 | 7.0E-09 |
sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 39 | 224 | 7.0E-09 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 394 | 671 | 7.0E-09 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 52 | 224 | 7.0E-09 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 37 | 224 | 7.0E-09 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 52 | 224 | 7.0E-09 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 476 | 691 | 7.0E-09 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 57 | 230 | 7.0E-09 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 57 | 230 | 7.0E-09 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 408 | 649 | 7.0E-09 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 390 | 691 | 7.0E-09 |
sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 408 | 649 | 7.0E-09 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 39 | 224 | 7.0E-09 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 474 | 691 | 8.0E-09 |
sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 478 | 690 | 8.0E-09 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 39 | 131 | 8.0E-09 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 476 | 692 | 8.0E-09 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 398 | 528 | 8.0E-09 |
sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 440 | 649 | 8.0E-09 |
sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 440 | 649 | 8.0E-09 |
sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 440 | 649 | 8.0E-09 |
sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 440 | 649 | 8.0E-09 |
sp|Q6TMK6|GBB1_CRIGR | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 | 58 | 224 | 8.0E-09 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 52 | 228 | 8.0E-09 |
sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 37 | 224 | 8.0E-09 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 41 | 224 | 8.0E-09 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 41 | 224 | 8.0E-09 |
sp|Q6CMA2|CIAO1_KLULA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CIA1 PE=3 SV=1 | 43 | 286 | 8.0E-09 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 398 | 612 | 9.0E-09 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 540 | 700 | 9.0E-09 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 474 | 702 | 9.0E-09 |
sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 62 | 224 | 9.0E-09 |
sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 478 | 690 | 9.0E-09 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 57 | 224 | 9.0E-09 |
sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 396 | 691 | 9.0E-09 |
sp|P54311|GBB1_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 | 58 | 224 | 9.0E-09 |
sp|P62874|GBB1_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 | 58 | 224 | 9.0E-09 |
sp|P62873|GBB1_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 | 58 | 224 | 9.0E-09 |
sp|P62872|GBB1_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 | 58 | 224 | 9.0E-09 |
sp|P62871|GBB1_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 | 58 | 224 | 9.0E-09 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 41 | 224 | 9.0E-09 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 437 | 648 | 9.0E-09 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 377 | 691 | 9.0E-09 |
sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 57 | 235 | 1.0E-08 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 574 | 691 | 1.0E-08 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 57 | 294 | 1.0E-08 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 57 | 228 | 1.0E-08 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 398 | 509 | 1.0E-08 |
sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 396 | 691 | 1.0E-08 |
sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 457 | 649 | 1.0E-08 |
sp|Q8RXA7|SCD1_ARATH | DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 | 47 | 228 | 1.0E-08 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 427 | 627 | 1.0E-08 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 479 | 690 | 1.0E-08 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 471 | 691 | 1.0E-08 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 471 | 691 | 1.0E-08 |
sp|Q5R5W8|GBB1_PONAB | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 | 58 | 224 | 1.0E-08 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 57 | 228 | 1.0E-08 |
sp|Q5ZMC3|WSDU1_CHICK | WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2 | 40 | 291 | 1.0E-08 |
sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 440 | 691 | 1.0E-08 |
sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 437 | 648 | 1.0E-08 |
sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 437 | 648 | 1.0E-08 |
sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 445 | 648 | 1.0E-08 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 445 | 648 | 1.0E-08 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 56 | 254 | 1.0E-08 |
sp|P26308|GBB1_DROME | Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 | 440 | 691 | 1.0E-08 |
sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 414 | 691 | 1.0E-08 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 540 | 691 | 1.0E-08 |
sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 97 | 479 | 1.0E-08 |
sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 68 | 290 | 1.0E-08 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 39 | 130 | 2.0E-08 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 575 | 691 | 2.0E-08 |
sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 414 | 686 | 2.0E-08 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 393 | 610 | 2.0E-08 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 396 | 690 | 2.0E-08 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 396 | 690 | 2.0E-08 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 398 | 509 | 2.0E-08 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 476 | 691 | 2.0E-08 |
sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 476 | 691 | 2.0E-08 |
sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 476 | 691 | 2.0E-08 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 413 | 692 | 2.0E-08 |
sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 393 | 691 | 2.0E-08 |
sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 393 | 691 | 2.0E-08 |
sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 444 | 695 | 2.0E-08 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 57 | 228 | 2.0E-08 |
sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 476 | 693 | 2.0E-08 |
sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 476 | 693 | 2.0E-08 |
sp|Q5GIS3|GBB_PINFU | Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 | 440 | 691 | 2.0E-08 |
sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 396 | 691 | 2.0E-08 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 74 | 232 | 2.0E-08 |
sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 396 | 691 | 2.0E-08 |
sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 437 | 648 | 2.0E-08 |
sp|P36408|GBB_DICDI | Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 | 365 | 690 | 2.0E-08 |
sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 476 | 691 | 2.0E-08 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 427 | 627 | 2.0E-08 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 57 | 228 | 2.0E-08 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 540 | 691 | 2.0E-08 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 540 | 691 | 2.0E-08 |
sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 414 | 689 | 2.0E-08 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 540 | 691 | 2.0E-08 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 540 | 691 | 2.0E-08 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 540 | 691 | 2.0E-08 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 540 | 691 | 2.0E-08 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 378 | 695 | 2.0E-08 |
sp|O94620|CWF17_SCHPO | Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 | 398 | 603 | 2.0E-08 |
sp|Q0J3D9|COPA3_ORYSJ | Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 | 399 | 698 | 2.0E-08 |
sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 399 | 698 | 2.0E-08 |
sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 451 | 691 | 2.0E-08 |
sp|Q62441|TLE4_MOUSE | Transducin-like enhancer protein 4 OS=Mus musculus GN=Tle4 PE=1 SV=4 | 480 | 689 | 2.0E-08 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 93 | 294 | 3.0E-08 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 477 | 691 | 3.0E-08 |
sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 62 | 208 | 3.0E-08 |
sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 396 | 649 | 3.0E-08 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 95 | 246 | 3.0E-08 |
sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 392 | 690 | 3.0E-08 |
sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 392 | 690 | 3.0E-08 |
sp|Q20168|COPB2_CAEEL | Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 | 25 | 221 | 3.0E-08 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 37 | 227 | 3.0E-08 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 56 | 182 | 3.0E-08 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 445 | 649 | 3.0E-08 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 543 | 691 | 3.0E-08 |
sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 562 | 691 | 3.0E-08 |
sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 570 | 691 | 3.0E-08 |
sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 447 | 691 | 3.0E-08 |
sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 562 | 691 | 3.0E-08 |
sp|Q6P1V3|WSB1_XENTR | WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 | 412 | 641 | 3.0E-08 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 41 | 224 | 3.0E-08 |
sp|P25635|PWP2_YEAST | Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2 | 55 | 226 | 3.0E-08 |
sp|Q08706|GBB_LYMST | Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 | 440 | 649 | 3.0E-08 |
sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 412 | 649 | 3.0E-08 |
sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 570 | 691 | 3.0E-08 |
sp|P42841|PFS2_YEAST | Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 | 62 | 288 | 3.0E-08 |
sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 396 | 691 | 3.0E-08 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 396 | 691 | 3.0E-08 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 540 | 691 | 3.0E-08 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 447 | 691 | 3.0E-08 |
sp|Q9DAJ4|WDR83_MOUSE | WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 | 79 | 226 | 3.0E-08 |
sp|Q04727|TLE4_HUMAN | Transducin-like enhancer protein 4 OS=Homo sapiens GN=TLE4 PE=1 SV=3 | 480 | 689 | 3.0E-08 |
sp|O42478|TLE4_XENLA | Transducin-like enhancer protein 4 OS=Xenopus laevis GN=tle4 PE=1 SV=2 | 480 | 689 | 3.0E-08 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 80 | 263 | 4.0E-08 |
sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 62 | 221 | 4.0E-08 |
sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 62 | 203 | 4.0E-08 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 62 | 203 | 4.0E-08 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 62 | 203 | 4.0E-08 |
sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 62 | 203 | 4.0E-08 |
sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 398 | 608 | 4.0E-08 |
sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 398 | 608 | 4.0E-08 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 95 | 246 | 4.0E-08 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 540 | 691 | 4.0E-08 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 57 | 229 | 4.0E-08 |
sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 62 | 224 | 4.0E-08 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 543 | 691 | 4.0E-08 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 543 | 691 | 4.0E-08 |
sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 393 | 691 | 4.0E-08 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 543 | 691 | 4.0E-08 |
sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 393 | 691 | 4.0E-08 |
sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 352 | 691 | 4.0E-08 |
sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 352 | 691 | 4.0E-08 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 574 | 691 | 4.0E-08 |
sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 396 | 691 | 4.0E-08 |
sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 396 | 691 | 4.0E-08 |
sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 396 | 691 | 4.0E-08 |
sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 396 | 691 | 4.0E-08 |
sp|P54319|PLAP_RAT | Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 | 54 | 358 | 4.0E-08 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 57 | 224 | 4.0E-08 |
sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 400 | 681 | 4.0E-08 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 475 | 690 | 4.0E-08 |
sp|Q9AUR7|COPA2_ORYSJ | Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 | 399 | 698 | 4.0E-08 |
sp|Q676U5|A16L1_HUMAN | Autophagy-related protein 16-1 OS=Homo sapiens GN=ATG16L1 PE=1 SV=2 | 471 | 691 | 4.0E-08 |
sp|Q9C827|COB22_ARATH | Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 | 30 | 221 | 4.0E-08 |
sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 446 | 817 | 4.0E-08 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 79 | 226 | 4.0E-08 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 573 | 691 | 5.0E-08 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 540 | 693 | 5.0E-08 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 62 | 224 | 5.0E-08 |
sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 478 | 690 | 5.0E-08 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 496 | 691 | 5.0E-08 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 56 | 182 | 5.0E-08 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 39 | 129 | 5.0E-08 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 469 | 691 | 5.0E-08 |
sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 477 | 691 | 5.0E-08 |
sp|P27612|PLAP_MOUSE | Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 | 54 | 225 | 5.0E-08 |
sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 57 | 208 | 5.0E-08 |
sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 447 | 691 | 5.0E-08 |
sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 447 | 691 | 5.0E-08 |
sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 57 | 293 | 5.0E-08 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 39 | 222 | 5.0E-08 |
sp|Q9CAA0|COB21_ARATH | Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 | 30 | 221 | 5.0E-08 |
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 411 | 612 | 6.0E-08 |
sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 412 | 690 | 6.0E-08 |
sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 477 | 649 | 6.0E-08 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 478 | 690 | 6.0E-08 |
sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 478 | 691 | 6.0E-08 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 478 | 690 | 6.0E-08 |
sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 540 | 691 | 6.0E-08 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 478 | 690 | 6.0E-08 |
sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 57 | 293 | 6.0E-08 |
sp|P79959|GBB1_XENLA | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 | 396 | 691 | 6.0E-08 |
sp|Q7T2F6|WSB1_DANRE | WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 | 454 | 690 | 6.0E-08 |
sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 39 | 226 | 6.0E-08 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 475 | 690 | 6.0E-08 |
sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 57 | 226 | 6.0E-08 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 475 | 690 | 6.0E-08 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 399 | 645 | 6.0E-08 |
sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 18 | 203 | 7.0E-08 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 478 | 690 | 7.0E-08 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 57 | 226 | 7.0E-08 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 58 | 224 | 7.0E-08 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 473 | 691 | 7.0E-08 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 540 | 691 | 7.0E-08 |
sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 399 | 698 | 7.0E-08 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 80 | 289 | 8.0E-08 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 477 | 691 | 8.0E-08 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 57 | 288 | 8.0E-08 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 540 | 697 | 8.0E-08 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 39 | 226 | 8.0E-08 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 39 | 226 | 8.0E-08 |
sp|Q5R5W8|GBB1_PONAB | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 | 283 | 649 | 8.0E-08 |
sp|Q6FJZ9|PRP46_CANGA | Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 | 575 | 691 | 8.0E-08 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 475 | 690 | 8.0E-08 |
sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 514 | 691 | 8.0E-08 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 475 | 690 | 8.0E-08 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 37 | 224 | 8.0E-08 |
sp|Q9AUR8|COPA1_ORYSJ | Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 | 399 | 698 | 8.0E-08 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 70 | 184 | 9.0E-08 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 476 | 691 | 9.0E-08 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 381 | 691 | 9.0E-08 |
sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 43 | 130 | 9.0E-08 |
sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 43 | 130 | 9.0E-08 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 39 | 226 | 9.0E-08 |
sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 58 | 224 | 9.0E-08 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 475 | 690 | 9.0E-08 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 475 | 690 | 9.0E-08 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 18 | 151 | 1.0E-07 |
sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 68 | 226 | 1.0E-07 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 548 | 700 | 1.0E-07 |
sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 62 | 203 | 1.0E-07 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 70 | 184 | 1.0E-07 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 574 | 691 | 1.0E-07 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 474 | 689 | 1.0E-07 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 57 | 285 | 1.0E-07 |
sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 476 | 692 | 1.0E-07 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 37 | 221 | 1.0E-07 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 69 | 285 | 1.0E-07 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 398 | 691 | 1.0E-07 |
sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 12 | 208 | 1.0E-07 |
sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 12 | 208 | 1.0E-07 |
sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 72 | 230 | 1.0E-07 |
sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 43 | 130 | 1.0E-07 |
sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 17 | 247 | 1.0E-07 |
sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 408 | 649 | 1.0E-07 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 394 | 652 | 1.0E-07 |
sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 35 | 225 | 1.0E-07 |
sp|Q6CXX3|HIR1_KLULA | Protein HIR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIR1 PE=3 SV=1 | 52 | 225 | 1.0E-07 |
sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 43 | 130 | 1.0E-07 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 79 | 241 | 1.0E-07 |
sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 43 | 130 | 1.0E-07 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 55 | 230 | 1.0E-07 |
sp|Q8C0J2|A16L1_MOUSE | Autophagy-related protein 16-1 OS=Mus musculus GN=Atg16l1 PE=1 SV=1 | 479 | 691 | 1.0E-07 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 97 | 288 | 1.0E-07 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 387 | 652 | 1.0E-07 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 475 | 690 | 1.0E-07 |
sp|Q6DH44|WDR83_DANRE | WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1 | 79 | 226 | 1.0E-07 |
sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 446 | 817 | 1.0E-07 |
sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 57 | 227 | 1.0E-07 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 469 | 672 | 2.0E-07 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 469 | 672 | 2.0E-07 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 343 | 557 | 2.0E-07 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 39 | 130 | 2.0E-07 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 96 | 246 | 2.0E-07 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 96 | 246 | 2.0E-07 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 96 | 246 | 2.0E-07 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 96 | 246 | 2.0E-07 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 96 | 246 | 2.0E-07 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 573 | 691 | 2.0E-07 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 70 | 184 | 2.0E-07 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 70 | 184 | 2.0E-07 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 70 | 184 | 2.0E-07 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 70 | 184 | 2.0E-07 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 411 | 612 | 2.0E-07 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 411 | 612 | 2.0E-07 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 360 | 691 | 2.0E-07 |
sp|Q32PJ6|CIAO1_BOVIN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 | 593 | 707 | 2.0E-07 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 67 | 297 | 2.0E-07 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 440 | 691 | 2.0E-07 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 37 | 221 | 2.0E-07 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 37 | 221 | 2.0E-07 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 37 | 221 | 2.0E-07 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 37 | 221 | 2.0E-07 |
sp|P87314|HIR1_SCHPO | Protein hir1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hip1 PE=1 SV=1 | 44 | 226 | 2.0E-07 |
sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 396 | 691 | 2.0E-07 |
sp|O43818|U3IP2_HUMAN | U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1 | 57 | 253 | 2.0E-07 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 382 | 700 | 2.0E-07 |
sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 57 | 293 | 2.0E-07 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 578 | 691 | 2.0E-07 |
sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 396 | 691 | 2.0E-07 |
sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 396 | 691 | 2.0E-07 |
sp|P54319|PLAP_RAT | Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 | 42 | 224 | 2.0E-07 |
sp|P54311|GBB1_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 | 396 | 691 | 2.0E-07 |
sp|P62874|GBB1_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 | 396 | 691 | 2.0E-07 |
sp|P62873|GBB1_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 | 396 | 691 | 2.0E-07 |
sp|P62872|GBB1_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 | 396 | 691 | 2.0E-07 |
sp|P62871|GBB1_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 | 396 | 691 | 2.0E-07 |
sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 57 | 293 | 2.0E-07 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 389 | 691 | 2.0E-07 |
sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 457 | 691 | 2.0E-07 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 93 | 291 | 2.0E-07 |
sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 567 | 702 | 2.0E-07 |
sp|Q6FJZ9|PRP46_CANGA | Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 | 455 | 636 | 2.0E-07 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 93 | 224 | 2.0E-07 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 97 | 230 | 2.0E-07 |
sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 30 | 221 | 2.0E-07 |
sp|P74598|Y1491_SYNY3 | Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 | 460 | 691 | 2.0E-07 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 79 | 241 | 2.0E-07 |
sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 17 | 247 | 2.0E-07 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 97 | 230 | 2.0E-07 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 93 | 224 | 2.0E-07 |
sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 412 | 649 | 2.0E-07 |
sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 39 | 228 | 2.0E-07 |
sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 489 | 691 | 2.0E-07 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 38 | 209 | 3.0E-07 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 469 | 709 | 3.0E-07 |
sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 573 | 691 | 3.0E-07 |
sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 471 | 691 | 3.0E-07 |
sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 35 | 235 | 3.0E-07 |
sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 22 | 235 | 3.0E-07 |
sp|Q99KN2|CIAO1_MOUSE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 | 593 | 707 | 3.0E-07 |
sp|Q5M7T1|CIAO1_RAT | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 | 593 | 707 | 3.0E-07 |
sp|O76071|CIAO1_HUMAN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 | 593 | 707 | 3.0E-07 |
sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 12 | 219 | 3.0E-07 |
sp|B4LJT7|CIAO1_DROVI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 | 96 | 285 | 3.0E-07 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 546 | 691 | 3.0E-07 |
sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 546 | 691 | 3.0E-07 |
sp|Q9Y6I7|WSB1_HUMAN | WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 | 27 | 224 | 3.0E-07 |
sp|Q09150|REC14_SCHPO | Meiotic recombination protein rec14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rec14 PE=3 SV=1 | 37 | 240 | 3.0E-07 |
sp|Q6TMK6|GBB1_CRIGR | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 | 440 | 691 | 3.0E-07 |
sp|Q5R5W8|GBB1_PONAB | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 | 396 | 691 | 3.0E-07 |
sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 57 | 293 | 3.0E-07 |
sp|Q7T2F6|WSB1_DANRE | WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 | 27 | 224 | 3.0E-07 |
sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 58 | 226 | 3.0E-07 |
sp|P42841|PFS2_YEAST | Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 | 57 | 200 | 3.0E-07 |
sp|P42841|PFS2_YEAST | Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 | 447 | 649 | 3.0E-07 |
sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 451 | 690 | 3.0E-07 |
sp|Q6GM65|PLAP_XENLA | Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 | 42 | 224 | 3.0E-07 |
sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 77 | 288 | 3.0E-07 |
sp|P23232|GBB_LOLFO | Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 | 396 | 691 | 3.0E-07 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 79 | 241 | 3.0E-07 |
sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 77 | 288 | 3.0E-07 |
sp|Q5RAC9|A16L1_PONAB | Autophagy-related protein 16-1 OS=Pongo abelii GN=ATG16L1 PE=2 SV=1 | 471 | 691 | 3.0E-07 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 451 | 627 | 3.0E-07 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 398 | 509 | 4.0E-07 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 58 | 235 | 4.0E-07 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 396 | 511 | 4.0E-07 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 548 | 700 | 4.0E-07 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 35 | 235 | 4.0E-07 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 575 | 691 | 4.0E-07 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 37 | 128 | 4.0E-07 |
sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 548 | 691 | 4.0E-07 |
sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 548 | 691 | 4.0E-07 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 78 | 294 | 4.0E-07 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 548 | 691 | 4.0E-07 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 548 | 691 | 4.0E-07 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 548 | 691 | 4.0E-07 |
sp|B6K1G6|CFD1_SCHJY | Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 | 73 | 224 | 4.0E-07 |
sp|P27612|PLAP_MOUSE | Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 | 42 | 224 | 4.0E-07 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 407 | 649 | 4.0E-07 |
sp|Q09150|REC14_SCHPO | Meiotic recombination protein rec14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rec14 PE=3 SV=1 | 30 | 203 | 4.0E-07 |
sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 54 | 226 | 4.0E-07 |
sp|Q91WM3|U3IP2_MOUSE | U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1 | 30 | 224 | 4.0E-07 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 447 | 690 | 4.0E-07 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 574 | 691 | 4.0E-07 |
sp|Q6GM65|PLAP_XENLA | Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 | 57 | 225 | 4.0E-07 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 39 | 224 | 4.0E-07 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 167 | 466 | 4.0E-07 |
sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 408 | 649 | 4.0E-07 |
sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 54 | 228 | 4.0E-07 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 167 | 466 | 4.0E-07 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 79 | 241 | 4.0E-07 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 79 | 241 | 4.0E-07 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 79 | 241 | 4.0E-07 |
sp|Q9DAJ4|WDR83_MOUSE | WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 | 41 | 291 | 4.0E-07 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 398 | 509 | 5.0E-07 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 27 | 160 | 5.0E-07 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 37 | 227 | 5.0E-07 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 37 | 227 | 5.0E-07 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 37 | 227 | 5.0E-07 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 37 | 128 | 5.0E-07 |
sp|O80990|CIA1_ARATH | Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 | 55 | 234 | 5.0E-07 |
sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 58 | 226 | 5.0E-07 |
sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 58 | 226 | 5.0E-07 |
sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 58 | 226 | 5.0E-07 |
sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 58 | 226 | 5.0E-07 |
sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 58 | 226 | 5.0E-07 |
sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 58 | 226 | 5.0E-07 |
sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 58 | 226 | 5.0E-07 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 79 | 241 | 5.0E-07 |
sp|O35353|GBB4_RAT | Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4 | 58 | 224 | 5.0E-07 |
sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 39 | 224 | 6.0E-07 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 27 | 235 | 6.0E-07 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 97 | 469 | 6.0E-07 |
sp|B4KTK4|CIAO1_DROMO | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 | 96 | 285 | 6.0E-07 |
sp|P38011|GBLP_YEAST | Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 | 39 | 226 | 6.0E-07 |
sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 77 | 288 | 6.0E-07 |
sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 77 | 288 | 6.0E-07 |
sp|A0AUS0|WSDU1_DANRE | WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 | 58 | 227 | 6.0E-07 |
sp|Q6P1V3|WSB1_XENTR | WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 | 27 | 224 | 6.0E-07 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 473 | 662 | 6.0E-07 |
sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 57 | 293 | 6.0E-07 |
sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 58 | 226 | 6.0E-07 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 540 | 691 | 6.0E-07 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 96 | 226 | 6.0E-07 |
sp|O43071|PRP17_SCHPO | Pre-mRNA-processing factor 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp17 PE=1 SV=1 | 530 | 691 | 6.0E-07 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 57 | 234 | 7.0E-07 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 37 | 227 | 7.0E-07 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 12 | 250 | 7.0E-07 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 96 | 228 | 7.0E-07 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 96 | 228 | 7.0E-07 |
sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 12 | 208 | 7.0E-07 |
sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 389 | 510 | 7.0E-07 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 377 | 690 | 7.0E-07 |
sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 444 | 695 | 7.0E-07 |
sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 444 | 691 | 7.0E-07 |
sp|Q91WM3|U3IP2_MOUSE | U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1 | 577 | 695 | 7.0E-07 |
sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 17 | 247 | 7.0E-07 |
sp|P74598|Y1491_SYNY3 | Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 | 169 | 512 | 7.0E-07 |
sp|Q9C270|PWP2_NEUCR | Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1 | 384 | 661 | 7.0E-07 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 79 | 241 | 7.0E-07 |
sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 58 | 226 | 7.0E-07 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 30 | 147 | 8.0E-07 |
sp|Q17GR9|CIAO1_AEDAE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 | 57 | 286 | 8.0E-07 |
sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 56 | 247 | 8.0E-07 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 540 | 691 | 8.0E-07 |
sp|B7QKS1|CIAO1_IXOSC | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 | 575 | 698 | 8.0E-07 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 570 | 691 | 8.0E-07 |
sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 446 | 649 | 8.0E-07 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 478 | 690 | 8.0E-07 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 100 | 477 | 8.0E-07 |
sp|P29387|GBB4_MOUSE | Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4 | 58 | 224 | 8.0E-07 |
sp|Q55AR8|SNR40_DICDI | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 | 572 | 691 | 8.0E-07 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 537 | 697 | 9.0E-07 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 537 | 697 | 9.0E-07 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 447 | 632 | 9.0E-07 |
sp|Q7PS24|CIAO1_ANOGA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 | 569 | 707 | 9.0E-07 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 61 | 224 | 9.0E-07 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 24 | 182 | 9.0E-07 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 414 | 671 | 9.0E-07 |
sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 412 | 691 | 9.0E-07 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 540 | 691 | 9.0E-07 |
sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 73 | 297 | 9.0E-07 |
sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 73 | 297 | 9.0E-07 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 469 | 709 | 1.0E-06 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 385 | 686 | 1.0E-06 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 396 | 621 | 1.0E-06 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 70 | 184 | 1.0E-06 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 70 | 184 | 1.0E-06 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 70 | 184 | 1.0E-06 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 70 | 184 | 1.0E-06 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 70 | 184 | 1.0E-06 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 12 | 193 | 1.0E-06 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 442 | 649 | 1.0E-06 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 396 | 606 | 1.0E-06 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 477 | 649 | 1.0E-06 |
sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 447 | 691 | 1.0E-06 |
sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 550 | 691 | 1.0E-06 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 538 | 696 | 1.0E-06 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 389 | 510 | 1.0E-06 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 12 | 252 | 1.0E-06 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 389 | 510 | 1.0E-06 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 567 | 710 | 1.0E-06 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 398 | 510 | 1.0E-06 |
sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 17 | 247 | 1.0E-06 |
sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 17 | 247 | 1.0E-06 |
sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 56 | 268 | 1.0E-06 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 575 | 691 | 1.0E-06 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 392 | 694 | 1.0E-06 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 575 | 691 | 1.0E-06 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 392 | 694 | 1.0E-06 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 575 | 691 | 1.0E-06 |
sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 41 | 224 | 1.0E-06 |
sp|Q6TMK6|GBB1_CRIGR | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 | 57 | 293 | 1.0E-06 |
sp|P41318|LST8_YEAST | Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 | 366 | 608 | 1.0E-06 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 447 | 698 | 1.0E-06 |
sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 58 | 226 | 1.0E-06 |
sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 473 | 649 | 1.0E-06 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 57 | 186 | 1.0E-06 |
sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 476 | 691 | 1.0E-06 |
sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 476 | 691 | 1.0E-06 |
sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 476 | 691 | 1.0E-06 |
sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 412 | 690 | 1.0E-06 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 72 | 230 | 1.0E-06 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 570 | 691 | 1.0E-06 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 440 | 629 | 1.0E-06 |
sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 58 | 226 | 1.0E-06 |
sp|O22785|PR19B_ARATH | Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 | 522 | 691 | 1.0E-06 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 39 | 378 | 1.0E-06 |
sp|P29387|GBB4_MOUSE | Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4 | 57 | 293 | 1.0E-06 |
sp|Q55AR8|SNR40_DICDI | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 | 454 | 649 | 1.0E-06 |
sp|O35353|GBB4_RAT | Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4 | 57 | 293 | 1.0E-06 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 96 | 228 | 2.0E-06 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 39 | 225 | 2.0E-06 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 77 | 225 | 2.0E-06 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 447 | 632 | 2.0E-06 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 77 | 225 | 2.0E-06 |
sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 471 | 691 | 2.0E-06 |
sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 35 | 235 | 2.0E-06 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 62 | 224 | 2.0E-06 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 442 | 649 | 2.0E-06 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 41 | 161 | 2.0E-06 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 577 | 711 | 2.0E-06 |
sp|Q9UTN4|PFS2_SCHPO | Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 | 56 | 224 | 2.0E-06 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 56 | 194 | 2.0E-06 |
sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 53 | 226 | 2.0E-06 |
sp|Q20168|COPB2_CAEEL | Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 | 80 | 236 | 2.0E-06 |
sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 477 | 691 | 2.0E-06 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 389 | 510 | 2.0E-06 |
sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 389 | 510 | 2.0E-06 |
sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 389 | 510 | 2.0E-06 |
sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 389 | 510 | 2.0E-06 |
sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 389 | 510 | 2.0E-06 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 538 | 700 | 2.0E-06 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 396 | 649 | 2.0E-06 |
sp|O35142|COPB2_RAT | Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 | 37 | 221 | 2.0E-06 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 574 | 704 | 2.0E-06 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 392 | 694 | 2.0E-06 |
sp|B5X212|CIO1B_SALSA | Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 | 593 | 707 | 2.0E-06 |
sp|P54311|GBB1_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 | 57 | 293 | 2.0E-06 |
sp|P62874|GBB1_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 | 57 | 293 | 2.0E-06 |
sp|P62873|GBB1_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 | 57 | 293 | 2.0E-06 |
sp|P62872|GBB1_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 | 57 | 293 | 2.0E-06 |
sp|P62871|GBB1_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 | 57 | 293 | 2.0E-06 |
sp|Q5R5W8|GBB1_PONAB | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 | 57 | 293 | 2.0E-06 |
sp|P41318|LST8_YEAST | Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 | 496 | 691 | 2.0E-06 |
sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 457 | 691 | 2.0E-06 |
sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 457 | 691 | 2.0E-06 |
sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 457 | 691 | 2.0E-06 |
sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 457 | 691 | 2.0E-06 |
sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 457 | 691 | 2.0E-06 |
sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 457 | 691 | 2.0E-06 |
sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 457 | 691 | 2.0E-06 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 562 | 691 | 2.0E-06 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 473 | 707 | 2.0E-06 |
sp|Q6FJZ9|PRP46_CANGA | Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 | 39 | 221 | 2.0E-06 |
sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 476 | 691 | 2.0E-06 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 476 | 691 | 2.0E-06 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 476 | 691 | 2.0E-06 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 396 | 690 | 2.0E-06 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 96 | 225 | 2.0E-06 |
sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 56 | 224 | 2.0E-06 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 558 | 691 | 2.0E-06 |
sp|Q6DH44|WDR83_DANRE | WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1 | 582 | 710 | 2.0E-06 |
sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 57 | 230 | 2.0E-06 |
sp|Q0J3D9|COPA3_ORYSJ | Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 | 446 | 691 | 2.0E-06 |
sp|Q9DAJ4|WDR83_MOUSE | WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 | 582 | 704 | 2.0E-06 |
sp|Q9W328|LST8_DROME | Protein LST8 homolog OS=Drosophila melanogaster GN=Lst8 PE=2 SV=2 | 411 | 670 | 2.0E-06 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 582 | 704 | 2.0E-06 |
sp|P0CS47|PFS2_CRYNB | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 | 491 | 691 | 2.0E-06 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 100 | 468 | 3.0E-06 |
sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 100 | 285 | 3.0E-06 |
sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 100 | 285 | 3.0E-06 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 538 | 691 | 3.0E-06 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 447 | 632 | 3.0E-06 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 39 | 225 | 3.0E-06 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 155 | 295 | 3.0E-06 |
sp|A7RWD2|CIAO1_NEMVE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 | 56 | 233 | 3.0E-06 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 41 | 162 | 3.0E-06 |
sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 12 | 208 | 3.0E-06 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 39 | 128 | 3.0E-06 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 542 | 691 | 3.0E-06 |
sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 476 | 691 | 3.0E-06 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 444 | 691 | 3.0E-06 |
sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 476 | 691 | 3.0E-06 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 95 | 224 | 3.0E-06 |
sp|O48847|LUH_ARATH | Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana GN=LUH PE=1 SV=1 | 16 | 286 | 3.0E-06 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 95 | 246 | 3.0E-06 |
sp|Q9W5Z5|WSB1_TAKRU | WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 | 27 | 224 | 3.0E-06 |
sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 24 | 293 | 3.0E-06 |
sp|Q6FJZ9|PRP46_CANGA | Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 | 548 | 691 | 3.0E-06 |
sp|P20053|PRP4_YEAST | U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 | 53 | 285 | 3.0E-06 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 95 | 224 | 3.0E-06 |
sp|Q9NYS7|WSB2_HUMAN | WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 | 27 | 224 | 3.0E-06 |
sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 449 | 727 | 3.0E-06 |
sp|Q6NLV4|FY_ARATH | Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 | 81 | 226 | 3.0E-06 |
sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 488 | 691 | 3.0E-06 |
sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 412 | 648 | 3.0E-06 |
sp|Q9AUR8|COPA1_ORYSJ | Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 | 446 | 691 | 3.0E-06 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 7 | 218 | 3.0E-06 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 39 | 228 | 4.0E-06 |
sp|B4GDM7|CIAO1_DROPE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 | 96 | 285 | 4.0E-06 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 56 | 194 | 4.0E-06 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 449 | 770 | 4.0E-06 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 449 | 730 | 4.0E-06 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 552 | 691 | 4.0E-06 |
sp|O43818|U3IP2_HUMAN | U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1 | 470 | 725 | 4.0E-06 |
sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 477 | 691 | 4.0E-06 |
sp|P79959|GBB1_XENLA | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 | 57 | 293 | 4.0E-06 |
sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 578 | 691 | 4.0E-06 |
sp|Q0V8J1|WSB2_BOVIN | WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 | 27 | 224 | 4.0E-06 |
sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 57 | 226 | 4.0E-06 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 37 | 224 | 4.0E-06 |
sp|Q9AUR7|COPA2_ORYSJ | Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 | 446 | 691 | 4.0E-06 |
sp|O35353|GBB4_RAT | Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4 | 440 | 691 | 4.0E-06 |
sp|P0CS47|PFS2_CRYNB | Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 | 447 | 666 | 4.0E-06 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 155 | 288 | 5.0E-06 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 155 | 288 | 5.0E-06 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 37 | 227 | 5.0E-06 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 39 | 203 | 5.0E-06 |
sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 540 | 691 | 5.0E-06 |
sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 540 | 691 | 5.0E-06 |
sp|Q292E8|CIAO1_DROPS | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 | 96 | 285 | 5.0E-06 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 449 | 730 | 5.0E-06 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 449 | 730 | 5.0E-06 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 449 | 730 | 5.0E-06 |
sp|Q17GR9|CIAO1_AEDAE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 | 569 | 695 | 5.0E-06 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 537 | 691 | 5.0E-06 |
sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 444 | 695 | 5.0E-06 |
sp|A8Q2R5|WDR48_BRUMA | WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 | 454 | 645 | 5.0E-06 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 39 | 218 | 5.0E-06 |
sp|O62621|COPB2_DROME | Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 | 57 | 221 | 5.0E-06 |
sp|Q55FR9|COPA_DICDI | Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 | 41 | 300 | 5.0E-06 |
sp|P29387|GBB4_MOUSE | Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4 | 440 | 691 | 5.0E-06 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 90 | 228 | 6.0E-06 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 62 | 226 | 6.0E-06 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 396 | 511 | 6.0E-06 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 39 | 151 | 6.0E-06 |
sp|Q5M7T1|CIAO1_RAT | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 | 57 | 225 | 6.0E-06 |
sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 540 | 691 | 6.0E-06 |
sp|O76071|CIAO1_HUMAN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 | 57 | 225 | 6.0E-06 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 395 | 513 | 6.0E-06 |
sp|Q32PJ6|CIAO1_BOVIN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 | 57 | 225 | 6.0E-06 |
sp|B4QFZ8|CIAO1_DROSI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 | 96 | 285 | 6.0E-06 |
sp|Q7K1Y4|CIAO1_DROME | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 | 96 | 285 | 6.0E-06 |
sp|B4MY77|CIAO1_DROWI | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 | 96 | 285 | 6.0E-06 |
sp|Q7PS24|CIAO1_ANOGA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 | 56 | 286 | 6.0E-06 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 396 | 691 | 6.0E-06 |
sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 473 | 691 | 6.0E-06 |
sp|Q6FJS0|PFS2_CANGA | Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 | 57 | 200 | 6.0E-06 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 35 | 235 | 7.0E-06 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 538 | 691 | 7.0E-06 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 538 | 691 | 7.0E-06 |
sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 538 | 691 | 7.0E-06 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 39 | 128 | 7.0E-06 |
sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 540 | 691 | 7.0E-06 |
sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 443 | 691 | 7.0E-06 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 389 | 510 | 7.0E-06 |
sp|B4HRQ6|CIAO1_DROSE | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 | 96 | 285 | 7.0E-06 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 374 | 606 | 7.0E-06 |
sp|A8Q2R5|WDR48_BRUMA | WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 | 594 | 691 | 7.0E-06 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 41 | 291 | 7.0E-06 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 39 | 214 | 8.0E-06 |
sp|Q99KN2|CIAO1_MOUSE | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 | 57 | 225 | 8.0E-06 |
sp|B3NQR5|CIAO1_DROER | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 | 96 | 285 | 8.0E-06 |
sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 57 | 293 | 8.0E-06 |
sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 57 | 293 | 8.0E-06 |
sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 57 | 293 | 8.0E-06 |
sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 57 | 293 | 8.0E-06 |
sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 374 | 606 | 8.0E-06 |
sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 374 | 606 | 8.0E-06 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 97 | 239 | 8.0E-06 |
sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 50 | 200 | 8.0E-06 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 394 | 509 | 9.0E-06 |
sp|Q32PJ6|CIAO1_BOVIN | Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 | 68 | 286 | 9.0E-06 |
sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 374 | 606 | 9.0E-06 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 374 | 606 | 9.0E-06 |
sp|P36408|GBB_DICDI | Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 | 33 | 229 | 9.0E-06 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 97 | 230 | 9.0E-06 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 97 | 230 | 9.0E-06 |
sp|B3MC74|CIAO1_DROAN | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 | 96 | 285 | 1.0E-05 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 548 | 691 | 1.0E-05 |
GO Term | Description | Terminal node |
---|---|---|
GO:0005515 | protein binding | Yes |
GO:0003674 | molecular_function | No |
GO:0005488 | binding | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 25 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Agabi119p4|073870 MVQSYLRHGPTQAFGLVCSASSNAVFNGKLAYVPALEDVLVWDVKKGAMLSMWHETGHRAEVTCIQPSPQSDVFA VGYADGSIRLWNASSGSVLTTFNGHKKSITTLAFDERGTRLASGSQDTDLIIWDVVGETGLYRLRGHRDQITNIR FLPSSSDLPSTSTSTAPGYLLTSGKDTFVKFWDLSTQHCVQTIVAHRSEVWSLDVSKDQELLFTGSGEGEVKAWR IDSEALSTGLRETDNGEVVKFIHAIASLPLASRHRVSQISFHPTQAYVSILSHDRSVEVFRIRTEEEIRKKMARR KKRAQEKKKLGKLTEEKEEEGDPEITLVDMFTPHLVVRASGKIRSFDYGADEKTVKAEFQLFIALNTNAFEVYTV PPPTKSKEELPVATRLYSVDLPGHRTDVRSLCLSSDDQILASTSNGSLKVWNMKTTSCIRTMDCGYGVCSTFLPG DKHVAVGTKDGEILIYDVASSTLVETIKAHTATVWSLHVRPDERGLVSGGADKDVKFWEFESKVATSDSVQSGKI LSLVHIRTLKMTDEVLSVRYSPNGRFLAVALLDSTVKVFYQDTLKFFLSLYGHKLPVLAMDISHDSKLIVTCSAD KNVKIWGLDFGDCHKSIFAHDDSIMQVAFEKDSHYFWTVGKDKMLKYWDGDKFEGIQKLDGHHGEIWALAVSHYG NFVVTGSQDKSIRVYEKLDEPLFLEEERERELEQLYEAGIAETMNREDVAMDIDAEENSGHTQSAEVTAVSKQTT ETLMAGERIMEALELADNERDKFREYEEAMAKLSEDDPMKMQPPPKNPVLAAYNLEPEEHVLRVIEKVPSTALHD ALLVLPFGKVVSLMHYLNAWVQKGWNIPLVSQIMFFLLKVHHRQIVANRIMRTTLIPFRKHLRAALQQQKEMMGY NLAALQYMKRKNEGERVAHFYEEEDWDEDRVRARIMEGKKRKRVTLQT* |
Coding | >Agabi119p4|073870 ATGGTGCAGAGCTATCTGAGGCACGGACCCACACAGGCCTTTGGTCTGGTGTGCAGCGCATCTTCTAATGCGGTC TTTAACGGAAAATTGGCATACGTTCCTGCTCTCGAAGATGTACTTGTATGGGACGTAAAAAAGGGGGCTATGCTT TCCATGTGGCACGAGACGGGTCATCGTGCCGAAGTGACCTGCATCCAACCGTCTCCTCAATCCGATGTCTTTGCG GTTGGATATGCCGATGGTTCCATACGTCTGTGGAATGCATCATCCGGCTCAGTATTGACAACTTTCAATGGACAC AAAAAATCCATCACTACGTTGGCTTTCGACGAACGAGGAACACGACTCGCATCAGGTTCTCAAGACACAGATCTC ATTATATGGGATGTCGTTGGAGAGACTGGCCTATATAGGTTGCGAGGACACCGTGATCAGATTACAAATATTCGG TTTCTTCCATCTTCTAGTGACCTCCCTTCGACCTCGACTTCGACCGCTCCAGGTTATCTGTTAACGTCTGGGAAA GACACTTTCGTTAAATTTTGGGACCTTTCCACTCAGCATTGCGTTCAAACGATTGTGGCCCACCGGTCCGAAGTA TGGTCTCTGGACGTCAGCAAAGACCAAGAGCTCTTATTTACTGGTAGCGGAGAAGGAGAGGTAAAGGCATGGAGA ATTGACTCGGAAGCTCTTTCTACAGGATTGCGGGAGACCGATAATGGAGAAGTTGTTAAATTTATCCATGCCATT GCCAGCCTTCCTCTTGCTTCGCGGCATCGCGTCTCTCAAATTTCTTTCCATCCTACGCAAGCCTATGTTTCTATT CTGTCTCATGATCGATCAGTAGAAGTATTCAGAATACGAACGGAAGAAGAAATCAGGAAAAAAATGGCTCGCCGA AAGAAGCGAGCTCAGGAGAAAAAAAAACTTGGTAAGCTTACCGAAGAAAAGGAGGAAGAAGGTGACCCAGAGATC ACATTGGTCGATATGTTTACTCCGCACCTTGTCGTCCGTGCCAGCGGGAAGATCAGATCCTTCGATTATGGTGCC GATGAAAAAACTGTTAAAGCAGAGTTCCAGCTGTTTATTGCGCTAAATACCAATGCCTTTGAAGTATATACCGTA CCGCCACCCACTAAATCAAAAGAAGAGCTGCCTGTAGCAACCCGTCTATATAGCGTTGACCTACCAGGACACAGA ACGGATGTGCGGTCCCTTTGTCTCAGCTCGGATGATCAGATACTTGCATCAACATCGAATGGTTCGCTCAAGGTA TGGAACATGAAGACTACGTCCTGCATCCGGACGATGGATTGTGGATATGGTGTCTGCAGTACTTTCCTACCCGGA GATAAGCATGTTGCTGTTGGGACGAAAGACGGAGAAATTCTCATCTATGATGTAGCTTCATCTACTCTCGTTGAA ACGATCAAAGCACACACGGCTACAGTCTGGTCGCTGCATGTTCGCCCTGATGAACGGGGACTTGTCAGCGGTGGT GCCGATAAAGATGTCAAATTTTGGGAATTTGAGTCCAAAGTTGCCACGAGTGATAGTGTCCAGAGCGGAAAAATT CTTTCACTTGTGCACATCCGAACGCTGAAAATGACAGACGAGGTGTTGTCTGTACGCTATAGTCCAAACGGGAGG TTCCTTGCTGTGGCTCTTTTAGATTCGACAGTAAAAGTATTCTACCAAGATACACTCAAGTTCTTCTTATCATTA TACGGTCATAAACTGCCTGTTTTAGCGATGGATATATCGCATGATTCAAAACTCATTGTAACTTGTTCAGCTGAT AAGAACGTCAAGATCTGGGGTCTAGATTTTGGCGACTGCCATAAGTCGATTTTCGCTCATGACGACAGTATAATG CAAGTCGCTTTCGAAAAGGATTCGCATTACTTTTGGACAGTGGGCAAGGATAAAATGTTGAAGTACTGGGATGGT GACAAGTTCGAGGGGATACAAAAACTGGATGGGCATCATGGTGAAATTTGGGCACTTGCTGTCAGCCACTATGGC AATTTTGTTGTTACTGGATCTCAAGACAAGTCAATACGAGTTTACGAGAAACTTGACGAGCCACTCTTTTTGGAA GAAGAGCGCGAACGCGAGCTCGAACAGCTTTATGAGGCCGGTATTGCAGAAACAATGAATCGTGAAGATGTGGCC ATGGACATTGACGCAGAAGAAAACTCGGGGCATACTCAAAGCGCAGAGGTCACCGCAGTCTCCAAGCAAACCACA GAGACATTAATGGCCGGAGAACGGATCATGGAAGCCCTGGAACTCGCAGATAATGAACGTGACAAGTTCCGTGAA TACGAGGAGGCCATGGCCAAGTTGTCGGAGGACGACCCTATGAAAATGCAGCCACCACCAAAAAACCCGGTCCTT GCTGCATACAACCTGGAGCCTGAGGAGCATGTTTTACGCGTAATCGAAAAGGTGCCGAGTACTGCCCTTCACGAC GCTCTTTTGGTTCTCCCCTTTGGAAAAGTTGTTTCGTTAATGCATTATCTCAATGCATGGGTGCAAAAGGGCTGG AACATACCCTTGGTATCTCAAATCATGTTTTTCCTTTTGAAGGTTCACCACCGTCAAATTGTGGCGAATCGCATC ATGAGAACTACTCTCATCCCGTTCCGTAAACATCTCCGAGCCGCACTGCAACAGCAGAAGGAAATGATGGGATAT AATCTTGCAGCCTTGCAGTATATGAAACGCAAGAACGAAGGCGAAAGGGTGGCCCACTTTTACGAAGAGGAAGAT TGGGACGAAGACAGGGTTCGTGCCCGCATAATGGAAGGCAAGAAACGCAAACGGGTCACGCTCCAAACGTAG |
Transcript | >Agabi119p4|073870 ATGGTGCAGAGCTATCTGAGGCACGGACCCACACAGGCCTTTGGTCTGGTGTGCAGCGCATCTTCTAATGCGGTC TTTAACGGAAAATTGGCATACGTTCCTGCTCTCGAAGATGTACTTGTATGGGACGTAAAAAAGGGGGCTATGCTT TCCATGTGGCACGAGACGGGTCATCGTGCCGAAGTGACCTGCATCCAACCGTCTCCTCAATCCGATGTCTTTGCG GTTGGATATGCCGATGGTTCCATACGTCTGTGGAATGCATCATCCGGCTCAGTATTGACAACTTTCAATGGACAC AAAAAATCCATCACTACGTTGGCTTTCGACGAACGAGGAACACGACTCGCATCAGGTTCTCAAGACACAGATCTC ATTATATGGGATGTCGTTGGAGAGACTGGCCTATATAGGTTGCGAGGACACCGTGATCAGATTACAAATATTCGG TTTCTTCCATCTTCTAGTGACCTCCCTTCGACCTCGACTTCGACCGCTCCAGGTTATCTGTTAACGTCTGGGAAA GACACTTTCGTTAAATTTTGGGACCTTTCCACTCAGCATTGCGTTCAAACGATTGTGGCCCACCGGTCCGAAGTA TGGTCTCTGGACGTCAGCAAAGACCAAGAGCTCTTATTTACTGGTAGCGGAGAAGGAGAGGTAAAGGCATGGAGA ATTGACTCGGAAGCTCTTTCTACAGGATTGCGGGAGACCGATAATGGAGAAGTTGTTAAATTTATCCATGCCATT GCCAGCCTTCCTCTTGCTTCGCGGCATCGCGTCTCTCAAATTTCTTTCCATCCTACGCAAGCCTATGTTTCTATT CTGTCTCATGATCGATCAGTAGAAGTATTCAGAATACGAACGGAAGAAGAAATCAGGAAAAAAATGGCTCGCCGA AAGAAGCGAGCTCAGGAGAAAAAAAAACTTGGTAAGCTTACCGAAGAAAAGGAGGAAGAAGGTGACCCAGAGATC ACATTGGTCGATATGTTTACTCCGCACCTTGTCGTCCGTGCCAGCGGGAAGATCAGATCCTTCGATTATGGTGCC GATGAAAAAACTGTTAAAGCAGAGTTCCAGCTGTTTATTGCGCTAAATACCAATGCCTTTGAAGTATATACCGTA CCGCCACCCACTAAATCAAAAGAAGAGCTGCCTGTAGCAACCCGTCTATATAGCGTTGACCTACCAGGACACAGA ACGGATGTGCGGTCCCTTTGTCTCAGCTCGGATGATCAGATACTTGCATCAACATCGAATGGTTCGCTCAAGGTA TGGAACATGAAGACTACGTCCTGCATCCGGACGATGGATTGTGGATATGGTGTCTGCAGTACTTTCCTACCCGGA GATAAGCATGTTGCTGTTGGGACGAAAGACGGAGAAATTCTCATCTATGATGTAGCTTCATCTACTCTCGTTGAA ACGATCAAAGCACACACGGCTACAGTCTGGTCGCTGCATGTTCGCCCTGATGAACGGGGACTTGTCAGCGGTGGT GCCGATAAAGATGTCAAATTTTGGGAATTTGAGTCCAAAGTTGCCACGAGTGATAGTGTCCAGAGCGGAAAAATT CTTTCACTTGTGCACATCCGAACGCTGAAAATGACAGACGAGGTGTTGTCTGTACGCTATAGTCCAAACGGGAGG TTCCTTGCTGTGGCTCTTTTAGATTCGACAGTAAAAGTATTCTACCAAGATACACTCAAGTTCTTCTTATCATTA TACGGTCATAAACTGCCTGTTTTAGCGATGGATATATCGCATGATTCAAAACTCATTGTAACTTGTTCAGCTGAT AAGAACGTCAAGATCTGGGGTCTAGATTTTGGCGACTGCCATAAGTCGATTTTCGCTCATGACGACAGTATAATG CAAGTCGCTTTCGAAAAGGATTCGCATTACTTTTGGACAGTGGGCAAGGATAAAATGTTGAAGTACTGGGATGGT GACAAGTTCGAGGGGATACAAAAACTGGATGGGCATCATGGTGAAATTTGGGCACTTGCTGTCAGCCACTATGGC AATTTTGTTGTTACTGGATCTCAAGACAAGTCAATACGAGTTTACGAGAAACTTGACGAGCCACTCTTTTTGGAA GAAGAGCGCGAACGCGAGCTCGAACAGCTTTATGAGGCCGGTATTGCAGAAACAATGAATCGTGAAGATGTGGCC ATGGACATTGACGCAGAAGAAAACTCGGGGCATACTCAAAGCGCAGAGGTCACCGCAGTCTCCAAGCAAACCACA GAGACATTAATGGCCGGAGAACGGATCATGGAAGCCCTGGAACTCGCAGATAATGAACGTGACAAGTTCCGTGAA TACGAGGAGGCCATGGCCAAGTTGTCGGAGGACGACCCTATGAAAATGCAGCCACCACCAAAAAACCCGGTCCTT GCTGCATACAACCTGGAGCCTGAGGAGCATGTTTTACGCGTAATCGAAAAGGTGCCGAGTACTGCCCTTCACGAC GCTCTTTTGGTTCTCCCCTTTGGAAAAGTTGTTTCGTTAATGCATTATCTCAATGCATGGGTGCAAAAGGGCTGG AACATACCCTTGGTATCTCAAATCATGTTTTTCCTTTTGAAGGTTCACCACCGTCAAATTGTGGCGAATCGCATC ATGAGAACTACTCTCATCCCGTTCCGTAAACATCTCCGAGCCGCACTGCAACAGCAGAAGGAAATGATGGGATAT AATCTTGCAGCCTTGCAGTATATGAAACGCAAGAACGAAGGCGAAAGGGTGGCCCACTTTTACGAAGAGGAAGAT TGGGACGAAGACAGGGTTCGTGCCCGCATAATGGAAGGCAAGAAACGCAAACGGGTCACGCTCCAAACGTAG |
Gene | >Agabi119p4|073870 ATGGTGCAGAGCTATCTGAGGCACGGACCCACACAGGTACAGACAACGCCCTTACATCCGTATATCTTCTGTGCT TATATCTATCGAGGCCTTTGGTCTGGTGTGCAGCGCATCTTCTAATGCGGTCTTTAACGGAAAATTGGCATACGT TCCTGCTCTCGAAGATGTACTTGTATGGGACGTAAAAAAGGGGGCTATGGTGAGGGCGGGTATTCTCTTGTCGTA CGGATGGCTGAATATTGCAGCTTTCCATGTGGCACGAGACGGGTCATCGTGCCGAAGTGACCTGCATCCAACCGT CTCCTCAATCCGATGTCTTTGCGGTTGGATATGCCGATGGTTCCATACGTCTGTGGAATGCATCATCCGGCTCAG TATTGACAACTTTCAATGGACACAAAAAATCCATCACTACGTTGGCTTTCGACGAACGAGGAACACGACTCGCAT CAGGTTCTCAAGACACAGATCTCATTATATGGGATGTCGTTGGAGAGACTGGCCTATATAGGTAAGTTTGCTGCT GCCTATAGTTGTCTATACATCGATCTGACTGTCTTAAGGTTGCGAGGACACCGTGATCAGATTACAAATATTCGG TTTCTTCCATCTTCTAGTGACCTCCCTTCGACCTCGACTTCGACCGCTCCAGGTTATCTGTTAACGTCTGGGAAA GACACTTTCGTTAAATTTTGGGACCTTTCCACTCAGCATTGCGTTCAAACGATTGTGGCCCACCGGTCCGAAGTA TGGTCTCTGGACGTCAGCAAAGACCAAGAGCTCTTATTTACTGGTAGCGGAGAAGGAGAGGTAAAGGCATGGAGA ATTGACTCGGAAGCTCTTTCTACAGGATTGCGGGAGACCGATAATGGAGAAGTATGTTACTCCCCATTATAGTTT TTCAATGGATTCCTGATTCTAGGCGACAGGTTGTTAAATTTATCCATGCCATTGCCAGCCTTCCTCTTGCTTCGC GGCATCGCGTCTCTCAAATTTCTTTCCATCCTACGCAAGCCTATGTTTCTATTCTGTCTCATGATCGATCAGTAG AAGTATTCAGAATACGAACGGAAGAAGAAATCAGGAAAAAAATGGCTCGCCGAAAGAAGCGAGCTCAGGAGAAAA AAAAACTTGGTAAGCTTACCGAAGAAAAGGAGGAAGAAGGTGACCCAGAGATCACATTGGTCGATATGTTTACTC CGCACCTTGTCGTCCGTGCCAGCGGGAAGATCAGATCCTTCGATTATGGTGCCGATGAAAAAACTGTTAAAGCAG AGTTCCAGGTATTTTAATTCATTAATTCTCGCGTCATATAGTGTTAAGTTGACATGCATATCAGCTGTTTATTGC GCTAAATACCAATGCCTTTGAAGTATATACCGTACCGCCACCCACTAAATCAAAAGAAGAGCTGCCTGTAGCAAC CCGTCTATATAGCGTTGACCTACCAGGACACAGAACGGATGTGCGGTCCCTTTGTCTCAGCTCGGATGATCAGAT ACTTGCATCAACATCGAATGGTTCGCTCAAGGTATGGAACATGAAGACTACGTCCTGCATCCGGACGATGGATTG TGGATATGGTGTCTGCAGTACTTTCCTACCCGGAGATAAGCATGTATGTCGTGTCACTTGTCCTCGTTATCTGTT CTGATGAATCTAGGTTGCTGTTGGGACGAAAGACGGAGAAATTCTCATCTATGATGTAGCTTCATCTACTCTCGT TGAAACGATCAAAGCACACACGGCTACAGTCTGGTCGCTGCATGTTCGCCCTGATGAACGGGGACTTGTCAGCGG TGGTGCCGATAAAGATGTCAAATTTTGGGAATTTGAGTCCAAAGTTGCCACGAGTGATAGTGTGAGCAAATTATC TCCTTCAGAGTTCTAAAATATCGAAGCTTACCTAAATCATATAGGTCCAGAGCGGAAAAATTCTTTCACTTGTGC ACATCCGAACGCTGAAAATGACAGACGAGGTGTTGTCTGTACGCTATAGTCCAAACGGGAGGTTCCTTGCTGTGG CTCTTTTAGATTCGACAGTAAAAGTATTCTACCAAGATACACTCAAGTTCTTCTTATCATTATACGGTCATAAAG TAAGTCTTATTCTATTTCATGACTTTACATATACAAACCCAATCATTCATAGCTGCCTGTTTTAGCGATGGATAT ATCGCATGATTCAAAACTCATTGTAACTTGTTCAGCTGATAAGAACGTCAAGATCTGGGGTCTAGATTTTGGCGA CTGCCATAAGTCGATTTTCGCTCATGACGACAGTATAATGCAAGTCGCTTTCGAAAAGGATTCGCATTACTTTTG GACAGTGGGCAAGGATAAAATGTTGAAGTACTGGGATGGTGACAAGGTAAACAGCCCGTTGTTACTTTGGAACAG AACGTAACTCATTTAATGCAGTTCGAGGGGATACAAAAACTGGATGGGCATCATGGTGAAATTTGGGCACTTGCT GTCAGCCACTATGGCAATTTTGTTGTTACTGGATCTCAAGACAAGTCAATACGAGTTTACGAGAAACTTGACGAG CCAGTAAGTATTCTTTTCAAAAGCGCCTTGAAAATTACTCACTCATGTGAAATAGCTCTTTTTGGAAGAAGAGCG CGAACGCGAGCTCGAACAGCTTTATGAGGCCGGTATTGCAGAAACAATGAATCGTGAAGATGTGGCCATGGACAT TGACGCAGAAGAAAACTCGGGGCATACTCAAAGCGCAGAGGTCACCGCAGTCTCCAAGCAAACCACAGAGACATT AATGGCCGGAGAACGGATCATGGAAGCCCTGGAACTCGCAGATAATGAACGTGACAAGTTCCGTGAATACGAGGA GGCCATGGCCAAGTTGTCGGAGGACGACCCTATGAAAATGCAGCCACCACCAAAAAACCCGGTCCTTGCTGCATA CAACCTGGAGCCTGAGGAGCATGTTTTACGCGTAATCGAAAAGGTGCCGAGTACTGCCCTTCACGACGCTCTTTT GGTTCTCCCCTTTGGAAAAGTTGTTTCGTTAATGCATTATCTCAATGCATGGGTGCAAAAGGTGCGGCTGCCCAC TCTTCTCAGGAGGAATTTACTCTTATTTGACCGCATACATCTAGGGCTGGAACATACCCTTGGTATCTCAAATCA TGTTTTTCCTTTTGAAGGTTCACCACCGTCAAATTGTGGCGAATCGCATCATGAGAACTACTCTCATCCCGTTCC GTAAACATCTCCGAGCCGCACTGCAACAGCAGAAGGAAATGATGGGATATAATCTTGCAGCCTTGCAGTATATGA AACGCAAGAACGAAGGCGAAAGGGTGGCCCACTTTTACGAAGAGGAAGATTGGGACGAAGACAGGGTTCGTGCCC GCATAATGGAAGGCAAGAAACGCAAACGGGTCACGCTCCAAACGTAG |