Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|072930
Gene name
Locationscaffold_04:1721594..1721983
Strand+
Gene length (bp)389
Transcript length (bp)294
Coding sequence length (bp)294
Protein length (aa) 98

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08571 Yos1 Yos1-like 2.9E-30 5 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13825|YOS1_SCHPO Protein transport protein yos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yos1 PE=3 SV=1 1 97 3.0E-19
sp|Q3B8G7|IR3IP_XENLA Immediate early response 3-interacting protein 1 OS=Xenopus laevis GN=ier3ip1 PE=3 SV=1 2 97 3.0E-16
sp|Q3E834|YOS1_YEAST Protein transport protein YOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOS1 PE=1 SV=1 1 97 7.0E-16
sp|Q4VBI2|IR3IP_DANRE Immediate early response 3-interacting protein 1 OS=Danio rerio GN=ier3ip1 PE=3 SV=1 2 97 8.0E-16
sp|Q9Y5U9|IR3IP_HUMAN Immediate early response 3-interacting protein 1 OS=Homo sapiens GN=IER3IP1 PE=1 SV=1 2 97 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13825|YOS1_SCHPO Protein transport protein yos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yos1 PE=3 SV=1 1 97 3.0E-19
sp|Q3B8G7|IR3IP_XENLA Immediate early response 3-interacting protein 1 OS=Xenopus laevis GN=ier3ip1 PE=3 SV=1 2 97 3.0E-16
sp|Q3E834|YOS1_YEAST Protein transport protein YOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOS1 PE=1 SV=1 1 97 7.0E-16
sp|Q4VBI2|IR3IP_DANRE Immediate early response 3-interacting protein 1 OS=Danio rerio GN=ier3ip1 PE=3 SV=1 2 97 8.0E-16
sp|Q9Y5U9|IR3IP_HUMAN Immediate early response 3-interacting protein 1 OS=Homo sapiens GN=IER3IP1 PE=1 SV=1 2 97 2.0E-14
sp|Q1JQC2|IR3IP_BOVIN Immediate early response 3-interacting protein 1 OS=Bos taurus GN=IER3IP1 PE=3 SV=1 2 97 2.0E-14
sp|P85007|IR3IP_RAT Immediate early response 3-interacting protein 1 OS=Rattus norvegicus GN=Ier3ip1 PE=3 SV=1 2 97 3.0E-14
sp|Q9CR20|IR3IP_MOUSE Immediate early response 3-interacting protein 1 OS=Mus musculus GN=Ier3ip1 PE=3 SV=1 2 97 3.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|072930
MFLIGTILQVSLLLVNAIAILNEERFLARIGWVSTSRLRTHSANAGYNHPYEQNGYGNEDVGIKARLIDLIGAVR
TLMRIPLIAINVAVILYELVWG*
Coding >Agabi119p4|072930
ATGTTTCTGATTGGTACTATTCTTCAAGTCTCCCTTCTGCTTGTAAACGCCATTGCTATCCTGAACGAGGAACGC
TTTCTAGCCAGAATCGGATGGGTTTCGACAAGTCGACTCCGAACCCACAGTGCAAATGCGGGATACAATCACCCT
TACGAACAGAATGGCTACGGAAACGAAGACGTTGGAATCAAAGCCCGCCTAATAGACCTTATAGGCGCTGTCCGC
ACCCTCATGCGTATCCCACTCATAGCAATAAACGTAGCCGTCATTCTATACGAATTGGTCTGGGGATGA
Transcript >Agabi119p4|072930
ATGTTTCTGATTGGTACTATTCTTCAAGTCTCCCTTCTGCTTGTAAACGCCATTGCTATCCTGAACGAGGAACGC
TTTCTAGCCAGAATCGGATGGGTTTCGACAAGTCGACTCCGAACCCACAGTGCAAATGCGGGATACAATCACCCT
TACGAACAGAATGGCTACGGAAACGAAGACGTTGGAATCAAAGCCCGCCTAATAGACCTTATAGGCGCTGTCCGC
ACCCTCATGCGTATCCCACTCATAGCAATAAACGTAGCCGTCATTCTATACGAATTGGTCTGGGGATGA
Gene >Agabi119p4|072930
ATGTTTCTGATTGGTACTATTCTTCAAGTCTCCCTTCTGCTTGTAAACGCCATTGCTATCCTGAACGAGGAACGC
TTTCTAGCCAGAAGTATGTCCTAAGCTCTTCCTACGTCTGCACATGCTCATACCCATCCAGTCGGATGGGTTTCG
ACAAGTCGACTCCGAACCCACAGTGCAAATGCGGGATACAATCACCCTTACGAACAGAATGGCTACGGAAACGAA
GACGTTGGAATCAAAGCCCGCCTAATAGACCTTATAGGCGCTGTCCGCACCCTCATGCGTAGTCAGTGGTCACTA
TGTTTGCCTGGCTTTTCGCTAATGGCTTTGCAGTCCCACTCATAGCAATAAACGTAGCCGTCATTCTATACGAAT
TGGTCTGGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail