Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|072880
Gene name
Locationscaffold_04:1713051..1715251
Strand+
Gene length (bp)2200
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.0E-28 65 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 66 379 5.0E-15
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 59 390 2.0E-14
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 59 390 1.0E-13
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 3 379 1.0E-12
sp|O93428|CATD_CHIHA Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 46 376 9.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 66 379 5.0E-15
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 59 390 2.0E-14
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 59 390 1.0E-13
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 3 379 1.0E-12
sp|O93428|CATD_CHIHA Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 46 376 9.0E-12
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 23 379 3.0E-11
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 22 386 6.0E-11
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 29 379 8.0E-11
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 62 387 8.0E-11
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 59 379 8.0E-11
sp|C5FEK4|CTSD_ARTOC Probable aspartic-type endopeptidase CTSD (Fragment) OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CTSD PE=3 SV=2 77 390 9.0E-11
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 59 379 2.0E-10
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 62 387 3.0E-10
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 64 387 4.0E-10
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 54 386 4.0E-10
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 51 379 5.0E-10
sp|C5PEI9|PEPA_COCP7 Aspartic protease PEP3 OS=Coccidioides posadasii (strain C735) GN=PEP3 PE=3 SV=1 36 377 6.0E-10
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 59 379 7.0E-10
sp|Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 29 386 1.0E-09
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 62 387 2.0E-09
sp|P18242|CATD_MOUSE Cathepsin D OS=Mus musculus GN=Ctsd PE=1 SV=1 31 376 2.0E-09
sp|P24268|CATD_RAT Cathepsin D OS=Rattus norvegicus GN=Ctsd PE=1 SV=1 31 376 2.0E-09
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 59 379 2.0E-09
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 59 376 4.0E-09
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 59 376 4.0E-09
sp|P07267|CARP_YEAST Saccharopepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP4 PE=1 SV=1 46 379 4.0E-09
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 29 379 6.0E-09
sp|P18276|CHYM_SHEEP Chymosin OS=Ovis aries GN=CYM PE=2 SV=1 71 376 9.0E-09
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 54 387 1.0E-08
sp|Q4WZS3|Y5950_ASPFU Putative aspergillopepsin A-like aspartic endopeptidase AFUA_2G15950 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G15950 PE=3 SV=2 55 377 1.0E-08
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 18 376 1.0E-08
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 7 381 1.0E-08
sp|C5FZ57|Y7979_ARTOC Putative aspergillopepsin A-like aspartic endopeptidase MCYG_07979 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07979 PE=3 SV=1 56 377 1.0E-08
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 58 389 3.0E-08
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 59 379 3.0E-08
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 64 376 3.0E-08
sp|P16476|PEPE_CHICK Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 59 376 5.0E-08
sp|P55956|ASP3_CAEEL Aspartic protease 3 OS=Caenorhabditis elegans GN=asp-3 PE=1 SV=3 71 379 6.0E-08
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 64 376 8.0E-08
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 59 379 8.0E-08
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 54 376 1.0E-07
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 54 376 2.0E-07
sp|P00794|CHYM_BOVIN Chymosin OS=Bos taurus GN=CYM PE=1 SV=3 71 376 2.0E-07
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 59 376 2.0E-07
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 64 379 2.0E-07
sp|D4AIC4|Y4018_ARTBC Probable aspartic-type endopeptidase ARB_04018 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04018 PE=3 SV=1 46 376 2.0E-07
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 54 376 3.0E-07
sp|Q4LAL9|CATD_CANLF Cathepsin D OS=Canis lupus familiaris GN=CTSD PE=2 SV=1 31 376 3.0E-07
sp|Q9DEX3|CATD_CLUHA Cathepsin D OS=Clupea harengus GN=ctsd PE=1 SV=1 45 376 3.0E-07
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 59 379 3.0E-07
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 54 376 4.0E-07
sp|P83495|PAG4_SHEEP Pregnancy-associated glycoprotein 4 OS=Ovis aries PE=1 SV=2 54 386 5.0E-07
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 36 379 6.0E-07
sp|Q9XFX4|CARDB_CYNCA Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 4 299 7.0E-07
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 64 376 8.0E-07
sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1 51 376 9.0E-07
sp|E5A7T3|PEPA_LEPMJ Aspartic protease PEP1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=PEP1 PE=3 SV=2 59 376 1.0E-06
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 34 378 1.0E-06
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 72 377 2.0E-06
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 64 376 2.0E-06
sp|C5FW52|Y6955_ARTOC Probable aspartic-type endopeptidase MCYG_06955 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_06955 PE=3 SV=1 59 377 3.0E-06
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 71 379 3.0E-06
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 46 390 3.0E-06
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 54 379 4.0E-06
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 58 377 7.0E-06
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 58 377 7.0E-06
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 259 379 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 453 475 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|072880
MRLSFSLPLAFLALAAARTYPFKRLKHPSHLLPRAQITEDGQVTTSNAGTPFSLSTIQDLIYLVDITVAGHNYTV
QLDTGSSDLWIKGQTNPLPGVTTTDSFYNITYVLGWASGHLAYAPVEFIGLKVDKQALLDVDAADNPVLGYGLDG
ICGLGFDSLSSIDYGVNQTSSDSGRSLLHNLFALNPSEPNFIAFSLHRSTAGGGDDDDVEGSFSIGEYEPDYAAV
ANTSKISTWPLHFPKRWTVLLDSLIVGDHLVVPHTQISTAPSNKAVVLLDSGASYTYAPKSIVDAIYANITGARF
DEKSNQWLVPCDHEVNMALQIGGQVFPLNPLDVTPTTPGNNKTCVGSFIPSQLSAESQFDWLIGDNFLRSVYAVY
DFGDFDDKGVAGPPYMRLLSLVNPDDASADFHEIRGGSPQHNITYKGLNETANTPSFFISDDVSESIETISKLVP
AMLAVVAFNAIVLVVLIIGGVVCWMKKRRLRSFQRRVTRGREGLSPMPMNPVSSYTPGGQLPSSMPVAYEPVSMA
LTEDTFVPPSPAFHKLDRNMQPGDRPKSIA*
Coding >Agabi119p4|072880
ATGCGTCTCTCTTTCTCCCTGCCCCTCGCTTTTCTCGCCCTCGCTGCTGCCCGCACTTATCCCTTCAAGCGCCTA
AAACACCCCTCCCACCTCCTCCCCCGTGCACAAATCACCGAAGACGGCCAGGTCACCACTTCAAATGCAGGGACG
CCCTTCAGCCTCAGCACCATTCAGGACCTCATTTATCTCGTCGACATCACTGTTGCCGGCCACAACTATACCGTC
CAGCTCGACACGGGCTCTTCTGACCTCTGGATAAAAGGGCAAACAAACCCGCTACCTGGCGTGACTACCACCGAC
TCTTTCTACAACATTACTTATGTCCTTGGTTGGGCTTCCGGCCACCTTGCTTATGCCCCCGTTGAGTTTATAGGG
TTGAAAGTCGACAAACAAGCTTTGCTTGACGTTGATGCCGCCGACAACCCAGTTCTCGGATACGGTCTCGATGGA
ATATGTGGCCTCGGCTTTGATAGTCTTTCTAGCATTGACTACGGTGTCAACCAAACCTCGTCAGATTCTGGTCGC
AGTCTCCTACACAACCTCTTCGCTCTCAACCCGTCCGAGCCCAATTTTATCGCCTTTTCTCTTCACCGCAGCACT
GCAGGTGGCGGAGATGATGATGATGTTGAAGGCAGCTTTTCCATAGGTGAGTATGAACCCGATTATGCTGCCGTC
GCCAACACGTCCAAGATTTCCACTTGGCCTCTGCATTTTCCCAAGAGGTGGACTGTACTCCTGGACTCTCTGATT
GTCGGAGATCATCTTGTGGTACCCCATACACAGATTTCCACCGCTCCGAGTAACAAAGCAGTTGTTTTGTTGGAC
AGCGGCGCGTCTTATACTTATGCCCCCAAATCAATCGTTGACGCAATCTATGCCAACATCACAGGCGCGCGCTTC
GATGAGAAAAGCAACCAATGGTTGGTACCATGCGATCATGAGGTCAACATGGCACTTCAAATTGGAGGCCAAGTC
TTTCCGCTCAATCCGCTTGATGTGACGCCCACGACGCCCGGGAACAACAAAACATGCGTGGGTTCTTTTATTCCA
TCTCAGCTTTCCGCAGAGAGTCAATTTGATTGGCTCATCGGTGACAACTTTCTTCGCTCCGTTTATGCTGTATAC
GATTTCGGTGACTTCGACGACAAGGGTGTCGCAGGTCCTCCCTATATGCGCCTTCTTTCGCTCGTCAATCCCGAT
GACGCCTCTGCCGATTTCCACGAGATCAGAGGTGGTTCTCCTCAACATAACATCACCTACAAGGGTCTCAATGAA
ACTGCCAACACGCCTTCCTTCTTTATTTCGGACGACGTTTCCGAATCGATAGAGACGATAAGCAAACTTGTCCCC
GCCATGTTGGCTGTGGTTGCATTCAATGCTATCGTACTTGTTGTGCTGATAATTGGTGGAGTCGTCTGCTGGATG
AAAAAGAGAAGATTGAGAAGCTTCCAGCGAAGGGTCACGAGAGGTCGCGAGGGTTTGAGTCCCATGCCCATGAAC
CCCGTGTCGAGTTATACACCAGGTGGGCAGTTGCCATCGAGCATGCCCGTTGCTTACGAGCCAGTATCGATGGCT
CTCACCGAGGATACTTTCGTACCACCCTCCCCCGCGTTCCATAAGCTCGACCGCAACATGCAGCCTGGTGATCGA
CCAAAATCGATTGCATAA
Transcript >Agabi119p4|072880
ATGCGTCTCTCTTTCTCCCTGCCCCTCGCTTTTCTCGCCCTCGCTGCTGCCCGCACTTATCCCTTCAAGCGCCTA
AAACACCCCTCCCACCTCCTCCCCCGTGCACAAATCACCGAAGACGGCCAGGTCACCACTTCAAATGCAGGGACG
CCCTTCAGCCTCAGCACCATTCAGGACCTCATTTATCTCGTCGACATCACTGTTGCCGGCCACAACTATACCGTC
CAGCTCGACACGGGCTCTTCTGACCTCTGGATAAAAGGGCAAACAAACCCGCTACCTGGCGTGACTACCACCGAC
TCTTTCTACAACATTACTTATGTCCTTGGTTGGGCTTCCGGCCACCTTGCTTATGCCCCCGTTGAGTTTATAGGG
TTGAAAGTCGACAAACAAGCTTTGCTTGACGTTGATGCCGCCGACAACCCAGTTCTCGGATACGGTCTCGATGGA
ATATGTGGCCTCGGCTTTGATAGTCTTTCTAGCATTGACTACGGTGTCAACCAAACCTCGTCAGATTCTGGTCGC
AGTCTCCTACACAACCTCTTCGCTCTCAACCCGTCCGAGCCCAATTTTATCGCCTTTTCTCTTCACCGCAGCACT
GCAGGTGGCGGAGATGATGATGATGTTGAAGGCAGCTTTTCCATAGGTGAGTATGAACCCGATTATGCTGCCGTC
GCCAACACGTCCAAGATTTCCACTTGGCCTCTGCATTTTCCCAAGAGGTGGACTGTACTCCTGGACTCTCTGATT
GTCGGAGATCATCTTGTGGTACCCCATACACAGATTTCCACCGCTCCGAGTAACAAAGCAGTTGTTTTGTTGGAC
AGCGGCGCGTCTTATACTTATGCCCCCAAATCAATCGTTGACGCAATCTATGCCAACATCACAGGCGCGCGCTTC
GATGAGAAAAGCAACCAATGGTTGGTACCATGCGATCATGAGGTCAACATGGCACTTCAAATTGGAGGCCAAGTC
TTTCCGCTCAATCCGCTTGATGTGACGCCCACGACGCCCGGGAACAACAAAACATGCGTGGGTTCTTTTATTCCA
TCTCAGCTTTCCGCAGAGAGTCAATTTGATTGGCTCATCGGTGACAACTTTCTTCGCTCCGTTTATGCTGTATAC
GATTTCGGTGACTTCGACGACAAGGGTGTCGCAGGTCCTCCCTATATGCGCCTTCTTTCGCTCGTCAATCCCGAT
GACGCCTCTGCCGATTTCCACGAGATCAGAGGTGGTTCTCCTCAACATAACATCACCTACAAGGGTCTCAATGAA
ACTGCCAACACGCCTTCCTTCTTTATTTCGGACGACGTTTCCGAATCGATAGAGACGATAAGCAAACTTGTCCCC
GCCATGTTGGCTGTGGTTGCATTCAATGCTATCGTACTTGTTGTGCTGATAATTGGTGGAGTCGTCTGCTGGATG
AAAAAGAGAAGATTGAGAAGCTTCCAGCGAAGGGTCACGAGAGGTCGCGAGGGTTTGAGTCCCATGCCCATGAAC
CCCGTGTCGAGTTATACACCAGGTGGGCAGTTGCCATCGAGCATGCCCGTTGCTTACGAGCCAGTATCGATGGCT
CTCACCGAGGATACTTTCGTACCACCCTCCCCCGCGTTCCATAAGCTCGACCGCAACATGCAGCCTGGTGATCGA
CCAAAATCGATTGCATAA
Gene >Agabi119p4|072880
ATGCGTCTCTCTTTCTCCCTGCCCCTCGCTTTTCTCGCCCTCGCTGCTGCCCGCACTTATCCCTTCAAGCGCCTA
AAACACCCCTCCCACCTCCTCCCCCGTGCACAAATCACCGAAGACGGCCAGGTCACCACTTCAAATGCAGGGACG
CCCTTCAGCCTCAGGTCGGCTCCCCCAGCTCTCCCTTTTCCACTCTGCTCACACCCTTCCCACTAGCACCATTCA
GGACCTCATTTATCTCGTCGACGTATGTGTCAAGCTTGTCTTACCCAATAATTAGGCTTAACCTCTCACGCCCCG
CACAGATCACTGTTGCCGGCCACAGTTCCGTATCCTTCGCTTCCTTCGGCGTCCATCTCCCGCTTATATTCCTGC
AGACTATACCGTCCAGCTCGACACGGGCTCTTCTGACCTCTGGATAAAAGGGCAAACAAACCCGCTACCTGGCGT
GACTACCACCGTATGTTCTATTTCCGTACTCCTATGTCAATCGCCTGATTTTTTTCTTTCTCAAGGACTCTTTCT
ACAACATTACTGTAAGTGGTCCAACTTCTTAGTTAACCCACACCTTCACCTCGTGGTAGTATGTCCTTGGTTGGG
CTTCCGGCCACCTTGCTTATGCCCCCGTTGAGTTTATAGGGTAAGTGATCCTCATCTACCCCTTTAATTGTGTAA
GCACATACATTCCAGGTTGAAAGTCGACAAACAAGCTTTGCTTGACGTTGATGCCGCCGACAACCCAGTTCTCGG
ATACGGTCTCGATGGAATATGTGGCCTCGGCTTTGATAGTCTTTCTAGCATTGACTACGGTGTCAACCAAACCTC
GTCAGATTCTGGTCGCAGTCTCCTACACAACCTCTTCGCTCTCAACCCGTCCGAGCCCAATTTTATCGCCTTTTC
TCTTCACCGCAGCACTGCAGGTGGCGGAGATGATGATGATGTTGAAGGCAGCTTTTCCATAGGTATCGTATACTT
TTGGGCGAGGTCCTCTTTCCCCTCTCCTCGCTGACTCTCTTCCACCTAGGTGAGTATGAACCCGATTATGCTGCC
GTCGCCAACACGTCCAAGATTTCCACTTGGCCTCTGCATTTTCCCAAGAGGTGGACTGTACTCCTGGACTCTCTG
ATTGTCGGAGATCATCTTGTGGTACCCCATACACAGATTTCCACCGCTCCGAGTAACAAAGCAGTTGTTTTGTTG
GACAGCGGCGCGTCTTATACGTGAGTAACCGTCTCCACTGTCGAGTGTATCAACTCAAGAAATCGCTCGTTGGAC
AGTTATGCCCCCAAATCAATCGTTGACGCAATCTATGCCAACATCACAGGCGCGCGCTTCGATGAGAAAAGCAAC
CAATGGTTGGTACCATGCGATCATGAGGTCAACATGGCACTTCAAATTGGGTATGTATAATACTCTCGTCGATCC
TGGAGAAATTCATATTTCGTACAGAGGCCAAGTCTTTCCGCTCAATCCGCTTGATGTGACGCCCACGACGCCCGG
GAACAACAAAACATGCGTGGGTTCTTTTATTCCATCTCAGCTTTCCGCAGAGAGTCAATTGTGAGTCCGCAACTA
TTTTTTATCCTCACATATTTACCGCGCGTGTAGTGATTGGCTCATCGGTGACAACTTTCTTCGCTCCGTTTATGC
TGTATACGATTTCGGTGACTTCGACGACAAGGGTGTCGCAGGTCCTCCCTATATGCGCCTTCTTTCGCTCGTCAA
TCCCGATGACGCCTCTGCCGATTTCCACGAGATCAGAGGTGGTTCTCCTCAACATAACATCACCTACAAGGGTCT
CAATGAAACTGCCAACACGCCTTCCTTCTTTATTTCGGACGACGTTTCCGAATCGATAGAGACGATAAGCAAACT
TGTCCCCGCCATGTTGGCTGTGGTTGCATTCAATGCTATCGTACTTGTTGTGCTGATAATTGGTGGAGTCGTCTG
CTGGATGAAAAAGAGAAGATTGAGAAGCTTCCAGCGAAGGGTCACGAGAGGTCGCGAGGGTTTGAGTCCCATGCC
CATGAACCCCGTGTCGAGTTATACACCAGGTGGGCAGTTGCCATCGAGCATGCCCGTTGCTTACGAGCCAGTATC
GATGGCTCTCACCGAGGATACTTTCGTACCACCCTCCCCCGCGTTCCATAAGCTCGACCGCAACATGCAGCCTGG
TGATCGACCAAAATCGATTGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail