Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|073670
Gene name
Locationscaffold_04:1877451..1880975
Strand-
Gene length (bp)3524
Transcript length (bp)2625
Coding sequence length (bp)2625
Protein length (aa) 875

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01532 Glyco_hydro_47 Glycosyl hydrolase family 47 5.5E-115 54 488
PF02225 PA PA domain 2.1E-05 722 777

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94726|MNL1_SCHPO ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnl1 PE=3 SV=2 37 569 6.0E-161
sp|Q92611|EDEM1_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens GN=EDEM1 PE=1 SV=1 34 492 8.0E-142
sp|Q925U4|EDEM1_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus GN=Edem1 PE=1 SV=1 34 491 6.0E-141
sp|Q9SXC9|MNS5_ARATH Probable alpha-mannosidase I MNS5 OS=Arabidopsis thaliana GN=MNS5 PE=2 SV=1 42 485 1.0E-120
sp|Q9FG93|MNS4_ARATH Probable alpha-mannosidase I MNS4 OS=Arabidopsis thaliana GN=MNS4 PE=2 SV=1 40 547 1.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94726|MNL1_SCHPO ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnl1 PE=3 SV=2 37 569 6.0E-161
sp|Q92611|EDEM1_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens GN=EDEM1 PE=1 SV=1 34 492 8.0E-142
sp|Q925U4|EDEM1_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus GN=Edem1 PE=1 SV=1 34 491 6.0E-141
sp|Q9SXC9|MNS5_ARATH Probable alpha-mannosidase I MNS5 OS=Arabidopsis thaliana GN=MNS5 PE=2 SV=1 42 485 1.0E-120
sp|Q9FG93|MNS4_ARATH Probable alpha-mannosidase I MNS4 OS=Arabidopsis thaliana GN=MNS4 PE=2 SV=1 40 547 1.0E-120
sp|Q6GQB9|EDEM3_XENLA ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis GN=edem3 PE=2 SV=2 36 501 6.0E-120
sp|Q9BV94|EDEM2_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens GN=EDEM2 PE=1 SV=2 47 498 5.0E-119
sp|Q9BZQ6|EDEM3_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Homo sapiens GN=EDEM3 PE=1 SV=2 2 489 7.0E-113
sp|Q2HXL6|EDEM3_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Mus musculus GN=Edem3 PE=1 SV=2 30 489 5.0E-112
sp|P38888|MNL1_YEAST ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNL1 PE=1 SV=1 37 491 2.0E-105
sp|Q9UKM7|MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens GN=MAN1B1 PE=1 SV=2 32 489 3.0E-50
sp|Q9C512|MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana GN=MNS1 PE=1 SV=1 47 489 9.0E-50
sp|Q8H116|MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana GN=MNS2 PE=1 SV=1 48 493 3.0E-49
sp|O60476|MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens GN=MAN1A2 PE=1 SV=1 47 489 2.0E-47
sp|P39098|MA1A2_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus GN=Man1a2 PE=1 SV=1 47 489 2.0E-46
sp|P45700|MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus GN=Man1a1 PE=1 SV=1 47 502 2.0E-46
sp|P33908|MA1A1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Homo sapiens GN=MAN1A1 PE=1 SV=3 47 489 4.0E-46
sp|O02773|MA1A1_PIG Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Sus scrofa GN=MAN1A1 PE=1 SV=1 47 502 4.0E-46
sp|B2GUY0|MA1B1_RAT Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus GN=Man1b1 PE=2 SV=2 52 489 1.0E-45
sp|A2AJ15|MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus GN=Man1b1 PE=1 SV=1 52 489 5.0E-45
sp|P45701|MA1A1_RABIT Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (Fragment) OS=Oryctolagus cuniculus GN=MAN1A1 PE=1 SV=1 47 489 2.0E-44
sp|Q9NR34|MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens GN=MAN1C1 PE=1 SV=1 40 487 1.0E-43
sp|P53624|MA1A1_DROME Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster GN=alpha-Man-Ia PE=1 SV=2 47 490 5.0E-42
sp|Q18788|MAN12_CAEEL Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 OS=Caenorhabditis elegans GN=C52E4.5 PE=1 SV=1 47 485 1.0E-36
sp|E9CXX8|MNS1B_COCPS Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_02648 PE=1 SV=1 1 485 4.0E-33
sp|Q0D076|MNS1B_ASPTN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mns1B PE=3 SV=1 30 485 2.0E-32
sp|P31723|MAN12_PENCI Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum GN=MSDC PE=1 SV=2 40 492 2.0E-32
sp|Q2ULB2|MNS1B_ASPOR Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mns1B PE=1 SV=1 51 485 4.0E-32
sp|B8N417|MNS1B_ASPFN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mns1B PE=3 SV=2 51 485 4.0E-32
sp|A2QAS2|MNS1B_ASPNC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mns1B PE=3 SV=1 33 485 7.0E-32
sp|D4AV26|MNS1B_ARTBC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00035 PE=1 SV=1 51 485 1.0E-31
sp|Q12563|MNS1B_ASPPH Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis GN=mns1B PE=2 SV=1 33 485 1.0E-31
sp|Q5BF93|MNS1B_EMENI Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mns1B PE=2 SV=2 51 485 2.0E-30
sp|Q8J0Q0|MNS1_CANAX Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans GN=MNS1 PE=3 SV=2 102 485 7.0E-30
sp|Q9P7C3|MNS1_SCHPO Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P5.01c PE=1 SV=2 51 485 4.0E-29
sp|Q4WRZ5|MNS1B_ASPFU Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mns1B PE=3 SV=1 51 463 7.0E-29
sp|B0XMT4|MNS1B_ASPFC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mns1B PE=3 SV=1 51 463 7.0E-29
sp|A1D1W1|MNS1B_NEOFI Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mns1B PE=3 SV=1 43 463 8.0E-29
sp|Q93Y37|MNS3_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana GN=MNS3 PE=2 SV=1 43 492 1.0E-27
sp|A1CP08|MNS1B_ASPCL Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mns1B PE=3 SV=1 51 493 2.0E-25
sp|P32906|MNS1_YEAST Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNS1 PE=1 SV=1 102 485 5.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0004571 mannosyl-oligosaccharide 1,2-alpha-mannosidase activity Yes
GO:0016020 membrane Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0016787 hydrolase activity No
GO:0004559 alpha-mannosidase activity No
GO:0015924 mannosyl-oligosaccharide mannosidase activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003824 catalytic activity No
GO:0015923 mannosidase activity No
GO:0046872 metal ion binding No
GO:0110165 cellular anatomical entity No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|073670
MRWRQFLPECLFIFSLVSFQIPRWLENTSASPLHRSAWTPQRKHAARHRTRELFYHGYDNYMTFAFPLDELTPLS
CSGRGPDWENPANIAVNDVAGNYSVTLVDVLDTLVVLDDRDGFEKAVKNVIEWVQFDVNTKPQVFETTIRVLGGL
LSGHIFASRPGQPFFLPWYRGQLLDLAHDLGNRLLPAFATRTGLPYARINLRKGVTKGETVETCTAGAGSLILEF
ATLSRLTGDDRFEKAAYKAFFALWNRKSDIGLVGNTINNWNGEWMAPEATSIGAGIDSFFEYALKWYIMSGEIEF
LDVWDDAYTAIMRYSRAADGYWYRPVSMKTGDTAFFTVDSLSAFWPGLQVLAGDVQSAIKLHLLYYNLWREHSGL
PEVYDTKFRQATAHQYPLRPEFVESTWYLYRATHDPFYLDVGERILEDITARARVACGLTGIQDLRTNKRDDRME
SFALSETLKYLYLLFDEDNFLHRDDSNYVFSTEGHILSLEKHHVRPMSASRKKMRPVNDHQCPAYKPFVEIYDNT
SAGTGLVRGIRSRSDYDYARKLIGVPASSVEMDAWSAGGWCEKPAIDSFSYEFILSADGRNVAEDLSPSRLKVEP
IADGLDDRGYDVRKLGHYHVRSGQTVYINDSAIFAGPPPENLDSVTATGNRDVEIQLLLSLDLLDPMLKLLPGNM
DAAGLNMQLTALTASFGADLSPRVGEQDKRPRMAQGKHPISVELTNKKGCSHYKEAYEDDILVVERGECTFMEKL
LLARDAGAVGVIVLSDEDAAIIPTAGVDELEASGDISDVGLLLLPKTAGTVLAELLELMGKLEGRVMVTISREPT
VVADSSGKKATPTKADDKAKEKKENIDDDSEGRILYINGHALLNTRLLI*
Coding >Agabi119p4|073670
ATGCGTTGGAGACAGTTCTTGCCGGAATGTCTCTTCATTTTCAGTCTGGTCTCCTTCCAGATTCCCCGCTGGCTT
GAAAATACTTCGGCGTCACCCCTTCACAGGTCTGCCTGGACACCCCAGCGGAAACACGCTGCTCGGCATCGGACG
AGAGAACTTTTCTATCATGGCTATGACAATTATATGACCTTTGCATTTCCTCTAGATGAGCTGACACCATTATCA
TGTTCAGGACGAGGTCCCGACTGGGAGAATCCCGCCAATATTGCAGTAAACGATGTGGCTGGAAACTATTCTGTC
ACCCTTGTCGATGTCCTTGACACTCTTGTCGTCCTTGATGACCGAGATGGATTCGAAAAAGCAGTGAAGAATGTC
ATCGAGTGGGTCCAGTTTGACGTGAACACTAAACCTCAAGTCTTCGAAACAACCATTCGAGTCCTAGGTGGCCTC
CTTTCAGGACACATATTTGCTAGTCGTCCAGGACAACCCTTCTTTCTTCCTTGGTATCGTGGTCAATTATTGGAT
CTTGCCCACGACCTCGGAAACCGTTTATTACCCGCTTTCGCTACGCGGACGGGACTCCCATACGCTAGGATCAAT
CTGAGAAAAGGTGTTACGAAGGGAGAGACAGTTGAAACGTGCACGGCAGGGGCAGGTTCTCTCATCCTTGAGTTC
GCAACTTTGAGTAGGTTGACTGGAGATGATCGTTTTGAAAAGGCGGCTTACAAGGCCTTTTTTGCCTTGTGGAAC
CGTAAGTCAGATATTGGCCTAGTTGGTAATACGATTAATAATTGGAATGGAGAATGGATGGCACCTGAAGCAACG
AGTATAGGCGCAGGTATTGACTCCTTTTTTGAATATGCTCTTAAGTGGTATATAATGAGTGGTGAGATCGAATTT
CTGGATGTTTGGGATGATGCCTACACGGCTATCATGCGTTATTCACGTGCAGCGGACGGGTACTGGTACAGGCCC
GTGAGTATGAAAACCGGAGATACGGCGTTTTTTACTGTCGACTCTCTGTCCGCTTTCTGGCCCGGGCTGCAAGTC
CTCGCTGGCGACGTTCAAAGTGCTATTAAATTACACCTACTGTATTATAATCTATGGCGAGAACACTCTGGACTT
CCCGAAGTATACGATACAAAGTTCAGACAGGCCACTGCTCATCAATATCCGCTTCGCCCTGAATTTGTTGAATCA
ACGTGGTATCTATACCGGGCAACGCATGATCCTTTCTATCTAGACGTTGGAGAGCGCATACTTGAGGACATCACG
GCAAGGGCTAGGGTTGCATGTGGATTAACAGGAATCCAGGATCTTCGCACAAATAAACGCGACGATCGAATGGAA
TCGTTTGCTTTATCAGAGACATTGAAGTATCTTTACTTGCTATTCGATGAAGACAATTTTTTACACCGTGATGAC
TCAAACTATGTTTTTTCAACCGAAGGACACATATTGAGTCTTGAAAAACACCATGTTCGCCCTATGTCAGCATCG
CGGAAGAAGATGCGACCCGTCAACGATCACCAATGCCCTGCATACAAGCCCTTCGTCGAGATTTACGACAACACG
TCTGCTGGAACTGGTCTCGTCCGTGGCATACGCTCTAGAAGTGACTATGACTATGCACGGAAGCTAATTGGGGTG
CCTGCTAGCTCGGTGGAGATGGACGCTTGGTCTGCTGGCGGATGGTGTGAAAAGCCCGCTATTGACAGTTTTTCT
TATGAATTCATACTCTCCGCTGATGGTCGAAACGTGGCGGAGGATTTGAGTCCCAGCCGTCTAAAAGTTGAGCCC
ATCGCGGATGGCCTCGATGATCGTGGTTATGACGTTCGAAAACTTGGCCATTATCATGTCAGATCAGGGCAAACG
GTCTATATCAATGATTCCGCTATTTTTGCCGGCCCACCTCCTGAAAACCTAGATTCTGTTACTGCGACGGGAAAC
CGAGATGTTGAAATCCAACTCCTTCTCTCCTTGGATTTGTTGGACCCGATGCTGAAGCTCCTCCCTGGTAATATG
GATGCTGCAGGTTTAAATATGCAATTGACAGCACTCACTGCCTCCTTTGGTGCTGACTTATCACCTCGTGTCGGT
GAACAAGATAAACGCCCACGAATGGCACAGGGAAAACATCCTATCTCGGTAGAGCTCACCAACAAGAAGGGATGT
TCACATTACAAGGAGGCATATGAAGATGATATTCTTGTCGTAGAGCGAGGAGAATGTACATTCATGGAGAAGCTA
TTATTAGCTCGAGACGCTGGTGCAGTGGGGGTTATCGTCCTAAGCGACGAGGATGCTGCCATTATACCAACAGCA
GGAGTGGATGAGCTTGAAGCAAGTGGCGATATATCTGATGTTGGCCTTCTGTTGCTGCCCAAGACGGCTGGCACG
GTTCTAGCAGAACTCTTAGAGCTAATGGGAAAGCTTGAAGGGCGAGTTATGGTCACCATCAGCCGAGAGCCTACG
GTGGTGGCCGATTCTTCAGGCAAGAAAGCGACACCAACGAAAGCTGACGACAAGGCAAAGGAGAAAAAGGAGAAC
ATCGATGACGATTCCGAAGGACGGATATTATATATTAACGGTCACGCATTGTTAAATACGCGACTCTTAATCTAA
Transcript >Agabi119p4|073670
ATGCGTTGGAGACAGTTCTTGCCGGAATGTCTCTTCATTTTCAGTCTGGTCTCCTTCCAGATTCCCCGCTGGCTT
GAAAATACTTCGGCGTCACCCCTTCACAGGTCTGCCTGGACACCCCAGCGGAAACACGCTGCTCGGCATCGGACG
AGAGAACTTTTCTATCATGGCTATGACAATTATATGACCTTTGCATTTCCTCTAGATGAGCTGACACCATTATCA
TGTTCAGGACGAGGTCCCGACTGGGAGAATCCCGCCAATATTGCAGTAAACGATGTGGCTGGAAACTATTCTGTC
ACCCTTGTCGATGTCCTTGACACTCTTGTCGTCCTTGATGACCGAGATGGATTCGAAAAAGCAGTGAAGAATGTC
ATCGAGTGGGTCCAGTTTGACGTGAACACTAAACCTCAAGTCTTCGAAACAACCATTCGAGTCCTAGGTGGCCTC
CTTTCAGGACACATATTTGCTAGTCGTCCAGGACAACCCTTCTTTCTTCCTTGGTATCGTGGTCAATTATTGGAT
CTTGCCCACGACCTCGGAAACCGTTTATTACCCGCTTTCGCTACGCGGACGGGACTCCCATACGCTAGGATCAAT
CTGAGAAAAGGTGTTACGAAGGGAGAGACAGTTGAAACGTGCACGGCAGGGGCAGGTTCTCTCATCCTTGAGTTC
GCAACTTTGAGTAGGTTGACTGGAGATGATCGTTTTGAAAAGGCGGCTTACAAGGCCTTTTTTGCCTTGTGGAAC
CGTAAGTCAGATATTGGCCTAGTTGGTAATACGATTAATAATTGGAATGGAGAATGGATGGCACCTGAAGCAACG
AGTATAGGCGCAGGTATTGACTCCTTTTTTGAATATGCTCTTAAGTGGTATATAATGAGTGGTGAGATCGAATTT
CTGGATGTTTGGGATGATGCCTACACGGCTATCATGCGTTATTCACGTGCAGCGGACGGGTACTGGTACAGGCCC
GTGAGTATGAAAACCGGAGATACGGCGTTTTTTACTGTCGACTCTCTGTCCGCTTTCTGGCCCGGGCTGCAAGTC
CTCGCTGGCGACGTTCAAAGTGCTATTAAATTACACCTACTGTATTATAATCTATGGCGAGAACACTCTGGACTT
CCCGAAGTATACGATACAAAGTTCAGACAGGCCACTGCTCATCAATATCCGCTTCGCCCTGAATTTGTTGAATCA
ACGTGGTATCTATACCGGGCAACGCATGATCCTTTCTATCTAGACGTTGGAGAGCGCATACTTGAGGACATCACG
GCAAGGGCTAGGGTTGCATGTGGATTAACAGGAATCCAGGATCTTCGCACAAATAAACGCGACGATCGAATGGAA
TCGTTTGCTTTATCAGAGACATTGAAGTATCTTTACTTGCTATTCGATGAAGACAATTTTTTACACCGTGATGAC
TCAAACTATGTTTTTTCAACCGAAGGACACATATTGAGTCTTGAAAAACACCATGTTCGCCCTATGTCAGCATCG
CGGAAGAAGATGCGACCCGTCAACGATCACCAATGCCCTGCATACAAGCCCTTCGTCGAGATTTACGACAACACG
TCTGCTGGAACTGGTCTCGTCCGTGGCATACGCTCTAGAAGTGACTATGACTATGCACGGAAGCTAATTGGGGTG
CCTGCTAGCTCGGTGGAGATGGACGCTTGGTCTGCTGGCGGATGGTGTGAAAAGCCCGCTATTGACAGTTTTTCT
TATGAATTCATACTCTCCGCTGATGGTCGAAACGTGGCGGAGGATTTGAGTCCCAGCCGTCTAAAAGTTGAGCCC
ATCGCGGATGGCCTCGATGATCGTGGTTATGACGTTCGAAAACTTGGCCATTATCATGTCAGATCAGGGCAAACG
GTCTATATCAATGATTCCGCTATTTTTGCCGGCCCACCTCCTGAAAACCTAGATTCTGTTACTGCGACGGGAAAC
CGAGATGTTGAAATCCAACTCCTTCTCTCCTTGGATTTGTTGGACCCGATGCTGAAGCTCCTCCCTGGTAATATG
GATGCTGCAGGTTTAAATATGCAATTGACAGCACTCACTGCCTCCTTTGGTGCTGACTTATCACCTCGTGTCGGT
GAACAAGATAAACGCCCACGAATGGCACAGGGAAAACATCCTATCTCGGTAGAGCTCACCAACAAGAAGGGATGT
TCACATTACAAGGAGGCATATGAAGATGATATTCTTGTCGTAGAGCGAGGAGAATGTACATTCATGGAGAAGCTA
TTATTAGCTCGAGACGCTGGTGCAGTGGGGGTTATCGTCCTAAGCGACGAGGATGCTGCCATTATACCAACAGCA
GGAGTGGATGAGCTTGAAGCAAGTGGCGATATATCTGATGTTGGCCTTCTGTTGCTGCCCAAGACGGCTGGCACG
GTTCTAGCAGAACTCTTAGAGCTAATGGGAAAGCTTGAAGGGCGAGTTATGGTCACCATCAGCCGAGAGCCTACG
GTGGTGGCCGATTCTTCAGGCAAGAAAGCGACACCAACGAAAGCTGACGACAAGGCAAAGGAGAAAAAGGAGAAC
ATCGATGACGATTCCGAAGGACGGATATTATATATTAACGGTCACGCATTGTTAAATACGCGACTCTTAATCTAA
Gene >Agabi119p4|073670
ATGCGTTGGAGACAGTTCTTGCCGGAATGTCTCTTCATTTTCAGTCTGGTCTCCTTCCAGATTCCCCGCTGGCTT
GAAAATACTTCGGCGTCACCCCTTCACAGGTCTGCCTGGACACCCCAGCGGAAACACGCTGCTCGGCATGTCACA
TTCATTCGGGAACTGGAAATAACATTGCTGACCCGGCAACTTAGGGAGCGGACGAGAGAACTTTTCTATCATGGC
TATGACAATTATATGACCTTTGGCATGTCCCCATTCGTTCCACTCGTCAACAGCATATATTGAGTCGACCTTTGC
CAGCATTTCCTCTAGATGAGGTACGAGAACCTGGACTTCGAAACCCGTCTGGCACTGAAGGAGCCTGATAGCTGA
CACCATTATCATGTTCAGGACGAGGTCCCGACTGGGAGAATCCGTACGTTTGCCACGGACTCACAGTATTCGAGT
GGGAATGTTGCTCAATATAGTTCCAGCGCCAATATTGCAGTAAACGATGTGGCTGGAAACTATTCTGTCACCCTT
GTCGATGTCCTTGACACTCTTGTCGTCCTTGATGACCGAGATGGATTCGAAAAAGCAGTGAAGAATGTCATCGAG
TGGGTCCAGTTTGACGTGAACACTAAACCTCAAGTCTTCGAAACAACCATTCGAGTCCTAGGTGGCCTCCTTTCA
GGACACATATTTGCTAGTCGTCCAGGACAACCCTTCTTTCTTCCTTGGTATCGTGGTCAATTATTGGATCTTGCC
CACGACCTCGGAAACCGTTTATTACCCGCTTTCGCTACGCGGACGGGACTCCCATACGCTAGGGTATTGTCTATT
TTTCTTCTTGCTTTCAAGAACCTAATTTAACCGGAAGATCAATCTGAGAAAAGGTGTTACGAAGGGAGAGACAGT
TGAAACGTGTAAGCGAAGTCAACTATGCCATTGCACACGCTGGTCTCACAGGCTACTTTTTAGGCACGGCAGGGG
CAGGTTCTCTCATCCTTGAGTTCGCAACTTTGAGTAGGTTGACTGGAGATGATCGTTTTGAAAAGGCGGCTTACA
AGGTGGGTGCGACTTTGCGACTTTCTGAGAAATTAATATATGAGTTAATCTTTATCCATTTCTCAGGCCTTTTTT
GCCTTGTGGAACCGTAAGTCAGATATTGGCCTAGTTGGTAATACGATTAATAATTGGAATGGAGTAAGTTCCACT
CCAATAGTCGTGATGGCAATTTTCATCGAGTTGTAGGAATGGATGGCACCTGAAGCAACGAGTATAGGCGCAGGT
ATTGACTCCTTTTTTGAATATGCTCTTAAGTGGTATATAATGAGTGGTAAATAATTCAATAACTCTTCATTTATC
TGGAGAGATACTGACGGCACTACAGGTGAGATCGAATTTCTGGATGTTTGGGATGATGCCTACACGGCTATCATG
CGTTATTCACGTGCAGCGGACGGGTACTGGGTTCGTCAGGAAAATAGAGCTCACAGGTTCATGAGCTGATTACAC
CAATTTCAGTACAGGCCCGTGAGTATGAAAACCGGAGATACGGCGTTTTTTACTGTCGACTCTCTGTCCGCTTTC
TGGCCCGGGCTGCAAGTCCTCGCTGGCGACGTTCAAAGTGCTATTAAATTACACCTACTGTGTGGGTTTTTTGCT
TGTTCTAGTCAATCGTAGTCTTGACATTCTAACAGATTATAATCTATGGCGAGAACACTCTGGACTTCCCGAAGT
ATACGATACAAAGTTCAGACAGGCCACTGCTCATCAATATCCGCTTCGCCCTGGTAAATTTGTTTCGAAAAAGAA
GTAAAAAATAACAACCTTATGTGACGCAACAGAATTTGTTGAATCAACGTGGTATCTATACCGGGTCCGCTTCCC
CCTTGTGTCCGTCCAAGTCCCTAATACTCACTCTTCATATCAGGCAACGCATGATCCTTTCTATCTAGACGTTGG
AGAGCGCATACTTGAGGACATCACGGCAAGGGCTAGGGTTGCATGTGGATTAACAGGAATCCAGGATCTTCGCAC
AAATAAACGCGACGATCGAATGGAATCGTTTGCTTTATCAGAGACATTGAAGGTCGGCTTTCTTGATTGCTTCCA
CTTTGAGTACCTCACGTTTTATTTCAGTATCTTTACTTGCTATTCGATGAAGACAATTTTTTACACCGTGATGAC
TCAAACTATGTTTTTTCAACCGAAGGACACATATTGAGTCTTGAAAAACACCATGTTCGCCCTATGTCAGCATCG
CGGAAGAAGATGCGACCCGTCAACGATCACCAATGCCCTGCATACAAGCCCTTCGTCGAGATTTACGACAACACG
TCTGCTGGAACTGGTCTCGTCCGTGGCATACGCTCTAGAAGTGACTATGACTATGCACGGAAGCTAATTGGGGTG
CCTGCTAGCTCGGTGGAGATGGACGCTTGGTCTGCTGGCGGATGGTGTGAAAAGCCCGCTATTGACAGTTTTGTG
AGTCCGGTTTGCAGTTAGCTCACTTTTTAGACTCACCGCAATTCTAGTCTTATGAATTCATACTCTCCGCTGATG
GTCGAAACGTGGCGGAGGATTTGAGTCCCAGCCGTCTAAAAGTTGAGCCCATCGCGGATGGGTTCGTTGTCCACA
ATATTTCCGGGGTTCGAACGAAAATTGTACGCAGCCTCGATGATCGTGGTTATGACGTTCGAAAACGTACGTCTG
TGGAAATTTATGAGCTTATCCCGGAACTTACGAGGTCGATAGTTGGCCATTATCATGTCAGATCAGGGCAAACGG
TCTATATCAATGATTCCGCTATTTTTGCCGGCCCACCTCCTGAAAACCTAGATTCTGTTACTGCGACGGGAAACC
GAGATGTTGAAATCCAACTCCTTCTCTCCTTGGATTTGTTGGACCCGATGCTGAAGCTCCTCCCTGGTAATATGG
ATGCTGCAGGTTTAAATATGCAATTGACAGCACTCACTGCCTCCTTTGGTGCTGACTTATCACCTCGTGTCGGTG
AACAAGATAAACGCCCACGAATGGCACAGGGAAAACATCCTATCTCGGTAGAGCTCACCAACAAGAAGGGATGTT
CACATTACAAGGAGGCATATGAAGATGATATTCTTGTCGTAGAGCGAGGAGAATGTACATTCATGGAGAAGCTAT
TATTAGCTCGAGACGCTGGTGCAGTGGGGGTTATCGTCCTAAGCGACGAGGATGCTGCCATTATACCAACAGCAG
GAGTGGATGAGCTTGAAGCAAGTGGCGATATATCTGATGTTGGCCTTCTGTTGCTGCCCAAGACGGCTGGCACGG
TTCTAGCAGAACTCTTAGAGCTAATGGGAAAGCTTGAAGGGCGAGTTATGGTCACCATCAGCCGAGAGCCTACGG
TGGTGGCCGATTCTTCAGGCAAGAAAGCGACACCAACGAAAGCTGACGACAAGGCAAAGGAGAAAAAGGAGAACA
TCGATGACGATTCCGAAGGACGGATATTATATATTAACGGTCACGCATTGTTAAATACGCGACTCTTAATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail