Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|073040
Gene name
Locationscaffold_04:1745080..1751500
Strand-
Gene length (bp)6420
Transcript length (bp)5526
Coding sequence length (bp)5526
Protein length (aa) 1842

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03836 RasGAP_C RasGAP C-terminus 7.7E-42 1621 1760
PF00616 RasGAP GTPase-activator protein for Ras-like GTPase 4.3E-35 1206 1410
PF00307 CH Calponin homology (CH) domain 6.8E-14 477 578
PF00612 IQ IQ calmodulin-binding motif 1.7E-01 655 670
PF00612 IQ IQ calmodulin-binding motif 2.7E-02 746 763
PF00612 IQ IQ calmodulin-binding motif 1.5E-02 868 884

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 658 1838 2.0E-161
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 960 1840 1.0E-110
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 926 1840 3.0E-108
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 926 1840 2.0E-107
sp|Q5AH02|IQG1_CANAL Ras GTPase-activating-like protein IQG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IQG1 PE=1 SV=1 467 1838 8.0E-105
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 658 1838 2.0E-161
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 960 1840 1.0E-110
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 926 1840 3.0E-108
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 926 1840 2.0E-107
sp|Q5AH02|IQG1_CANAL Ras GTPase-activating-like protein IQG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IQG1 PE=1 SV=1 467 1838 8.0E-105
sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 959 1840 1.0E-103
sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 926 1839 2.0E-98
sp|Q54K32|RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum GN=rgaA PE=1 SV=1 1041 1791 5.0E-63
sp|O00899|GAPA_DICDI Ras GTPase-activating-like protein gapA OS=Dictyostelium discoideum GN=gapA PE=1 SV=1 1041 1747 2.0E-50
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 454 626 1.0E-39
sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 451 631 2.0E-38
sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 467 630 2.0E-36
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 467 630 4.0E-36
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 467 630 1.0E-35
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 467 630 2.0E-35
sp|Q12280|IQG1_YEAST Ras GTPase-activating-like protein IQG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IQG1 PE=1 SV=1 680 1709 1.0E-26
sp|P33277|GAP1_SCHPO GTPase-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gap1 PE=3 SV=1 1058 1561 3.0E-26
sp|Q12280|IQG1_YEAST Ras GTPase-activating-like protein IQG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IQG1 PE=1 SV=1 443 644 9.0E-25
sp|Q10201|YBX7_SCHPO Uncharacterized protein C17D1.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC17D1.07c PE=3 SV=2 467 710 1.0E-13
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 651 884 6.0E-13
sp|P14318|MP20_DROME Muscle-specific protein 20 OS=Drosophila melanogaster GN=Mp20 PE=2 SV=2 476 575 1.0E-07
sp|P51911|CNN1_HUMAN Calponin-1 OS=Homo sapiens GN=CNN1 PE=1 SV=2 476 589 2.0E-07
sp|Q08290|CNN1_RAT Calponin-1 OS=Rattus norvegicus GN=Cnn1 PE=1 SV=1 476 589 2.0E-07
sp|Q08091|CNN1_MOUSE Calponin-1 OS=Mus musculus GN=Cnn1 PE=1 SV=1 476 589 2.0E-07
sp|Q9GK38|CNN1_MUSPF Calponin-1 OS=Mustela putorius furo GN=CNN1 PE=1 SV=1 476 589 3.0E-07
sp|Q08092|CNN1_PIG Calponin-1 OS=Sus scrofa GN=CNN1 PE=2 SV=1 476 589 3.0E-07
sp|Q7YRL2|CNN1_SHEEP Calponin-1 OS=Ovis aries GN=CNN1 PE=2 SV=1 476 589 3.0E-07
sp|Q2HJ38|CNN1_BOVIN Calponin-1 OS=Bos taurus GN=CNN1 PE=2 SV=1 476 589 3.0E-07
sp|Q24799|MYPH_ECHGR Myophilin OS=Echinococcus granulosus PE=2 SV=1 476 576 4.0E-06
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 805 924 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0043087 regulation of GTPase activity Yes
GO:0065009 regulation of molecular function No
GO:0051336 regulation of hydrolase activity No
GO:0065007 biological regulation No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0050790 regulation of catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|073040
MSTPNQVPQSSSKASSGGPFAYQKRLFERTSSIGAGSRLSRNNSQSGVGILTTPTGSSSTPIASRRWTPSHRPSS
SLDVLRGKWEERSREAEAEYDGHLKSSPVPEPLNSRSRALVPESSSSGTNSPSNASPTTSPSFPESQRTPTYLKR
RTLPEPIVASPLSPNSTGISVEADSPSSPSPHRIRIPPSTAQFKLPNSKHSSSDSTTPSRNIFSTPSAQSSYESL
KASPVRQHSPLRSLNAFSSVSPSTTRAATPEFDTKSSPRSPPSQLVNDVFSSTSSTSVPKKSAQQSFYTPSRNNL
GRNASVASLSEDKASTSLSGRPSVMSPTPYRSSYMSSKKASTYGDNLIIGRRMGRHLPRIASGDGDENENDSNLV
EEQKQFQGSYEPLSLRAEEKRKERPHTNAPVSPSRNQSAPGIAGLPVPDAEGVVGLPGRLQLKAPSDPTSPTPVS
RYYGTNWADTQRHFIQAYEYLCHVGEAHQWIEGCLEEEIGFDIVEMEEGLRNGVLLAKLVRVFHPQSVRRIFESS
NLRDYRHSDNINIFFGFVRDVGLPEGFIFELTDLYEKKNIPKVIYCIHALSHLLARRGLAQQIGNLIGHLHFSDD
DLQKTQKGLKESGVAMPNFSNVGKELAKEINEEPEPEVETEDERRQRLLIENTGSIVAVQALARGYLARRVRLNI
QARMRFAERHVVKLQTQCRGFSLRKKVCSLKREQQSLVPWVTAVQSIARAALVRRHWNAYLMKVKSTYPTVVKIQ
AQLRGVLQRRRFRQLQKALRFIDTPMTRLQAFARARITRTARTELKKTFAQPQIETSIVQFQALARGSIMRRALK
RQEHRLDKMSPVFSRLQGQLRGLVVRRHVRKQLTKLENAAEVIVRIQAAARTYLARKRLLILIRGLRRVTPLMIG
FQARARARISRQQHTSLVKALETPRNLKMVSSLQALARASLAKHRHIELKRKLDYVVPDVTNFQAATRGALIRNE
YYAWRDHLHRNAHVATTLQAMLLGASIRIRFKAKMDYYHANLNKVVKIQSLFRAKDTREQYRQLTMGTNVSIGTI
KNFVHLLDDSEADFQEEIKVERLRKQVVECIRENQGLENQVNNLDVTVALMVDNAKKRKGTDSATIHAARVKLLA
DHGDPFSGSSTVDHSARRKLELYQQLFFLLQTRGEYLSRLIWKLSQDGTPEPSKRFTERVILTLFGYGQDRREDF
LLLKLLQLAIRDEISTSNSIDDVIRNHPIYLNITVHYIRPKQSTLSREAFETIIKEVIESDDLDLEVDPTVLHQS
RIITQERRSGMASSIPKDVTFREALEYPETRAMYIRQLQLVQWWSDAFVNAITASTKKMPFSMRYLARETLLALK
EKFPNGSDEQYAACVGRLVYYRYISPIIMSPEIFEIVPKTVKIGARKNFAQVSKVLTQIMTGRDFGDDQPIYIPI
NDFVREASSRMSAWLLEVADVPDAESYFYAHEFLDVTVQPKPIYITPNEVYTMHGLLLRHLKAIAPQTNDPLNVI
LNELVGVPNLADEELKDARDTAITLELTNRFTTVKDPHAEEKTLWVQAKRGVLAILRVQPAQDLLESLMRPVTEQ
DESVWEDILEAEALNEQSRKHSRRQPSAVGNDAYRLEDIRTWRFTAVKALAITNLLELEKQGKITRDDGFQGILD
AIAGDVRSKHRKRMQRQHEMKSMKEALRHLQERKKNYEEQISSYQDHVQAAMNTMQQKKGKKRGFVIPFTKQFWH
VRELQKAGVTPKFGSYFYTAKDLYDKKVLLSIEQYSPRQYDKFHIKISSDSVGIFTLVLESTMLGITSKLATENI
RMEDLLQAKYEKQSCLVLFGGRVKVNFEPFLDEINQNFLGS*
Coding >Agabi119p4|073040
ATGAGCACTCCAAACCAAGTCCCACAATCCTCATCGAAAGCCTCGTCCGGAGGCCCGTTTGCATACCAGAAGCGC
TTATTTGAGCGAACGTCATCTATAGGGGCTGGTTCGCGATTATCGCGCAACAATTCTCAATCGGGGGTTGGCATC
CTCACCACTCCGACCGGCTCTTCCAGCACACCCATAGCATCTAGGAGATGGACACCCTCACACCGTCCTAGCAGT
AGTTTAGATGTCCTGAGAGGGAAATGGGAGGAACGATCCCGCGAAGCGGAAGCAGAATACGACGGTCACCTCAAA
TCCAGTCCCGTTCCAGAACCTCTGAATTCCAGAAGCCGAGCTCTTGTACCTGAAAGCTCGTCGAGCGGCACCAAT
AGTCCTTCGAATGCTAGTCCCACTACGTCGCCGTCCTTCCCTGAGAGCCAGAGAACTCCAACATATCTCAAGCGA
CGAACTTTGCCCGAACCCATCGTCGCTTCTCCACTGTCTCCCAATTCTACGGGTATCTCAGTTGAGGCTGATTCA
CCATCTTCACCATCTCCTCATCGCATTCGCATACCCCCATCTACTGCTCAGTTCAAATTACCAAACTCCAAGCAC
TCGTCTTCGGACTCTACTACGCCCTCACGGAATATCTTCTCGACTCCTAGTGCTCAATCCTCCTACGAGTCTCTG
AAGGCTTCCCCAGTTAGACAACATTCGCCTCTACGAAGCCTTAATGCGTTTTCGTCGGTTTCACCGTCAACGACT
CGCGCAGCTACTCCGGAATTCGACACAAAGTCATCTCCAAGATCACCTCCTTCGCAACTCGTAAATGATGTGTTC
TCATCGACATCTTCGACTTCAGTTCCCAAAAAGAGCGCTCAGCAATCGTTTTATACCCCCAGCCGTAATAACCTA
GGTCGCAATGCCTCAGTCGCATCTCTGAGCGAAGACAAAGCTTCTACTTCTCTATCTGGCCGCCCTTCCGTTATG
TCCCCCACTCCTTATCGGAGTTCATACATGTCAAGCAAGAAGGCCTCTACCTACGGTGATAACCTGATCATCGGT
CGCAGAATGGGAAGGCATCTACCACGGATAGCTAGTGGTGATGGTGACGAGAATGAAAACGATTCCAATCTTGTC
GAGGAACAAAAACAATTCCAAGGATCTTATGAGCCACTATCGTTGAGGGCGGAAGAGAAACGTAAAGAAAGGCCT
CACACAAACGCTCCTGTGTCGCCCTCCCGTAATCAAAGTGCTCCTGGGATAGCTGGTCTTCCTGTTCCCGATGCT
GAGGGCGTCGTCGGACTCCCTGGACGCCTACAGCTCAAAGCGCCGAGTGATCCCACCTCTCCCACTCCTGTTTCT
CGATATTATGGGACTAACTGGGCGGATACGCAGCGACACTTCATTCAAGCATATGAATATCTTTGTCACGTTGGG
GAAGCACATCAATGGATTGAAGGGTGTCTTGAGGAGGAGATAGGCTTCGATATCGTGGAGATGGAAGAGGGTCTC
CGCAATGGCGTTCTTCTCGCGAAACTTGTGCGCGTCTTCCATCCACAATCTGTAAGACGCATCTTCGAGTCCTCC
AACCTTCGCGACTATCGCCATTCGGACAACATCAACATATTTTTTGGCTTCGTACGTGATGTTGGACTGCCTGAG
GGCTTTATATTTGAACTTACAGATCTCTACGAGAAAAAGAACATACCAAAAGTCATATACTGCATCCATGCCCTG
AGTCACCTTCTTGCGCGTCGTGGATTGGCTCAACAGATTGGCAACTTGATAGGACATCTGCATTTCTCTGACGAT
GATTTGCAGAAAACGCAAAAGGGATTGAAAGAGTCTGGAGTTGCTATGCCCAATTTCAGCAATGTTGGGAAAGAA
TTAGCCAAGGAGATTAATGAAGAGCCAGAGCCAGAGGTGGAGACCGAGGACGAACGTCGTCAAAGGCTTTTGATT
GAAAACACAGGTTCCATTGTTGCCGTCCAGGCATTGGCTCGTGGCTACCTCGCAAGGCGTGTGCGCCTAAATATC
CAAGCTCGCATGAGGTTTGCTGAGCGACACGTTGTAAAGCTCCAAACACAATGTCGAGGTTTCTCGTTGCGGAAA
AAGGTTTGTTCTCTGAAGCGGGAGCAACAGAGTCTTGTTCCTTGGGTAACTGCAGTCCAATCAATTGCTCGAGCA
GCTCTTGTGAGACGCCACTGGAATGCTTACTTGATGAAGGTCAAATCGACCTATCCAACGGTTGTCAAGATCCAG
GCTCAGCTTCGAGGAGTTTTACAACGTCGCCGCTTCCGCCAACTTCAGAAAGCACTACGATTCATTGACACCCCT
ATGACGCGTCTCCAAGCGTTCGCTCGTGCTCGTATAACGAGGACAGCGCGAACGGAACTTAAGAAGACTTTCGCT
CAGCCTCAAATTGAGACTTCTATTGTTCAATTCCAAGCACTTGCTCGTGGTTCGATTATGCGACGAGCTTTGAAA
AGACAAGAACACAGGCTGGATAAAATGAGCCCAGTATTCAGTAGGCTACAGGGACAACTTCGCGGTCTCGTTGTA
CGTCGTCATGTCCGGAAGCAGTTGACTAAGTTAGAAAACGCGGCAGAAGTCATCGTACGCATACAAGCCGCCGCC
CGTACTTATCTTGCTCGGAAACGCTTGCTGATTCTTATTCGTGGATTGCGTCGCGTCACTCCTCTTATGATCGGT
TTCCAAGCCCGTGCTCGGGCGAGAATCTCCCGTCAGCAACACACGAGCCTGGTGAAAGCACTCGAAACACCCAGG
AACTTGAAAATGGTTTCATCGCTTCAGGCTCTTGCACGGGCCAGCTTGGCGAAGCACCGTCACATTGAACTAAAG
CGGAAGTTGGATTACGTTGTTCCCGATGTCACCAACTTTCAAGCCGCTACACGTGGTGCCTTGATCAGAAACGAA
TATTATGCATGGCGGGATCACTTGCACCGTAATGCGCATGTTGCCACTACTCTTCAAGCTATGTTACTCGGCGCT
TCTATTCGAATTCGATTCAAGGCCAAGATGGATTACTATCATGCCAATCTCAATAAAGTCGTAAAAATCCAATCT
TTATTTCGCGCAAAAGATACTCGCGAGCAATATCGCCAACTCACGATGGGGACCAACGTCTCCATCGGTACGATC
AAAAATTTCGTCCATCTACTTGACGACTCTGAGGCCGATTTCCAGGAGGAAATCAAAGTAGAAAGGTTGAGAAAG
CAAGTTGTAGAGTGCATTCGCGAGAATCAAGGCCTCGAAAATCAGGTTAATAACCTGGATGTCACGGTTGCCCTT
ATGGTAGACAACGCGAAGAAACGTAAAGGAACTGACAGTGCTACTATACATGCCGCCAGGGTCAAACTTCTTGCT
GATCATGGGGACCCCTTCTCCGGATCCAGTACTGTGGATCACTCTGCCAGGCGAAAGCTGGAACTGTATCAACAG
CTATTCTTCCTTTTGCAAACTCGTGGCGAGTATCTGAGTCGTTTAATCTGGAAGCTTTCCCAAGATGGCACCCCC
GAGCCTAGTAAAAGATTCACAGAACGCGTTATTTTGACGCTTTTTGGTTATGGTCAGGACCGCCGCGAGGATTTT
CTTCTACTGAAGCTACTACAGCTTGCGATTCGGGACGAGATCTCAACGTCCAATAGCATTGATGACGTTATTCGG
AATCATCCTATCTACCTCAATATCACGGTCCATTACATTAGACCAAAGCAGAGCACATTGTCCCGTGAAGCTTTT
GAGACGATCATCAAAGAAGTCATTGAATCCGACGATCTCGACCTAGAAGTTGATCCTACTGTGCTGCATCAATCG
CGCATAATAACGCAAGAGCGTAGATCTGGTATGGCAAGTTCCATACCCAAAGATGTGACATTTAGGGAGGCTCTT
GAATACCCCGAAACAAGGGCGATGTACATTCGCCAACTTCAGCTCGTGCAATGGTGGTCAGACGCCTTTGTGAAC
GCCATCACAGCTTCAACAAAGAAGATGCCTTTCAGTATGAGATATCTTGCTCGAGAAACCTTGCTCGCCTTAAAG
GAGAAATTTCCGAATGGCTCGGATGAACAATATGCGGCGTGCGTGGGACGCTTGGTGTATTATCGTTACATCTCC
CCAATCATCATGTCCCCAGAAATCTTCGAGATTGTCCCTAAAACGGTCAAAATCGGAGCACGAAAGAACTTTGCC
CAGGTCTCCAAGGTATTGACCCAGATCATGACTGGTAGAGATTTCGGAGATGATCAACCCATCTATATCCCTATC
AATGATTTTGTCCGCGAAGCCTCAAGTCGCATGTCCGCCTGGCTTTTGGAAGTGGCCGATGTGCCGGATGCGGAG
TCTTACTTCTACGCGCACGAATTCTTAGACGTCACCGTGCAGCCAAAACCCATCTATATAACTCCTAACGAAGTG
TATACAATGCATGGACTTCTCCTACGACATCTCAAAGCCATCGCACCTCAAACCAACGACCCTCTAAATGTCATC
CTGAATGAACTTGTGGGAGTCCCGAACCTTGCAGACGAGGAGCTTAAGGATGCTAGGGACACCGCTATCACGCTC
GAGCTAACCAATCGATTTACGACCGTCAAAGACCCACATGCCGAAGAAAAAACACTGTGGGTCCAGGCCAAACGC
GGAGTTTTAGCAATTCTTCGAGTACAGCCTGCTCAAGACCTCTTGGAGTCATTGATGCGTCCGGTTACAGAACAA
GATGAGTCTGTCTGGGAGGACATTCTCGAGGCGGAAGCTTTGAATGAGCAAAGCCGTAAACATTCAAGGCGACAA
CCTTCTGCTGTCGGCAATGACGCTTACAGATTAGAAGACATAAGAACGTGGAGGTTTACGGCAGTCAAAGCATTG
GCTATCACCAATCTTTTAGAGCTGGAGAAACAAGGCAAAATAACACGAGACGATGGTTTTCAAGGAATCTTGGAT
GCAATTGCTGGCGATGTACGAAGCAAACACCGAAAACGTATGCAACGGCAACATGAGATGAAGAGCATGAAGGAA
GCACTACGCCATCTTCAAGAAAGAAAGAAAAATTACGAAGAGCAAATAAGCAGTTACCAGGATCATGTACAGGCT
GCTATGAATACAATGCAGCAGAAGAAAGGAAAGAAGCGCGGATTCGTTATTCCTTTTACCAAACAATTTTGGCAT
GTTCGGGAGCTACAGAAGGCTGGGGTCACTCCTAAATTTGGGTCGTACTTTTACACTGCCAAGGACCTTTATGAT
AAGAAGGTCTTGCTATCCATCGAGCAATATTCACCTCGTCAATACGACAAATTTCACATTAAGATCTCGTCCGAC
TCCGTTGGCATATTCACACTCGTACTGGAGTCAACGATGCTGGGAATAACGAGTAAGCTTGCAACGGAAAACATT
CGGATGGAGGATCTGCTGCAGGCAAAATACGAGAAGCAGTCTTGCTTGGTGTTGTTTGGAGGAAGAGTCAAGGTC
AATTTTGAGCCCTTTCTTGACGAGATCAACCAAAATTTCTTGGGATCATAA
Transcript >Agabi119p4|073040
ATGAGCACTCCAAACCAAGTCCCACAATCCTCATCGAAAGCCTCGTCCGGAGGCCCGTTTGCATACCAGAAGCGC
TTATTTGAGCGAACGTCATCTATAGGGGCTGGTTCGCGATTATCGCGCAACAATTCTCAATCGGGGGTTGGCATC
CTCACCACTCCGACCGGCTCTTCCAGCACACCCATAGCATCTAGGAGATGGACACCCTCACACCGTCCTAGCAGT
AGTTTAGATGTCCTGAGAGGGAAATGGGAGGAACGATCCCGCGAAGCGGAAGCAGAATACGACGGTCACCTCAAA
TCCAGTCCCGTTCCAGAACCTCTGAATTCCAGAAGCCGAGCTCTTGTACCTGAAAGCTCGTCGAGCGGCACCAAT
AGTCCTTCGAATGCTAGTCCCACTACGTCGCCGTCCTTCCCTGAGAGCCAGAGAACTCCAACATATCTCAAGCGA
CGAACTTTGCCCGAACCCATCGTCGCTTCTCCACTGTCTCCCAATTCTACGGGTATCTCAGTTGAGGCTGATTCA
CCATCTTCACCATCTCCTCATCGCATTCGCATACCCCCATCTACTGCTCAGTTCAAATTACCAAACTCCAAGCAC
TCGTCTTCGGACTCTACTACGCCCTCACGGAATATCTTCTCGACTCCTAGTGCTCAATCCTCCTACGAGTCTCTG
AAGGCTTCCCCAGTTAGACAACATTCGCCTCTACGAAGCCTTAATGCGTTTTCGTCGGTTTCACCGTCAACGACT
CGCGCAGCTACTCCGGAATTCGACACAAAGTCATCTCCAAGATCACCTCCTTCGCAACTCGTAAATGATGTGTTC
TCATCGACATCTTCGACTTCAGTTCCCAAAAAGAGCGCTCAGCAATCGTTTTATACCCCCAGCCGTAATAACCTA
GGTCGCAATGCCTCAGTCGCATCTCTGAGCGAAGACAAAGCTTCTACTTCTCTATCTGGCCGCCCTTCCGTTATG
TCCCCCACTCCTTATCGGAGTTCATACATGTCAAGCAAGAAGGCCTCTACCTACGGTGATAACCTGATCATCGGT
CGCAGAATGGGAAGGCATCTACCACGGATAGCTAGTGGTGATGGTGACGAGAATGAAAACGATTCCAATCTTGTC
GAGGAACAAAAACAATTCCAAGGATCTTATGAGCCACTATCGTTGAGGGCGGAAGAGAAACGTAAAGAAAGGCCT
CACACAAACGCTCCTGTGTCGCCCTCCCGTAATCAAAGTGCTCCTGGGATAGCTGGTCTTCCTGTTCCCGATGCT
GAGGGCGTCGTCGGACTCCCTGGACGCCTACAGCTCAAAGCGCCGAGTGATCCCACCTCTCCCACTCCTGTTTCT
CGATATTATGGGACTAACTGGGCGGATACGCAGCGACACTTCATTCAAGCATATGAATATCTTTGTCACGTTGGG
GAAGCACATCAATGGATTGAAGGGTGTCTTGAGGAGGAGATAGGCTTCGATATCGTGGAGATGGAAGAGGGTCTC
CGCAATGGCGTTCTTCTCGCGAAACTTGTGCGCGTCTTCCATCCACAATCTGTAAGACGCATCTTCGAGTCCTCC
AACCTTCGCGACTATCGCCATTCGGACAACATCAACATATTTTTTGGCTTCGTACGTGATGTTGGACTGCCTGAG
GGCTTTATATTTGAACTTACAGATCTCTACGAGAAAAAGAACATACCAAAAGTCATATACTGCATCCATGCCCTG
AGTCACCTTCTTGCGCGTCGTGGATTGGCTCAACAGATTGGCAACTTGATAGGACATCTGCATTTCTCTGACGAT
GATTTGCAGAAAACGCAAAAGGGATTGAAAGAGTCTGGAGTTGCTATGCCCAATTTCAGCAATGTTGGGAAAGAA
TTAGCCAAGGAGATTAATGAAGAGCCAGAGCCAGAGGTGGAGACCGAGGACGAACGTCGTCAAAGGCTTTTGATT
GAAAACACAGGTTCCATTGTTGCCGTCCAGGCATTGGCTCGTGGCTACCTCGCAAGGCGTGTGCGCCTAAATATC
CAAGCTCGCATGAGGTTTGCTGAGCGACACGTTGTAAAGCTCCAAACACAATGTCGAGGTTTCTCGTTGCGGAAA
AAGGTTTGTTCTCTGAAGCGGGAGCAACAGAGTCTTGTTCCTTGGGTAACTGCAGTCCAATCAATTGCTCGAGCA
GCTCTTGTGAGACGCCACTGGAATGCTTACTTGATGAAGGTCAAATCGACCTATCCAACGGTTGTCAAGATCCAG
GCTCAGCTTCGAGGAGTTTTACAACGTCGCCGCTTCCGCCAACTTCAGAAAGCACTACGATTCATTGACACCCCT
ATGACGCGTCTCCAAGCGTTCGCTCGTGCTCGTATAACGAGGACAGCGCGAACGGAACTTAAGAAGACTTTCGCT
CAGCCTCAAATTGAGACTTCTATTGTTCAATTCCAAGCACTTGCTCGTGGTTCGATTATGCGACGAGCTTTGAAA
AGACAAGAACACAGGCTGGATAAAATGAGCCCAGTATTCAGTAGGCTACAGGGACAACTTCGCGGTCTCGTTGTA
CGTCGTCATGTCCGGAAGCAGTTGACTAAGTTAGAAAACGCGGCAGAAGTCATCGTACGCATACAAGCCGCCGCC
CGTACTTATCTTGCTCGGAAACGCTTGCTGATTCTTATTCGTGGATTGCGTCGCGTCACTCCTCTTATGATCGGT
TTCCAAGCCCGTGCTCGGGCGAGAATCTCCCGTCAGCAACACACGAGCCTGGTGAAAGCACTCGAAACACCCAGG
AACTTGAAAATGGTTTCATCGCTTCAGGCTCTTGCACGGGCCAGCTTGGCGAAGCACCGTCACATTGAACTAAAG
CGGAAGTTGGATTACGTTGTTCCCGATGTCACCAACTTTCAAGCCGCTACACGTGGTGCCTTGATCAGAAACGAA
TATTATGCATGGCGGGATCACTTGCACCGTAATGCGCATGTTGCCACTACTCTTCAAGCTATGTTACTCGGCGCT
TCTATTCGAATTCGATTCAAGGCCAAGATGGATTACTATCATGCCAATCTCAATAAAGTCGTAAAAATCCAATCT
TTATTTCGCGCAAAAGATACTCGCGAGCAATATCGCCAACTCACGATGGGGACCAACGTCTCCATCGGTACGATC
AAAAATTTCGTCCATCTACTTGACGACTCTGAGGCCGATTTCCAGGAGGAAATCAAAGTAGAAAGGTTGAGAAAG
CAAGTTGTAGAGTGCATTCGCGAGAATCAAGGCCTCGAAAATCAGGTTAATAACCTGGATGTCACGGTTGCCCTT
ATGGTAGACAACGCGAAGAAACGTAAAGGAACTGACAGTGCTACTATACATGCCGCCAGGGTCAAACTTCTTGCT
GATCATGGGGACCCCTTCTCCGGATCCAGTACTGTGGATCACTCTGCCAGGCGAAAGCTGGAACTGTATCAACAG
CTATTCTTCCTTTTGCAAACTCGTGGCGAGTATCTGAGTCGTTTAATCTGGAAGCTTTCCCAAGATGGCACCCCC
GAGCCTAGTAAAAGATTCACAGAACGCGTTATTTTGACGCTTTTTGGTTATGGTCAGGACCGCCGCGAGGATTTT
CTTCTACTGAAGCTACTACAGCTTGCGATTCGGGACGAGATCTCAACGTCCAATAGCATTGATGACGTTATTCGG
AATCATCCTATCTACCTCAATATCACGGTCCATTACATTAGACCAAAGCAGAGCACATTGTCCCGTGAAGCTTTT
GAGACGATCATCAAAGAAGTCATTGAATCCGACGATCTCGACCTAGAAGTTGATCCTACTGTGCTGCATCAATCG
CGCATAATAACGCAAGAGCGTAGATCTGGTATGGCAAGTTCCATACCCAAAGATGTGACATTTAGGGAGGCTCTT
GAATACCCCGAAACAAGGGCGATGTACATTCGCCAACTTCAGCTCGTGCAATGGTGGTCAGACGCCTTTGTGAAC
GCCATCACAGCTTCAACAAAGAAGATGCCTTTCAGTATGAGATATCTTGCTCGAGAAACCTTGCTCGCCTTAAAG
GAGAAATTTCCGAATGGCTCGGATGAACAATATGCGGCGTGCGTGGGACGCTTGGTGTATTATCGTTACATCTCC
CCAATCATCATGTCCCCAGAAATCTTCGAGATTGTCCCTAAAACGGTCAAAATCGGAGCACGAAAGAACTTTGCC
CAGGTCTCCAAGGTATTGACCCAGATCATGACTGGTAGAGATTTCGGAGATGATCAACCCATCTATATCCCTATC
AATGATTTTGTCCGCGAAGCCTCAAGTCGCATGTCCGCCTGGCTTTTGGAAGTGGCCGATGTGCCGGATGCGGAG
TCTTACTTCTACGCGCACGAATTCTTAGACGTCACCGTGCAGCCAAAACCCATCTATATAACTCCTAACGAAGTG
TATACAATGCATGGACTTCTCCTACGACATCTCAAAGCCATCGCACCTCAAACCAACGACCCTCTAAATGTCATC
CTGAATGAACTTGTGGGAGTCCCGAACCTTGCAGACGAGGAGCTTAAGGATGCTAGGGACACCGCTATCACGCTC
GAGCTAACCAATCGATTTACGACCGTCAAAGACCCACATGCCGAAGAAAAAACACTGTGGGTCCAGGCCAAACGC
GGAGTTTTAGCAATTCTTCGAGTACAGCCTGCTCAAGACCTCTTGGAGTCATTGATGCGTCCGGTTACAGAACAA
GATGAGTCTGTCTGGGAGGACATTCTCGAGGCGGAAGCTTTGAATGAGCAAAGCCGTAAACATTCAAGGCGACAA
CCTTCTGCTGTCGGCAATGACGCTTACAGATTAGAAGACATAAGAACGTGGAGGTTTACGGCAGTCAAAGCATTG
GCTATCACCAATCTTTTAGAGCTGGAGAAACAAGGCAAAATAACACGAGACGATGGTTTTCAAGGAATCTTGGAT
GCAATTGCTGGCGATGTACGAAGCAAACACCGAAAACGTATGCAACGGCAACATGAGATGAAGAGCATGAAGGAA
GCACTACGCCATCTTCAAGAAAGAAAGAAAAATTACGAAGAGCAAATAAGCAGTTACCAGGATCATGTACAGGCT
GCTATGAATACAATGCAGCAGAAGAAAGGAAAGAAGCGCGGATTCGTTATTCCTTTTACCAAACAATTTTGGCAT
GTTCGGGAGCTACAGAAGGCTGGGGTCACTCCTAAATTTGGGTCGTACTTTTACACTGCCAAGGACCTTTATGAT
AAGAAGGTCTTGCTATCCATCGAGCAATATTCACCTCGTCAATACGACAAATTTCACATTAAGATCTCGTCCGAC
TCCGTTGGCATATTCACACTCGTACTGGAGTCAACGATGCTGGGAATAACGAGTAAGCTTGCAACGGAAAACATT
CGGATGGAGGATCTGCTGCAGGCAAAATACGAGAAGCAGTCTTGCTTGGTGTTGTTTGGAGGAAGAGTCAAGGTC
AATTTTGAGCCCTTTCTTGACGAGATCAACCAAAATTTCTTGGGATCATAA
Gene >Agabi119p4|073040
ATGAGCACTCCAAACCAAGTCCCACAATCCTCATCGAAAGCCTCGTCCGGAGGCCCGTTTGCATACCAGAAGCGC
TTATTTGAGCGAACGTCATCTATAGGGGCTGGTTCGCGATTATCGCGCAACAATTCTCAATCGGGGGTTGGCATC
CTCACCACTCCGACCGGCTCTTCCAGCACACCCATAGCATCTAGGAGATGGACACCCTCACACCGTCCTAGCAGT
AGTTTAGATGTCCTGAGAGGGAAATGGGAGGAACGATCCCGCGAAGCGGAAGCAGAATACGACGGTCACCTCAAA
TCCAGTCCCGTTCCAGAACCTCTGAATTCCAGAAGCCGAGCTCTTGTACCTGAAAGCTCGTCGAGCGGCACCAAT
AGTCCTTCGAATGCTAGTCCCACTACGTCGCCGTCCTTCCCTGAGAGCCAGAGAACTCCAACATATCTCAAGCGA
CGAACTTTGCCCGAACCCATCGTCGCTTCTCCACTGTCTCCCAATTCTACGGGTATCTCAGTTGAGGCTGATTCA
CCATCTTCACCATCTCCTCATCGCATTCGCATACCCCCATCTACTGCTCAGTTCAAATTACCAAACTCCAAGCAC
TCGTCTTCGGACTCTACTACGCCCTCACGGAATATCTTCTCGACTCCTAGTGCTCAATCCTCCTACGAGTCTCTG
AAGGCTTCCCCAGTTAGACAACATTCGCCTCTACGAAGCCTTAATGCGTTTTCGTCGGTTTCACCGTCAACGACT
CGCGCAGCTACTCCGGAATTCGACACAAAGTCATCTCCAAGATCACCTCCTTCGCAACTCGTAAATGATGTGTTC
TCATCGACATCTTCGACTTCAGTTCCCAGTATGTCAAGAAACAGATCAAGGTCGTTGTATGGCTCATCTGCCATC
TTATCAACCCCAGAAAAGAGCGCTCAGCAATCGTTTTATACCCCCAGCCGTAATAAGTCTGTTACATCTCTTGCA
AGCGATAAAGATTCTTCTGTGAAAGCTTTGCATAGCCTAGGTCGCAATGCCTCAGTCGCATCTCTGAGCGAAGAC
AAAGCTTCTACTTCTCTATCTGGCCGCCCTTCCGTTATGTCCCCCACTCCTTATCGGAGTTCATACATGTCAAGC
AAGAAGGCCTCTACCTACGGTGATAACCTGATCATCGGTCGCAGAATGGGAAGGCATCTACCACGGATAGCTAGT
GGTGATGGTGACGAGAATGAAAACGATTCCAATCTTGTCGAGGAACAAAAACAATTCCAAGGATCTTATGAGCCA
CTATCGTTGAGGGCGGAAGAGAAACGTAAAGAAAGGCCTCACACAAACGCTCCTGTGTCGCCCTCCCGTAATCAA
AGTGCTCCTGGGATAGCTGGTCTTCCTGTTCCCGATGCTGAGGGCGTCGTCGGACTCCCTGGACGCCTACAGCTC
AAAGCGCCGAGTGATCCCACCTCTCCCACTCCTGTTTCTCGATATTATGGGACTAACTGGGCGGATACGCAGCGA
CACTTCATTCAAGCATATGAATATCTTTGTCACGTTGGGGAAGCACATCAATGGATTGAAGGGTGTCTTGAGGAG
GAGATAGGCTTCGATATCGTGGAGATGGAAGAGGGTCTCCGCAATGGCGTTCTTCTCGCGAAACTTGTGCGCGTC
TTCCATCCACAATCTGTAAGACGCATCTTCGAGGTGGGTATCTATAGAGTTGCTAAGCAGAGGTAAACTGATGAA
ATACTAGTCCTCCAACCTTCGCGACTATCGCCATTCGGACAACATCAACATATTTTTTGGCTTCGTACGTGATGT
TGGACTGCCTGAGGTATGTTGGTTGAATGCAATATGAATTTGTTGATGACCAAAAGCAGGGCTTTATATTTGAAC
TTACAGATCTCTACGAGAAAAAGAACATACCAAAAGTCATATACTGCATCCATGCCCTGAGGTTTGCATCATACT
TATTAAATTCGGAATTGGGAATGTGTGCTCATAGGTCATTTTAGTCACCTTCTTGCGCGTCGTGGATTGGCTCAA
CAGATTGGCAACTTGATAGGACATCTGCATTTCTCTGACGATGATTTGCAGAAAACGCAAAAGGGATTGAAAGAG
TCTGGAGTTGCTATGCCCAATTTCAGCAATGTTGGGAAAGAATTAGCCAAGGAGATTAATGAAGAGCCAGAGCCA
GAGGTGGAGACCGAGGACGAACGTGAGCTTTTCTTCTTAGGTTGCATCGCCCATTCGTTTAACTCTTTTTAGGTC
GTCAAAGGCTTTTGATTGAAAACACAGGTTCCATTGTTGCCGTCCAGGCATTGGCTCGTGGCTACCTCGCAAGGC
GTGTGCGCCTAAATATCCAAGCTCGCATGAGGTTTGCTGAGCGACACGTTGTAAAGCTCCAAACACAATGTCGAG
GTTTCTCGTTGCGGAAAAAGGTTTGTTCTCTGAAGCGGGAGCAACAGAGTCTTGTTCCTTGGGTAACTGCAGTCC
AATCAATTGCTCGAGCAGCTCTTGTGAGACGCCACTGGAATGCTTACTTGATGAAGGTCAAATCGACCTATCCAA
CGGTTGTCAAGATCCAGGCTCAGCTTCGAGGAGTTTTACAACGTCGCCGCTTCCGCCAACTTCAGAAAGCACTAC
GATTCATTGACACCCCTATGACGCGTCTCCAAGCGTTCGCTCGTGCTCGTATAACGAGGACAGCGCGAACGGAAC
TTAAGAAGACTTTCGCTCAGCCTCAAATTGAGACTTCTATTGTTCAATTCCAAGCACTTGCTCGTGGTTCGATTA
TGCGACGAGCTTTGAAAAGACAAGAACACAGGCTGGATAAAATGAGCCCAGTATTCAGTAGGCTACAGGGACAAC
TTCGCGGTCTCGTTGTACGTCGTCATGTCCGGAAGCAGTTGACTAAGTTAGAAAACGCGGCAGAAGTCATCGTAC
GCATACAAGCCGCCGCCCGTACTTATCTTGCTCGGAAACGCTTGCTGATTCTTATTCGTGGATTGCGTCGCGTCA
CTCCTCTTATGATCGGTTTCCAAGCCCGTGCTCGGGCGAGAATCTCCCGTCAGCAACACACGAGCCTGGTGAAAG
CACTCGAAACACCCAGGAACTTGAAAATGGTTTCATCGCTTCAGGCTCTTGCACGGGCCAGCTTGGCGAAGCACC
GTCACATTGAACTAAAGCGGAAGTTGGATTACGTTGTTCCCGATGTCACCAACTTTCAAGCCGCTACACGTGGTG
CCTTGATCAGAAACGAATATTATGCATGGCGGGATCACTTGCACCGTAATGCGCATGTTGCCACTACTCTTCAAG
CTATGTTACTCGGCGCTTCTATTCGAATTCGATTCAAGGCCAAGATGGATTACTATCATGCCAATCTCAATAAAG
TCGTAAAAATCCAATCTTTATTTCGCGCAAAAGATACTCGCGAGCAATATCGCCAACTCACGATGGGGACCAACG
TCTCCATCGGTACGATCAAAAATTTCGTCCATCTACTTGACGACTCTGAGGCCGATTTCCAGGAGGAAATCAAAG
TAGAAAGGTTGAGAAAGCAAGTTGTAGAGTGCATTCGCGAGAATCAAGGCCTCGAAAATCAGGTTAATAACCTGG
ATGTCACGGTTGCCCTTATGGTAGACAACGCGAAGAAACGTAAAGGAACTGACAGTGCTACTATACATGCCGCCA
GGGTCAAACTTCTTGCTGATCATGGGGACCCCTTCTCCGGATCCAGTACTGTGGATCACTCTGCCAGGCGAAAGC
TGGAACTGTATCAACAGCTATTCTTCCTTTTGCAAACTCGTGGCGAGTATCTGAGTCGTTTAATCTGGAAGCTTT
CCCAAGATGGCACCCCCGAGCCTAGTAAAAGATTCACAGAACGCGTTATTTTGACGCTTTTTGGTTATGGTCAGG
ACCGCCGCGAGGATTTTCTTCTACTGAAGCTACTACAGGTACGTTGTTGTTCTGCCATAAAATTCAACTCCTTGC
AATTCTTTTGTCAGCTTGCGATTCGGGACGAGATCTCAACGTCCAATAGCATTGATGACGTTATTCGGAATCATC
CTATCTACCTCAATATCACGGTCCATTACATTAGACCAAAGCAGAGCACATTGTCCCGTGAAGCTTTTGAGACGA
TCATCAAAGAAGTCATTGAATCCGACGATCTCGACCTAGAAGTTGATCCTACTGTGGTATGTCGCTACCTATCTC
TTTTTTTGGTGATAAAATTCTGATACTAGCCCTAGCTGCATCAATCGCGCATAATAACGCAAGAGCGTAGATCTG
GTATGGCAAGTTCCATACCCAAAGATGTGACATTTAGGGAGGCTCTTGAATACCCCGAAACAAGGGCGATGTACA
TTCGCCGTCAGTGATAGCTCTATTCTCTTCGAGCATCAGGCTTATAAAAGGCTAGAACTTCAGCTCGTGCAATGG
TGGTCAGACGCCTTTGTGAACGCCATCACAGCTTCAACAAAGAAGATGCCTTTCAGTATGAGATATCTTGCTCGA
GAAACCTTGCTCGCCTTAAAGGTCAGTGCGACATCATAATTCCGAGCTGCTGCTGAAGATCATACATTAGGAGAA
ATTTCCGAATGGCTCGGATGAACAATATGCGGCGTGCGTGGGACGCTTGGTGTATTATCGTTACATCTCCCCAAT
CATCATGTAGGTCCAGCCGTGGCGTTTAGTGCCAGCCCTAATCTCGTTCTCAGGTCCCCAGAAATCTTCGAGATT
GTCCCTAAAACGGTCAAAATCGGAGCACGAAAGAACTTTGCCCAGGTCTCCAAGGTATTGACCCAGATCATGACT
GGTAGAGATTTCGGAGATGATCAACCCATCTATATCCCTATCAATGATTTTGTCCGCGAAGCCTCAAGTCGCATG
TCCGCCTGGCTTTTGGAAGGTCAATATTGTATTTATTGTCCAGGGTCTTTTTTGATTGCCATTGCAGTGGCCGAT
GTGCCGGATGCGGAGTCTTACTTCTACGCGCACGAATTCTTAGACGTCACCGTGCAGCCAAAACCCATCTATATA
ACTCCTAACGAAGTGTATACAATGCATGGACTTCTCCTACGACATCTCAAAGCCATCGTACGTCTGTCTATTCAA
CACCTCGAAAGTCCTCTATCCTGATTTCACTATTCAGGCACCTCAAACCAACGACCCTCTAAATGTCATCCTGAA
TGAACTTGTGGGAGTCCCGAACCTTGCAGACGAGGAGCTTAAGGATGCTAGGGACACCGCTATCACGCTCGAGCT
AACCAATCGATTTACGACCGTCAAAGGTGAGCCAGATAGTATAGTATGTTCATCTCAGCCGATTGCGACGTGTTT
CCACTAGACCCACATGCCGAAGAAAAAACACTGTGGGTCCAGGCCAAACGCGGAGTTTTAGCAATTCTTCGAGTA
CAGCCTGCTCAAGACCTCTTGGAGTCATTGATGCGTCCGGTTACAGAACAAGATGAGTCTGTCTGGGAGGACATT
CTCGAGGCGGAAGCTTTGAATGAGCAAAGCCGTAAACATTCAAGGCGACAACCTTCTGCTGTCGGCAATGACGCT
TACAGATTAGAAGACATAAGAACGTGAGTCTTATCTATAGATTTTACCCGATGGCGGCCCTACCTGTTGTTACAT
AGGTGGAGGTTTACGGCAGTCAAAGCATTGGCTATCACCAATCTTTTAGAGCTGGAGAAACAAGGCAAAATAACA
CGAGACGATGGTTTTCAAGGAATCTTGGATGCAATTGCTGGCGATGTACGAAGCAAACACCGAAAACGTATGCAA
CGGCAACATGAGATGAAGAGCATGAAGGAAGCACTACGCCATCTTCAAGAAAGAAAGAAAAATTACGAAGAGCAA
ATAAGCAGTTACCAGGATCATGTACAGGCTGCTATGAATACAATGCAGCAGAAGAAAGGGTATTATCTTCTTGCT
CATAAAGTCATTCAAACTGATAAAACCACCGTCAAATTTTCAGAAAGAAGCGCGGATTCGTTATTCCTTTTACCA
AACAATTTTGGCATGTTCGGGAGCTACAGAAGGCTGGGGTCACTCCTAAATTTGGGTCGTACTTTTACACTGCCA
AGGACCTTTATGATAAGAAGGTCTTGCTATCCATCGAGCAATATTCACCTCGTCAATACGACAAATTTCACATTA
AGATCTCGTCCGACTCCGTTGGCATATTCACACTCGTACTGGAGTCAACGATGCTGGGAATAACGAGTAAGCTTG
CAACGGAAAACATTCGGATGGAGGATCTGCTGCAGGCAAAATACGAGAAGCAGTCTTGCTTGGTGTTGTTTGGAG
GAAGAGTCAAGGTCAATTTTGAGCCCTTTCTTGACGAGATCAACCAAAAGTACGTATTGGCCAGGAATCCTTATG
CTGCCTCGGATTGACCTGTTATTGTTTAGTTTCTTGGGATCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail