Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|073440
Gene name
Locationscaffold_04:1837780..1839519
Strand-
Gene length (bp)1739
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01300 Sua5_yciO_yrdC Telomere recombination 2.4E-53 150 330
PF13233 Complex1_LYR_2 Complex1_LYR-like 6.6E-15 7 82
PF03481 Sua5_C Threonylcarbamoyl-AMP synthase, C-terminal domain 6.3E-12 332 426

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94530|SUA5_SCHPO Threonylcarbamoyl-AMP synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sua5 PE=3 SV=1 116 432 2.0E-65
sp|P39153|SUA5_BACSU Threonylcarbamoyl-AMP synthase OS=Bacillus subtilis (strain 168) GN=ywlC PE=1 SV=1 146 393 2.0E-64
sp|P32579|SUA5_YEAST Threonylcarbamoyl-AMP synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUA5 PE=1 SV=1 116 388 3.0E-63
sp|Q9UYB2|SUA5_PYRAB Threonylcarbamoyl-AMP synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=sua5 PE=1 SV=1 143 423 3.0E-63
sp|Q970S6|SUA5_SULTO Threonylcarbamoyl-AMP synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=sua5 PE=1 SV=1 140 390 2.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94530|SUA5_SCHPO Threonylcarbamoyl-AMP synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sua5 PE=3 SV=1 116 432 2.0E-65
sp|P39153|SUA5_BACSU Threonylcarbamoyl-AMP synthase OS=Bacillus subtilis (strain 168) GN=ywlC PE=1 SV=1 146 393 2.0E-64
sp|P32579|SUA5_YEAST Threonylcarbamoyl-AMP synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUA5 PE=1 SV=1 116 388 3.0E-63
sp|Q9UYB2|SUA5_PYRAB Threonylcarbamoyl-AMP synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=sua5 PE=1 SV=1 143 423 3.0E-63
sp|Q970S6|SUA5_SULTO Threonylcarbamoyl-AMP synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=sua5 PE=1 SV=1 140 390 2.0E-48
sp|P9WGC9|TSAC_MYCTU Putative threonylcarbamoyl-AMP synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1301 PE=1 SV=1 146 344 2.0E-28
sp|P9WGC8|TSAC_MYCTO Putative threonylcarbamoyl-AMP synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1340 PE=3 SV=1 146 344 2.0E-28
sp|P45831|TSAC_MYCLE Putative threonylcarbamoyl-AMP synthase OS=Mycobacterium leprae (strain TN) GN=ML1136 PE=3 SV=1 146 343 6.0E-26
sp|Q60369|TSAC_METJA Putative threonylcarbamoyl-AMP synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0062 PE=3 SV=1 141 313 2.0E-20
sp|Q0VTD8|TSAC_ALCBS Threonylcarbamoyl-AMP synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=tsaC PE=3 SV=1 146 329 1.0E-19
sp|A8FP81|TSAC_SHESH Threonylcarbamoyl-AMP synthase OS=Shewanella sediminis (strain HAW-EB3) GN=tsaC PE=3 SV=1 150 318 7.0E-18
sp|Q21PU1|TSAC_SACD2 Threonylcarbamoyl-AMP synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=tsaC PE=3 SV=1 150 325 1.0E-17
sp|A6UX84|TSAC_PSEA7 Threonylcarbamoyl-AMP synthase OS=Pseudomonas aeruginosa (strain PA7) GN=tsaC PE=3 SV=1 146 303 1.0E-17
sp|Q88RQ9|TSAC_PSEPK Threonylcarbamoyl-AMP synthase OS=Pseudomonas putida (strain KT2440) GN=tsaC PE=3 SV=1 146 303 2.0E-17
sp|A1TWN4|TSAC_MARHV Threonylcarbamoyl-AMP synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=tsaC PE=3 SV=1 135 286 3.0E-17
sp|A5VWK1|TSAC_PSEP1 Threonylcarbamoyl-AMP synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=tsaC PE=3 SV=1 146 303 3.0E-17
sp|B0KF32|TSAC_PSEPG Threonylcarbamoyl-AMP synthase OS=Pseudomonas putida (strain GB-1) GN=tsaC PE=3 SV=1 146 303 1.0E-16
sp|B3PGZ1|TSAC_CELJU Threonylcarbamoyl-AMP synthase OS=Cellvibrio japonicus (strain Ueda107) GN=tsaC PE=3 SV=2 143 281 1.0E-16
sp|Q87KE2|TSAC_VIBPA Threonylcarbamoyl-AMP synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tsaC PE=3 SV=1 150 303 2.0E-16
sp|Q3KKE2|TSAC_PSEPF Threonylcarbamoyl-AMP synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=tsaC PE=3 SV=1 146 303 2.0E-16
sp|Q8PG13|TSAC_XANAC Threonylcarbamoyl-AMP synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tsaC PE=3 SV=1 143 332 3.0E-16
sp|B1J499|TSAC_PSEPW Threonylcarbamoyl-AMP synthase OS=Pseudomonas putida (strain W619) GN=tsaC PE=3 SV=1 146 303 5.0E-16
sp|A3QJE8|TSAC_SHELP Threonylcarbamoyl-AMP synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tsaC PE=3 SV=1 155 316 6.0E-16
sp|Q6LLJ9|TSAC_PHOPR Threonylcarbamoyl-AMP synthase OS=Photobacterium profundum GN=tsaC PE=3 SV=2 140 303 7.0E-16
sp|Q4KKQ6|TSAC_PSEF5 Threonylcarbamoyl-AMP synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tsaC PE=3 SV=1 146 303 8.0E-16
sp|Q3BNJ9|TSAC_XANC5 Threonylcarbamoyl-AMP synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tsaC PE=3 SV=1 143 332 1.0E-15
sp|Q9I7A5|TSAC_PSEAE Threonylcarbamoyl-AMP synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tsaC PE=3 SV=1 146 292 1.0E-15
sp|Q02V59|TSAC_PSEAB Threonylcarbamoyl-AMP synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tsaC PE=3 SV=1 146 292 1.0E-15
sp|A6TET6|TSAC_KLEP7 Threonylcarbamoyl-AMP synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tsaC PE=3 SV=1 141 304 1.0E-15
sp|Q603G8|TSAC_METCA Threonylcarbamoyl-AMP synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tsaC PE=3 SV=1 143 297 1.0E-15
sp|Q8P4F2|TSAC_XANCP Threonylcarbamoyl-AMP synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tsaC PE=3 SV=1 143 332 1.0E-15
sp|B0RWR5|TSAC_XANCB Threonylcarbamoyl-AMP synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=tsaC PE=3 SV=2 143 332 1.0E-15
sp|Q4UQ07|TSAC_XANC8 Threonylcarbamoyl-AMP synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tsaC PE=3 SV=1 143 332 1.0E-15
sp|B1KCX0|TSAC_SHEWM Threonylcarbamoyl-AMP synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tsaC PE=3 SV=1 150 318 2.0E-15
sp|Q0I0R7|TSAC_SHESR Threonylcarbamoyl-AMP synthase OS=Shewanella sp. (strain MR-7) GN=tsaC PE=3 SV=1 152 330 2.0E-15
sp|Q0HPA1|TSAC_SHESM Threonylcarbamoyl-AMP synthase OS=Shewanella sp. (strain MR-4) GN=tsaC PE=3 SV=1 152 330 2.0E-15
sp|Q08A23|TSAC_SHEFN Threonylcarbamoyl-AMP synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=tsaC PE=3 SV=1 146 317 2.0E-15
sp|A0KR66|TSAC_SHESA Threonylcarbamoyl-AMP synthase OS=Shewanella sp. (strain ANA-3) GN=tsaC PE=3 SV=1 152 330 2.0E-15
sp|Q7P0L7|TSAC_CHRVO Threonylcarbamoyl-AMP synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tsaC PE=3 SV=1 146 316 2.0E-15
sp|Q3SG43|TSAC_THIDA Threonylcarbamoyl-AMP synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=tsaC PE=3 SV=1 148 316 2.0E-15
sp|Q9KVT5|TSAC_VIBCH Threonylcarbamoyl-AMP synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tsaC PE=3 SV=1 140 303 2.0E-15
sp|A5F4C5|TSAC_VIBC3 Threonylcarbamoyl-AMP synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tsaC PE=3 SV=1 140 303 2.0E-15
sp|Q5H5D8|TSAC_XANOR Threonylcarbamoyl-AMP synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tsaC PE=3 SV=1 143 332 2.0E-15
sp|B2SL46|TSAC_XANOP Threonylcarbamoyl-AMP synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=tsaC PE=3 SV=1 143 332 2.0E-15
sp|Q2P833|TSAC_XANOM Threonylcarbamoyl-AMP synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tsaC PE=3 SV=1 143 332 2.0E-15
sp|Q1I2G9|TSAC_PSEE4 Threonylcarbamoyl-AMP synthase OS=Pseudomonas entomophila (strain L48) GN=tsaC PE=3 SV=1 146 282 3.0E-15
sp|A1WZH9|TSAC_HALHL Threonylcarbamoyl-AMP synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tsaC PE=3 SV=1 146 280 3.0E-15
sp|Q8EKQ3|TSAC_SHEON Threonylcarbamoyl-AMP synthase OS=Shewanella oneidensis (strain MR-1) GN=tsaC PE=3 SV=1 152 330 3.0E-15
sp|Q48QH8|TSAC_PSE14 Threonylcarbamoyl-AMP synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tsaC PE=3 SV=1 146 303 3.0E-15
sp|Q499R4|YRDC_RAT YrdC domain-containing protein, mitochondrial OS=Rattus norvegicus GN=Yrdc PE=2 SV=1 141 342 4.0E-15
sp|Q500S6|TSAC_PSEU2 Threonylcarbamoyl-AMP synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tsaC PE=3 SV=1 146 303 4.0E-15
sp|Q88B46|TSAC_PSESM Threonylcarbamoyl-AMP synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tsaC PE=3 SV=1 146 303 6.0E-15
sp|Q7MGL3|TSAC_VIBVY Threonylcarbamoyl-AMP synthase OS=Vibrio vulnificus (strain YJ016) GN=tsaC PE=3 SV=2 143 303 7.0E-15
sp|Q8DDD6|TSAC_VIBVU Threonylcarbamoyl-AMP synthase OS=Vibrio vulnificus (strain CMCP6) GN=tsaC PE=3 SV=1 143 303 7.0E-15
sp|A7N129|TSAC_VIBCB Threonylcarbamoyl-AMP synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=tsaC PE=3 SV=1 150 303 7.0E-15
sp|A7MPF3|TSAC_CROS8 Threonylcarbamoyl-AMP synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tsaC PE=3 SV=1 142 300 8.0E-15
sp|Q31VZ4|TSAC_SHIBS Threonylcarbamoyl-AMP synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=tsaC PE=3 SV=1 142 301 1.0E-14
sp|A4XNB6|TSAC_PSEMY Threonylcarbamoyl-AMP synthase OS=Pseudomonas mendocina (strain ymp) GN=tsaC PE=3 SV=1 146 282 2.0E-14
sp|Q65WC1|TSAC_MANSM Threonylcarbamoyl-AMP synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tsaC PE=3 SV=1 150 302 3.0E-14
sp|A4WF91|TSAC_ENT38 Threonylcarbamoyl-AMP synthase OS=Enterobacter sp. (strain 638) GN=tsaC PE=3 SV=2 140 301 3.0E-14
sp|Q86U90|YRDC_HUMAN YrdC domain-containing protein, mitochondrial OS=Homo sapiens GN=YRDC PE=1 SV=1 141 330 4.0E-14
sp|Q83AA2|TSAC_COXBU Threonylcarbamoyl-AMP synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tsaC PE=3 SV=1 141 303 4.0E-14
sp|Q3YWX6|TSAC_SHISS Threonylcarbamoyl-AMP synthase OS=Shigella sonnei (strain Ss046) GN=tsaC PE=3 SV=1 142 300 5.0E-14
sp|B2U2Q0|TSAC_SHIB3 Threonylcarbamoyl-AMP synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=tsaC PE=3 SV=2 142 300 5.0E-14
sp|Q1R650|TSAC_ECOUT Threonylcarbamoyl-AMP synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=tsaC PE=3 SV=2 142 300 5.0E-14
sp|B1LGN9|TSAC_ECOSM Threonylcarbamoyl-AMP synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=tsaC PE=3 SV=1 142 300 5.0E-14
sp|Q0TCH9|TSAC_ECOL5 Threonylcarbamoyl-AMP synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tsaC PE=3 SV=2 142 300 5.0E-14
sp|A1AGH4|TSAC_ECOK1 Threonylcarbamoyl-AMP synthase OS=Escherichia coli O1:K1 / APEC GN=tsaC PE=3 SV=2 142 300 5.0E-14
sp|A7ZSH1|TSAC_ECO24 Threonylcarbamoyl-AMP synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tsaC PE=3 SV=2 142 300 5.0E-14
sp|A9N9G8|TSAC_COXBR Threonylcarbamoyl-AMP synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tsaC PE=3 SV=1 141 281 5.0E-14
sp|Q8ZLN0|TSAC_SALTY Threonylcarbamoyl-AMP synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tsaC PE=3 SV=1 140 281 6.0E-14
sp|Q5PIS8|TSAC_SALPA Threonylcarbamoyl-AMP synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tsaC PE=3 SV=1 150 281 6.0E-14
sp|P45748|TSAC_ECOLI Threonylcarbamoyl-AMP synthase OS=Escherichia coli (strain K12) GN=tsaC PE=1 SV=2 142 300 6.0E-14
sp|B1IQ17|TSAC_ECOLC Threonylcarbamoyl-AMP synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tsaC PE=3 SV=1 142 300 6.0E-14
sp|A8A587|TSAC_ECOHS Threonylcarbamoyl-AMP synthase OS=Escherichia coli O9:H4 (strain HS) GN=tsaC PE=3 SV=2 142 300 6.0E-14
sp|B1X6D5|TSAC_ECODH Threonylcarbamoyl-AMP synthase OS=Escherichia coli (strain K12 / DH10B) GN=tsaC PE=3 SV=1 142 300 6.0E-14
sp|Q83JD1|TSAC_SHIFL Threonylcarbamoyl-AMP synthase OS=Shigella flexneri GN=tsaC PE=3 SV=4 142 300 6.0E-14
sp|Q8Z1W6|TSAC_SALTI Threonylcarbamoyl-AMP synthase OS=Salmonella typhi GN=tsaC PE=3 SV=1 150 281 6.0E-14
sp|Q8FD17|TSAC_ECOL6 Threonylcarbamoyl-AMP synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tsaC PE=3 SV=2 142 300 6.0E-14
sp|A9N8A7|TSAC_SALPB Threonylcarbamoyl-AMP synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tsaC PE=3 SV=1 150 281 6.0E-14
sp|Q57J68|TSAC_SALCH Threonylcarbamoyl-AMP synthase OS=Salmonella choleraesuis (strain SC-B67) GN=tsaC PE=3 SV=2 150 281 6.0E-14
sp|Q1H4G9|TSAC_METFK Threonylcarbamoyl-AMP synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tsaC PE=3 SV=1 150 316 8.0E-14
sp|Q8X8F8|TSAC_ECO57 Threonylcarbamoyl-AMP synthase OS=Escherichia coli O157:H7 GN=tsaC PE=3 SV=1 142 300 8.0E-14
sp|Q0T019|TSAC_SHIF8 Threonylcarbamoyl-AMP synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=tsaC PE=3 SV=2 142 300 8.0E-14
sp|Q32B67|TSAC_SHIDS Threonylcarbamoyl-AMP synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tsaC PE=3 SV=1 142 300 9.0E-14
sp|A9KH21|TSAC_COXBN Threonylcarbamoyl-AMP synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tsaC PE=3 SV=1 141 303 9.0E-14
sp|Q5E1R5|TSAC_VIBF1 Threonylcarbamoyl-AMP synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=tsaC PE=3 SV=1 140 279 9.0E-14
sp|B2FIS1|TSAC_STRMK Threonylcarbamoyl-AMP synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=tsaC PE=3 SV=1 143 303 1.0E-13
sp|Q3U5F4|YRDC_MOUSE YrdC domain-containing protein, mitochondrial OS=Mus musculus GN=Yrdc PE=1 SV=1 141 342 1.0E-13
sp|B0UWV9|TSAC_HISS2 Threonylcarbamoyl-AMP synthase OS=Histophilus somni (strain 2336) GN=tsaC PE=3 SV=1 150 300 1.0E-13
sp|Q5QXJ5|TSAC_IDILO Threonylcarbamoyl-AMP synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tsaC PE=3 SV=1 155 302 2.0E-13
sp|Q0I1B6|TSAC_HAES1 Threonylcarbamoyl-AMP synthase OS=Haemophilus somnus (strain 129Pt) GN=tsaC PE=3 SV=2 150 300 2.0E-13
sp|Q0A5B4|TSAC_ALKEH Threonylcarbamoyl-AMP synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=tsaC PE=3 SV=1 147 281 2.0E-13
sp|Q12TA0|TSAC_SHEDO Threonylcarbamoyl-AMP synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tsaC PE=3 SV=1 155 317 2.0E-13
sp|A5UE77|TSAC_HAEIE Threonylcarbamoyl-AMP synthase OS=Haemophilus influenzae (strain PittEE) GN=tsaC PE=3 SV=1 147 300 2.0E-13
sp|P44807|TSAC_HAEIN Threonylcarbamoyl-AMP synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tsaC PE=1 SV=1 147 300 3.0E-13
sp|Q4QMR0|TSAC_HAEI8 Threonylcarbamoyl-AMP synthase OS=Haemophilus influenzae (strain 86-028NP) GN=tsaC PE=3 SV=1 147 300 3.0E-13
sp|B0VCB7|TSAC_ACIBY Threonylcarbamoyl-AMP synthase OS=Acinetobacter baumannii (strain AYE) GN=tsaC PE=3 SV=1 146 292 3.0E-13
sp|A3M154|TSAC_ACIBT Threonylcarbamoyl-AMP synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=tsaC PE=3 SV=2 146 292 3.0E-13
sp|B0VNL3|TSAC_ACIBS Threonylcarbamoyl-AMP synthase OS=Acinetobacter baumannii (strain SDF) GN=tsaC PE=3 SV=1 146 292 3.0E-13
sp|B2I111|TSAC_ACIBC Threonylcarbamoyl-AMP synthase OS=Acinetobacter baumannii (strain ACICU) GN=tsaC PE=3 SV=1 146 292 3.0E-13
sp|A5UHE9|TSAC_HAEIG Threonylcarbamoyl-AMP synthase OS=Haemophilus influenzae (strain PittGG) GN=tsaC PE=3 SV=1 147 300 4.0E-13
sp|A1JRY6|TSAC_YERE8 Threonylcarbamoyl-AMP synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tsaC PE=3 SV=1 142 280 4.0E-13
sp|Q0VC80|YRDC_BOVIN YrdC domain-containing protein, mitochondrial OS=Bos taurus GN=YRDC PE=2 SV=1 141 342 4.0E-13
sp|A9MN84|TSAC_SALAR Threonylcarbamoyl-AMP synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=tsaC PE=3 SV=2 150 300 5.0E-13
sp|A1SR31|TSAC_PSYIN Threonylcarbamoyl-AMP synthase OS=Psychromonas ingrahamii (strain 37) GN=tsaC PE=3 SV=1 143 278 5.0E-13
sp|A1S1K5|TSAC_SHEAM Threonylcarbamoyl-AMP synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tsaC PE=3 SV=2 150 316 8.0E-13
sp|Q8D257|TSAC_WIGBR Threonylcarbamoyl-AMP synthase OS=Wigglesworthia glossinidia brevipalpis GN=tsaC PE=3 SV=1 150 330 1.0E-12
sp|Q3J7C4|TSAC_NITOC Threonylcarbamoyl-AMP synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tsaC PE=3 SV=1 143 303 1.0E-12
sp|A1RDY7|TSAC_SHESW Threonylcarbamoyl-AMP synthase OS=Shewanella sp. (strain W3-18-1) GN=tsaC PE=3 SV=1 152 330 1.0E-12
sp|A4Y1D2|TSAC_SHEPC Threonylcarbamoyl-AMP synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tsaC PE=3 SV=1 152 330 1.0E-12
sp|Q87AQ5|TSAC_XYLFT Threonylcarbamoyl-AMP synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tsaC PE=3 SV=1 143 332 1.0E-12
sp|B2I8S9|TSAC_XYLF2 Threonylcarbamoyl-AMP synthase OS=Xylella fastidiosa (strain M23) GN=tsaC PE=3 SV=2 143 332 1.0E-12
sp|A8AQH7|TSAC_CITK8 Threonylcarbamoyl-AMP synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=tsaC PE=3 SV=2 142 300 2.0E-12
sp|A4VFI1|TSAC_PSEU5 Threonylcarbamoyl-AMP synthase OS=Pseudomonas stutzeri (strain A1501) GN=tsaC PE=3 SV=1 150 282 2.0E-12
sp|A6WHB6|TSAC_SHEB8 Threonylcarbamoyl-AMP synthase OS=Shewanella baltica (strain OS185) GN=tsaC PE=3 SV=1 155 330 2.0E-12
sp|A3CYL0|TSAC_SHEB5 Threonylcarbamoyl-AMP synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tsaC PE=3 SV=1 155 330 2.0E-12
sp|Q31JQ7|TSAC_THICR Threonylcarbamoyl-AMP synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=tsaC PE=3 SV=1 130 280 2.0E-12
sp|Q3IDH7|TSAC_PSEHT Threonylcarbamoyl-AMP synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tsaC PE=3 SV=1 146 280 3.0E-12
sp|Q15ZX7|TSAC_PSEA6 Threonylcarbamoyl-AMP synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tsaC PE=3 SV=1 155 303 3.0E-12
sp|A9KUA7|TSAC_SHEB9 Threonylcarbamoyl-AMP synthase OS=Shewanella baltica (strain OS195) GN=tsaC PE=3 SV=1 155 330 4.0E-12
sp|Q2NQQ7|TSAC_SODGM Threonylcarbamoyl-AMP synthase OS=Sodalis glossinidius (strain morsitans) GN=tsaC PE=3 SV=1 150 302 4.0E-12
sp|A1KWL6|TSAC_NEIMF Threonylcarbamoyl-AMP synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=tsaC PE=3 SV=2 128 317 7.0E-12
sp|Q9JXA4|TSAC_NEIMB Threonylcarbamoyl-AMP synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=tsaC PE=3 SV=1 128 317 7.0E-12
sp|A1IP83|TSAC_NEIMA Threonylcarbamoyl-AMP synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=tsaC PE=3 SV=2 128 317 7.0E-12
sp|A9M4K6|TSAC_NEIM0 Threonylcarbamoyl-AMP synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=tsaC PE=3 SV=1 128 317 7.0E-12
sp|B1JJI2|TSAC_YERPY Threonylcarbamoyl-AMP synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tsaC PE=3 SV=1 150 287 1.0E-11
sp|Q664V8|TSAC_YERPS Threonylcarbamoyl-AMP synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tsaC PE=3 SV=1 150 287 1.0E-11
sp|A4TH27|TSAC_YERPP Threonylcarbamoyl-AMP synthase OS=Yersinia pestis (strain Pestoides F) GN=tsaC PE=3 SV=1 150 287 1.0E-11
sp|Q1CCY0|TSAC_YERPN Threonylcarbamoyl-AMP synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tsaC PE=3 SV=1 150 287 1.0E-11
sp|A9R933|TSAC_YERPG Threonylcarbamoyl-AMP synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tsaC PE=3 SV=1 150 287 1.0E-11
sp|Q74XX5|TSAC_YERPE Threonylcarbamoyl-AMP synthase OS=Yersinia pestis GN=tsaC PE=3 SV=1 150 287 1.0E-11
sp|B2K500|TSAC_YERPB Threonylcarbamoyl-AMP synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tsaC PE=3 SV=1 150 287 1.0E-11
sp|Q1C2Y3|TSAC_YERPA Threonylcarbamoyl-AMP synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tsaC PE=3 SV=1 150 287 1.0E-11
sp|A7FNJ8|TSAC_YERP3 Threonylcarbamoyl-AMP synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tsaC PE=3 SV=1 150 287 1.0E-11
sp|Q9PEV9|TSAC_XYLFA Threonylcarbamoyl-AMP synthase OS=Xylella fastidiosa (strain 9a5c) GN=tsaC PE=3 SV=1 143 332 1.0E-11
sp|Q8K977|TSAC_BUCAP Threonylcarbamoyl-AMP synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=tsaC PE=3 SV=1 150 300 1.0E-11
sp|P57561|TSAC_BUCAI Threonylcarbamoyl-AMP synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=tsaC PE=3 SV=1 150 303 1.0E-11
sp|Q7MYI5|TSAC_PHOLL Threonylcarbamoyl-AMP synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tsaC PE=3 SV=1 150 303 2.0E-11
sp|Q1QTJ8|TSAC_CHRSD Threonylcarbamoyl-AMP synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=tsaC PE=3 SV=1 146 316 2.0E-11
sp|A8GKG1|TSAC_SERP5 Threonylcarbamoyl-AMP synthase OS=Serratia proteamaculans (strain 568) GN=tsaC PE=3 SV=1 150 300 3.0E-11
sp|Q48AU1|TSAC_COLP3 Threonylcarbamoyl-AMP synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=tsaC PE=3 SV=1 150 318 3.0E-11
sp|Q5F5I5|TSAC_NEIG1 Threonylcarbamoyl-AMP synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=tsaC PE=3 SV=2 128 317 3.0E-11
sp|Q6FFH9|TSAC_ACIAD Threonylcarbamoyl-AMP synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=tsaC PE=3 SV=1 147 279 5.0E-11
sp|A8GYH9|TSAC_SHEPA Threonylcarbamoyl-AMP synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tsaC PE=3 SV=1 146 316 5.0E-11
sp|D5V9A9|TSAC_MORCR Threonylcarbamoyl-AMP synthase OS=Moraxella catarrhalis (strain RH4) GN=tsaC PE=3 SV=1 143 285 5.0E-11
sp|B0U4N0|TSAC_XYLFM Threonylcarbamoyl-AMP synthase OS=Xylella fastidiosa (strain M12) GN=tsaC PE=3 SV=2 143 332 6.0E-11
sp|A6VL69|TSAC_ACTSZ Threonylcarbamoyl-AMP synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=tsaC PE=3 SV=1 147 302 8.0E-11
sp|B0TLD6|TSAC_SHEHH Threonylcarbamoyl-AMP synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=tsaC PE=3 SV=1 147 316 1.0E-10
sp|A0KEX6|TSAC_AERHH Threonylcarbamoyl-AMP synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=tsaC PE=3 SV=1 141 280 5.0E-10
sp|Q1Q7W4|TSAC_PSYCK Threonylcarbamoyl-AMP synthase OS=Psychrobacter cryohalolentis (strain K5) GN=tsaC PE=3 SV=1 132 281 5.0E-10
sp|A4ST51|TSAC_AERS4 Threonylcarbamoyl-AMP synthase OS=Aeromonas salmonicida (strain A449) GN=tsaC PE=3 SV=1 146 303 6.0E-10
sp|Q7VQB9|TSAC_BLOFL Threonylcarbamoyl-AMP synthase OS=Blochmannia floridanus GN=tsaC PE=3 SV=1 149 295 1.0E-09
sp|B0BQ80|TSAC_ACTPJ Threonylcarbamoyl-AMP synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=tsaC PE=3 SV=1 140 300 4.0E-09
sp|B3GY27|TSAC_ACTP7 Threonylcarbamoyl-AMP synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=tsaC PE=3 SV=2 140 300 4.0E-09
sp|A3N1E4|TSAC_ACTP2 Threonylcarbamoyl-AMP synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=tsaC PE=3 SV=1 140 300 5.0E-09
sp|A5EW39|TSAC_DICNV Threonylcarbamoyl-AMP synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=tsaC PE=3 SV=1 149 301 9.0E-09
sp|Q2SQW8|TSAC_HAHCH Threonylcarbamoyl-AMP synthase OS=Hahella chejuensis (strain KCTC 2396) GN=tsaC PE=3 SV=1 143 276 1.0E-08
sp|Q4FPS7|TSAC_PSYA2 Threonylcarbamoyl-AMP synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=tsaC PE=3 SV=1 132 281 3.0E-08
sp|C1D9T5|TSAC_LARHH Threonylcarbamoyl-AMP synthase OS=Laribacter hongkongensis (strain HLHK9) GN=tsaC PE=3 SV=1 153 316 4.0E-08
sp|Q7VNS3|TSAC_HAEDU Threonylcarbamoyl-AMP synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=tsaC PE=3 SV=1 150 281 4.0E-08
sp|Q493I0|TSAC_BLOPB Threonylcarbamoyl-AMP synthase OS=Blochmannia pennsylvanicus (strain BPEN) GN=tsaC PE=3 SV=1 149 300 4.0E-08
sp|Q9CLG4|TSAC_PASMU Threonylcarbamoyl-AMP synthase OS=Pasteurella multocida (strain Pm70) GN=tsaC PE=3 SV=1 149 300 1.0E-07
sp|P0AFR6|YCIO_SHIFL Uncharacterized protein YciO OS=Shigella flexneri GN=yciO PE=3 SV=1 143 321 2.0E-07
sp|P0AFR4|YCIO_ECOLI Uncharacterized protein YciO OS=Escherichia coli (strain K12) GN=yciO PE=1 SV=1 143 321 2.0E-07
sp|P0AFR5|YCIO_ECOL6 Uncharacterized protein YciO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yciO PE=3 SV=1 143 321 2.0E-07
sp|Q1LT55|TSAC_BAUCH Threonylcarbamoyl-AMP synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tsaC PE=3 SV=1 138 285 4.0E-07
sp|A6VT87|TSAC_MARMS Threonylcarbamoyl-AMP synthase OS=Marinomonas sp. (strain MWYL1) GN=tsaC PE=3 SV=1 150 303 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003725 double-stranded RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0003723 RNA binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|073440
MLPDHPRLYRSLLRELTRAAPSKPNRTIVSNLRALLEQSRLQDARNALLFLKSQREHQTLVERYNPLSSLTEQER
IRKTANRIANMCTQMMLLDLLMFIWRTLRRSFARCFARSPTRLLACDPRSISFQPLLSISAPKTLHALNLAAAHL
RDADVVAFPTETVYGLGALALNPRAAKKIFSTKGRPADNPLIVHVSSSDMLNSFLPKGYTMSPAYHVLTKHFWPG
ALTLLFPRDPDLVPDIITAGHPSVAVRMPSHPVARALIELTGSPLAAPSANTSGKPSPTKADHALHDLDGKVPLI
LDGGPCTVGVESTVVDGLHQDGNIRILRPGGITVEDIQRVLKLELPEDTVPKVLVHRRDYQDEAMEQTPTTPGMK
YRHYSPSVPVTLLHTSTQPSAGQRSISATSFFSTFHDAGTKPKIGILAPADSKLWQHIDSERGVQWHKGDFRGKG
RACCHEPSSQGSRGVEMDTLRLLVKII*
Coding >Agabi119p4|073440
ATGCTTCCCGACCACCCGCGCCTCTACCGCTCCCTCCTCCGCGAGCTCACCCGTGCGGCCCCCTCAAAGCCCAAC
CGGACCATCGTTTCCAACCTTCGTGCCCTGCTCGAGCAATCCCGGCTACAGGACGCCAGAAATGCACTCTTGTTC
CTCAAATCTCAGAGGGAACACCAGACCTTGGTGGAGAGATATAACCCATTGAGCTCGCTGACCGAGCAGGAACGG
ATTCGAAAGACGGCGAATCGGATCGCAAACATGTGCACACAAATGATGTTGTTGGACTTGTTGATGTTCATCTGG
CGCACGCTGAGGCGCTCCTTTGCTCGCTGTTTCGCCCGTTCTCCAACTCGCCTCCTTGCCTGCGATCCCCGCTCA
ATATCTTTCCAGCCTCTCTTGAGCATATCCGCCCCCAAGACCCTCCACGCCCTCAATCTCGCTGCGGCCCACCTC
CGCGATGCTGACGTCGTTGCATTTCCCACAGAAACTGTCTACGGCCTCGGCGCACTCGCGCTCAATCCACGGGCA
GCCAAAAAAATATTCTCTACCAAGGGAAGACCCGCAGATAACCCGCTGATCGTCCATGTCTCTTCCTCCGACATG
CTCAATTCTTTTCTTCCGAAAGGATATACCATGTCCCCAGCCTATCACGTCCTGACAAAACATTTTTGGCCCGGA
GCCCTCACCCTGCTATTTCCGCGAGATCCCGATCTCGTACCAGACATCATCACAGCCGGCCACCCTTCAGTCGCA
GTCCGCATGCCTTCCCATCCTGTCGCTCGCGCCCTTATCGAATTGACAGGCAGTCCTCTGGCTGCTCCCAGTGCA
AACACCTCCGGCAAACCCAGTCCGACCAAGGCAGATCACGCTCTCCATGATCTTGACGGAAAGGTTCCCTTGATA
CTCGATGGAGGTCCATGCACTGTTGGCGTCGAGAGCACAGTTGTCGATGGCTTACACCAGGATGGCAATATTCGC
ATCCTACGACCTGGCGGAATCACCGTAGAAGACATCCAACGTGTCCTCAAACTCGAATTGCCCGAAGACACAGTA
CCCAAGGTCCTTGTACACCGGAGGGATTACCAGGATGAGGCAATGGAGCAGACACCAACGACTCCAGGCATGAAA
TACCGACATTATTCGCCCTCTGTTCCAGTCACTCTTCTTCACACCTCAACTCAACCGTCGGCCGGGCAAAGGTCT
ATCTCCGCTACCTCTTTCTTCTCCACCTTCCATGACGCTGGTACCAAGCCAAAGATTGGAATACTAGCACCGGCA
GATTCAAAACTCTGGCAGCACATTGACTCTGAGCGTGGCGTTCAATGGCACAAAGGAGATTTTAGAGGAAAGGGA
AGGGCTTGCTGTCATGAACCGAGTTCGCAAGGCAGCAGGGGAGTCGAGATGGATACATTACGACTCCTAGTAAAA
ATTATATAG
Transcript >Agabi119p4|073440
ATGCTTCCCGACCACCCGCGCCTCTACCGCTCCCTCCTCCGCGAGCTCACCCGTGCGGCCCCCTCAAAGCCCAAC
CGGACCATCGTTTCCAACCTTCGTGCCCTGCTCGAGCAATCCCGGCTACAGGACGCCAGAAATGCACTCTTGTTC
CTCAAATCTCAGAGGGAACACCAGACCTTGGTGGAGAGATATAACCCATTGAGCTCGCTGACCGAGCAGGAACGG
ATTCGAAAGACGGCGAATCGGATCGCAAACATGTGCACACAAATGATGTTGTTGGACTTGTTGATGTTCATCTGG
CGCACGCTGAGGCGCTCCTTTGCTCGCTGTTTCGCCCGTTCTCCAACTCGCCTCCTTGCCTGCGATCCCCGCTCA
ATATCTTTCCAGCCTCTCTTGAGCATATCCGCCCCCAAGACCCTCCACGCCCTCAATCTCGCTGCGGCCCACCTC
CGCGATGCTGACGTCGTTGCATTTCCCACAGAAACTGTCTACGGCCTCGGCGCACTCGCGCTCAATCCACGGGCA
GCCAAAAAAATATTCTCTACCAAGGGAAGACCCGCAGATAACCCGCTGATCGTCCATGTCTCTTCCTCCGACATG
CTCAATTCTTTTCTTCCGAAAGGATATACCATGTCCCCAGCCTATCACGTCCTGACAAAACATTTTTGGCCCGGA
GCCCTCACCCTGCTATTTCCGCGAGATCCCGATCTCGTACCAGACATCATCACAGCCGGCCACCCTTCAGTCGCA
GTCCGCATGCCTTCCCATCCTGTCGCTCGCGCCCTTATCGAATTGACAGGCAGTCCTCTGGCTGCTCCCAGTGCA
AACACCTCCGGCAAACCCAGTCCGACCAAGGCAGATCACGCTCTCCATGATCTTGACGGAAAGGTTCCCTTGATA
CTCGATGGAGGTCCATGCACTGTTGGCGTCGAGAGCACAGTTGTCGATGGCTTACACCAGGATGGCAATATTCGC
ATCCTACGACCTGGCGGAATCACCGTAGAAGACATCCAACGTGTCCTCAAACTCGAATTGCCCGAAGACACAGTA
CCCAAGGTCCTTGTACACCGGAGGGATTACCAGGATGAGGCAATGGAGCAGACACCAACGACTCCAGGCATGAAA
TACCGACATTATTCGCCCTCTGTTCCAGTCACTCTTCTTCACACCTCAACTCAACCGTCGGCCGGGCAAAGGTCT
ATCTCCGCTACCTCTTTCTTCTCCACCTTCCATGACGCTGGTACCAAGCCAAAGATTGGAATACTAGCACCGGCA
GATTCAAAACTCTGGCAGCACATTGACTCTGAGCGTGGCGTTCAATGGCACAAAGGAGATTTTAGAGGAAAGGGA
AGGGCTTGCTGTCATGAACCGAGTTCGCAAGGCAGCAGGGGAGTCGAGATGGATACATTACGACTCCTAGTAAAA
ATTATATAG
Gene >Agabi119p4|073440
ATGCTTCCCGACCACCCGCGCCTCTACCGCTCCCTCCTCCGCGAGCTCACCCGTGCGGTGAGTAGTCCCTAAACT
GTATTCAACCATTTCTCACCCCCAGCAGGCCCCCTCAAAGCCCAACCGGACCATCGTTTCCAACCTTCGTGCCCT
GCTCGAGCAATCCCGGCTACAGGACGCCAGAAATGCACTCTTGTTCCTCAAATCTCAGAGGGAACACCAGGTCCG
GTTTCCCATTCTCTCTCTCTCTCACACGACTGACCTGCCACCGCAGACCTTGGTGGAGAGATATAACCCATTGAG
CTCGCTGACCGAGCAGGAACGGATTCGAAAGACGGCGAATCGGGTCGGACTCGATGTGCCGAAGGCATCGACTAG
GCTACTGTAGTACAGTAGATCGCAAACATGTGCACACAAATGATGTTGTTGGACTTGTTGATGTTCATCTGGCGC
ACGCTGAGGCGCTCCTTTGCTCGCTGTTTCGCCCGTTCTCCAACTCGCCTCCTTGCCTGCGATCCCCGCTCAATA
TCTTTCCAGCCTCTCTTGAGCATATCCGCCCCCAAGACCCTCCACGCCCTCAATCTCGCTGCGGCCCACCTCCGC
GATGCTGACGTCGTTGCATTTCCCACAGAAACTGTCTACGGCCTCGGCGCACTCGCGCTCAATCCACGGGCAGCC
AAAAAAATATTCTCTACCAAGGGAAGACCCGCAGATAACCCGCTGATCGTCCATGTCTCTTCCTCCGACATGCTC
AATTCTTTTCTTCCGAAAGGATATACCATGTCCCCAGCCTATCACGTCCTGACAAAACATTTTTGGCCCGGAGCC
CTCACCCTGCTATTTCCGCGAGATCCCGATCTCGTACCAGACATCATCACAGCCGGCCACCCTTCAGTCGCAGTC
CGCATGCCTTCCCATCCTGTCGCTCGCGCCCTTATCGAATTGACAGGCAGTCCTCTGGCTGCTCCCAGTGCAAAC
ACCTCCGGCAAACCCAGTCCGACCAAGGCAGATCACGCTCTCCATGATCTTGACGGAAAGGTTCCCTTGATACTC
GATGGAGGTCCATGCACTGTTGGCGTCGAGAGCACAGTTGTCGATGGCTTACACCAGGATGGCAATATTCGCATC
CTACGACCTGGCGGAATCACCGTAGAAGACATCCAACGTGTCCTCAAACTCGAATTGCCCGAAGACACAGTACCC
AAGGTCCTTGTACACCGGAGGGATTACCAGGATGAGGCAATGGAGCAGACACCAACGACTCCAGGCATGAAATAC
CGACATTATTCGCCCTCTGTTCCAGTCACTCTTCTTCACACCTCAACTCAACCGTCGGCCGGGCAAAGGTCTATC
TCCGCTACCTCTTTCTTCTCCACCTTCCATGACGCTGGTACCAAGCCAAAGATTGGAATACTAGCACCGGCAGAT
TCAAAACTCTGGCAGCACATTGACTCTGAGCGTGGCGTTCAATGGCACAAGTATACCCTAGGACCAGTTGCTGAG
CCAGCAGTGACCGCGCGCCGTTTATTCGATGGACTACTAACATTGGAGCAGGAACACGTAGATTTCATTTTCATA
GAGGAGATTTTAGAGGAAAGGGAAGGGCTTGCTGTCATGAACCGAGTTCGCAAGGCAGCAGGGGAGTCGAGATGG
ATACATTACGACTCCTGTAAGTCTTTTATATGTCATTCGGTGCCAACATGTCATCTCACGTTGTCACCCACAGAG
TAAAAATTATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail