Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|072750
Gene name
Locationscaffold_04:1683534..1689308
Strand+
Gene length (bp)5774
Transcript length (bp)4209
Coding sequence length (bp)4209
Protein length (aa) 1403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02257 RFX_DNA_binding RFX DNA-binding domain 2.6E-27 771 847
PF00149 Metallophos Calcineurin-like phosphoesterase 2.3E-09 47 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPN1 PE=3 SV=1 18 530 2.0E-123
sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppn1 PE=3 SV=1 4 390 9.0E-82
sp|Q756F2|PPN1_ASHGO Endopolyphosphatase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPN1 PE=3 SV=2 44 484 1.0E-78
sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPN1 PE=3 SV=1 42 390 1.0E-78
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPN1 PE=3 SV=3 44 313 5.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPN1 PE=3 SV=1 18 530 2.0E-123
sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppn1 PE=3 SV=1 4 390 9.0E-82
sp|Q756F2|PPN1_ASHGO Endopolyphosphatase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPN1 PE=3 SV=2 44 484 1.0E-78
sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPN1 PE=3 SV=1 42 390 1.0E-78
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPN1 PE=3 SV=3 44 313 5.0E-74
sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=epp-1 PE=3 SV=3 7 391 1.0E-73
sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPN1 PE=3 SV=1 42 393 2.0E-71
sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPN1 PE=1 SV=1 24 313 4.0E-71
sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPN1 PE=3 SV=1 13 390 3.0E-70
sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dictyostelium discoideum GN=sgmC PE=3 SV=1 37 395 3.0E-31
sp|Q92484|ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a OS=Homo sapiens GN=SMPDL3A PE=1 SV=2 46 311 9.0E-29
sp|Q3ZC91|ASM3A_BOVIN Acid sphingomyelinase-like phosphodiesterase 3a OS=Bos taurus GN=SMPDL3A PE=2 SV=1 46 311 4.0E-28
sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesterase 3b OS=Homo sapiens GN=SMPDL3B PE=2 SV=2 36 350 4.0E-28
sp|P70158|ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a OS=Mus musculus GN=Smpdl3a PE=1 SV=2 46 311 2.0E-27
sp|Q641Z7|ASM3A_RAT Acid sphingomyelinase-like phosphodiesterase 3a OS=Rattus norvegicus GN=Smpdl3a PE=2 SV=1 46 311 6.0E-27
sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b OS=Mus musculus GN=Smpdl3b PE=1 SV=1 46 313 2.0E-25
sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyostelium discoideum GN=sgmB PE=3 SV=1 47 314 1.0E-24
sp|Q59V88|RFX1_CANAL Transcriptional regulator RFX1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFX1 PE=2 SV=1 737 1250 2.0E-24
sp|P48379|RFX2_MOUSE DNA-binding protein RFX2 OS=Mus musculus GN=Rfx2 PE=1 SV=2 997 1268 5.0E-20
sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyostelium discoideum GN=sgmA PE=3 SV=1 46 325 1.0E-19
sp|P48383|SAK1_SCHPO Protein sak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sak1 PE=1 SV=2 739 846 1.0E-19
sp|B2GV50|RFX2_RAT DNA-binding protein RFX2 OS=Rattus norvegicus GN=Rfx2 PE=1 SV=1 997 1268 1.0E-19
sp|Q0V9K5|RFX3_XENTR Transcription factor RFX3 OS=Xenopus tropicalis GN=rfx3 PE=2 SV=2 964 1261 2.0E-18
sp|A0JMF8|RFX3_DANRE Transcription factor RFX3 OS=Danio rerio GN=rfx3 PE=2 SV=1 995 1268 2.0E-18
sp|Q5RDR2|RFX2_PONAB DNA-binding protein RFX2 OS=Pongo abelii GN=RFX2 PE=2 SV=1 997 1268 4.0E-18
sp|Q4R3Z4|RFX2_MACFA DNA-binding protein RFX2 OS=Macaca fascicularis GN=RFX2 PE=2 SV=1 997 1268 7.0E-18
sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorhabditis elegans GN=asm-1 PE=1 SV=2 49 318 7.0E-18
sp|Q32NR3|RFX2_XENLA DNA-binding protein RFX2 OS=Xenopus laevis GN=rfx2 PE=2 SV=1 963 1268 9.0E-18
sp|A6QLW9|RFX2_BOVIN DNA-binding protein RFX2 OS=Bos taurus GN=RFX2 PE=2 SV=1 997 1268 1.0E-17
sp|P48378|RFX2_HUMAN DNA-binding protein RFX2 OS=Homo sapiens GN=RFX2 PE=2 SV=2 997 1268 1.0E-17
sp|P22670|RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens GN=RFX1 PE=1 SV=2 995 1249 2.0E-17
sp|P48380|RFX3_HUMAN Transcription factor RFX3 OS=Homo sapiens GN=RFX3 PE=1 SV=2 995 1268 2.0E-17
sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens GN=SMPD1 PE=1 SV=4 47 321 2.0E-17
sp|Q4R3I8|RFX3_MACFA Transcription factor RFX3 OS=Macaca fascicularis GN=RFX3 PE=2 SV=1 995 1268 2.0E-17
sp|P48381|RFX3_MOUSE Transcription factor RFX3 OS=Mus musculus GN=Rfx3 PE=1 SV=2 995 1268 4.0E-17
sp|B1WAV2|RFX2_XENTR DNA-binding protein RFX2 OS=Xenopus tropicalis GN=rfx2 PE=2 SV=1 950 1268 7.0E-17
sp|Q5EAP5|RFX2_DANRE DNA-binding protein RFX2 OS=Danio rerio GN=rfx2 PE=2 SV=1 997 1268 9.0E-17
sp|P48377|RFX1_MOUSE MHC class II regulatory factor RFX1 OS=Mus musculus GN=Rfx1 PE=1 SV=2 995 1249 1.0E-16
sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus GN=SMPD1 PE=2 SV=1 47 321 3.0E-16
sp|Q5RJA1|RFX6_DANRE DNA-binding protein RFX6 OS=Danio rerio GN=rfx6 PE=2 SV=2 997 1253 3.0E-16
sp|Q33E94|RFX4_HUMAN Transcription factor RFX4 OS=Homo sapiens GN=RFX4 PE=1 SV=2 1026 1249 5.0E-16
sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorhabditis elegans GN=asm-2 PE=1 SV=3 82 320 5.0E-16
sp|A2BGA0|RFX4_DANRE Transcription factor RFX4 OS=Danio rerio GN=rfx4 PE=2 SV=1 1026 1249 8.0E-16
sp|Q7TNK1|RFX4_MOUSE Transcription factor RFX4 OS=Mus musculus GN=Rfx4 PE=1 SV=1 1026 1249 8.0E-16
sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus GN=Smpd1 PE=2 SV=2 47 316 4.0E-15
sp|P48743|RFX1_YEAST RFX-like DNA-binding protein RFX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFX1 PE=1 SV=2 767 872 7.0E-15
sp|Q8C7R7|RFX6_MOUSE DNA-binding protein RFX6 OS=Mus musculus GN=Rfx6 PE=1 SV=2 997 1251 7.0E-15
sp|D2HNW6|RFX6_AILME DNA-binding protein RFX6 OS=Ailuropoda melanoleuca GN=RFX6 PE=3 SV=2 997 1251 1.0E-14
sp|Q8HWS3|RFX6_HUMAN DNA-binding protein RFX6 OS=Homo sapiens GN=RFX6 PE=1 SV=2 997 1251 2.0E-14
sp|P48381|RFX3_MOUSE Transcription factor RFX3 OS=Mus musculus GN=Rfx3 PE=1 SV=2 777 861 3.0E-12
sp|P48380|RFX3_HUMAN Transcription factor RFX3 OS=Homo sapiens GN=RFX3 PE=1 SV=2 777 861 3.0E-12
sp|P48378|RFX2_HUMAN DNA-binding protein RFX2 OS=Homo sapiens GN=RFX2 PE=2 SV=2 777 846 3.0E-12
sp|Q4R3Z4|RFX2_MACFA DNA-binding protein RFX2 OS=Macaca fascicularis GN=RFX2 PE=2 SV=1 777 846 3.0E-12
sp|Q0V9K5|RFX3_XENTR Transcription factor RFX3 OS=Xenopus tropicalis GN=rfx3 PE=2 SV=2 777 861 3.0E-12
sp|Q09555|DAF19_CAEEL RFX-like transcription factor daf-19 OS=Caenorhabditis elegans GN=daf-19 PE=2 SV=3 777 846 4.0E-12
sp|Q4R3I8|RFX3_MACFA Transcription factor RFX3 OS=Macaca fascicularis GN=RFX3 PE=2 SV=1 777 861 4.0E-12
sp|P48379|RFX2_MOUSE DNA-binding protein RFX2 OS=Mus musculus GN=Rfx2 PE=1 SV=2 777 846 4.0E-12
sp|B2GV50|RFX2_RAT DNA-binding protein RFX2 OS=Rattus norvegicus GN=Rfx2 PE=1 SV=1 777 846 4.0E-12
sp|A0JMF8|RFX3_DANRE Transcription factor RFX3 OS=Danio rerio GN=rfx3 PE=2 SV=1 777 861 4.0E-12
sp|A6QLW9|RFX2_BOVIN DNA-binding protein RFX2 OS=Bos taurus GN=RFX2 PE=2 SV=1 777 846 4.0E-12
sp|Q5RDR2|RFX2_PONAB DNA-binding protein RFX2 OS=Pongo abelii GN=RFX2 PE=2 SV=1 777 846 4.0E-12
sp|Q2KHR2|RFX7_HUMAN DNA-binding protein RFX7 OS=Homo sapiens GN=RFX7 PE=1 SV=1 765 846 5.0E-12
sp|Q5EAP5|RFX2_DANRE DNA-binding protein RFX2 OS=Danio rerio GN=rfx2 PE=2 SV=1 777 846 5.0E-12
sp|B1WAV2|RFX2_XENTR DNA-binding protein RFX2 OS=Xenopus tropicalis GN=rfx2 PE=2 SV=1 777 846 5.0E-12
sp|Q32NR3|RFX2_XENLA DNA-binding protein RFX2 OS=Xenopus laevis GN=rfx2 PE=2 SV=1 777 846 5.0E-12
sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm-3 OS=Caenorhabditis elegans GN=asm-3 PE=3 SV=2 47 316 1.0E-11
sp|P48377|RFX1_MOUSE MHC class II regulatory factor RFX1 OS=Mus musculus GN=Rfx1 PE=1 SV=2 759 846 3.0E-11
sp|P22670|RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens GN=RFX1 PE=1 SV=2 759 846 3.0E-11
sp|Q6ZV50|RFX8_HUMAN DNA-binding protein RFX8 OS=Homo sapiens GN=RFX8 PE=2 SV=2 753 845 4.0E-11
sp|A2BGA0|RFX4_DANRE Transcription factor RFX4 OS=Danio rerio GN=rfx4 PE=2 SV=1 777 845 2.0E-10
sp|Q7TNK1|RFX4_MOUSE Transcription factor RFX4 OS=Mus musculus GN=Rfx4 PE=1 SV=1 777 845 2.0E-10
sp|Q33E94|RFX4_HUMAN Transcription factor RFX4 OS=Homo sapiens GN=RFX4 PE=1 SV=2 777 845 2.0E-10
sp|D3YU81|RFX8_MOUSE DNA-binding protein RFX8 OS=Mus musculus GN=Rfx8 PE=3 SV=1 777 845 3.0E-10
sp|P48382|RFX5_HUMAN DNA-binding protein RFX5 OS=Homo sapiens GN=RFX5 PE=1 SV=1 772 849 8.0E-10
sp|Q9JL61|RFX5_MOUSE DNA-binding protein Rfx5 OS=Mus musculus GN=Rfx5 PE=1 SV=2 772 849 2.0E-09
sp|Q8C7R7|RFX6_MOUSE DNA-binding protein RFX6 OS=Mus musculus GN=Rfx6 PE=1 SV=2 758 845 3.0E-09
sp|D2HNW6|RFX6_AILME DNA-binding protein RFX6 OS=Ailuropoda melanoleuca GN=RFX6 PE=3 SV=2 758 880 3.0E-09
sp|Q8HWS3|RFX6_HUMAN DNA-binding protein RFX6 OS=Homo sapiens GN=RFX6 PE=1 SV=2 758 880 3.0E-09
sp|Q5RJA1|RFX6_DANRE DNA-binding protein RFX6 OS=Danio rerio GN=rfx6 PE=2 SV=2 767 880 7.0E-09
sp|Q55GC7|SGMD_DICDI Sphingomyelinase phosphodiesterase D OS=Dictyostelium discoideum GN=sgmD PE=3 SV=1 42 311 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0031323 regulation of cellular metabolic process No
GO:0003676 nucleic acid binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0019222 regulation of metabolic process No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0080090 regulation of primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
RFX DNA-binding domain

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|072750
MINVPLCALVVFLTTQVLASPAQTPLRDVVSENETATSAAPRKLHGRFLHITDMHPDPHYSFHASTSKSCHGKKA
KKKRKRAGYWGTPDVECDSPLRLIDLTLDYLDKNWADEIDFVVWTGDNARHDEDHHIPRTLDEILDQNKRMAMKM
EKIFSKKGIPVVPSLGNNDIWPHNILAPGPNKITNEFASLWSPFIPFPQRQVFQRGAYYSTEVIPGHLAVISLNT
LYFYDSNKAVGGCQYGDDDDPGNLEFDWLEVQLKQFRDKNIQVYLTGHIPPSLGNYYPECYVRYTEMSLRFQDTI
LGHLYGHMNLDYFSFMEEIDLEIIPGEEEEGPRAKGGRNGLYETLLREFEQLPEESEEERLDGLAVINVAPSVVP
NPFVPAFRIFSYNVSGDGLMGARKQREHGHRRGRKGNKDDVCKDKRYDKSWKCHLQKSWHTDRDAPSRRNQALTP
LGYAQYYMPDIATANKTQAPRYELEYVTYPVSALGSGDWEPVPVRHLPRALREGRKGKRYAPYGLRDLTVGSWVG
LGRRLGQGAEKRDVVVVLTMENAYTYRVGFDCAVVEASAERQTSRAPPPAAVLPVSPILGWSDPPTILSQHDMTA
VNMHMPLDFLPHHSRSNSLSSASTHSRPHSSQGSIPRMQAAGTDDLYRPPYHLHPPPLHPDPSSSIHNTALKGPL
RPTHNRVRASPYPRDTDSVHSSSSEAEDISMYLGHHHTPEYQPLYGAPHTMAPSPETMHAANAFGRMAISQDHAL
EKLAANVRAATTTSASDRAKQIFVQAWLTANYAPYPDGNVPRQGLYFSYRRVCDQYGIPHINTATLGKAIRLCFP
TIKTRRLGVRGNSKYHYCGIRPATTAEAEFLQDYIQKSNNNAGQSSINAARLANEQADNTHRTNEDGSGDDDDDD
SEGNHSTAGSKRSSLVLSNELKTVVYADDLSDKTPTAATLLSHAQAQRPGIFPSQASIRRHPGQEPLLGPHSAHP
SQTIGSASAFISGQTALSVRQFPHFPSIDEAVGAGSTSTHGIAGREVWNWFQDHLDALLDSMRTFRFDQFEMHLR
SFWSNLAGNHREVVHAPAIAGLMAKADAIVYDEILEILRSQMLSPIPAASLTSLRQLALKMEKILLASLDGYGNT
FVEPKVELGARFGHLILRFLDIYQVTQALNTVLTNPKQLADMRRSWEKVDFESVRNQSALSNKNQLMGSSRVHST
PEERGGMSSRSVLIRWGYVTSQVMRDLTIRSDPAFGAFQILKLFLDDWIAVNVLRSVALSTNSVAASVEPVMQQQ
YFTLSPMAGQESFGSIDVRPTLIAQTPTTSSMLAALQSDAFPSTSLDPTSSAFGSDSYGTMQYMDPSSGQDDALS
SSHQATLSFSDFSGPGNAFDVGNYSQDLGISASGTPTSESDHEPESVKSEQT*
Coding >Agabi119p4|072750
ATGATTAATGTTCCACTCTGCGCTCTGGTGGTCTTTTTGACCACACAAGTTCTGGCTTCTCCCGCTCAGACACCT
CTGCGGGACGTCGTGTCGGAAAATGAAACAGCCACGTCTGCGGCCCCGAGGAAGCTGCACGGGCGCTTTTTGCAT
ATCACAGATATGCATCCAGACCCCCATTATAGTTTCCACGCATCAACTTCCAAGTCCTGTCACGGAAAGAAAGCG
AAGAAGAAGAGAAAGCGTGCGGGCTATTGGGGGACACCTGACGTTGAATGCGATTCGCCTTTGCGATTAATTGAT
TTGACGTTGGATTATCTGGACAAAAATTGGGCTGATGAGATAGATTTCGTTGTTTGGACGGGCGATAATGCTAGG
CATGACGAGGACCACCATATTCCTCGAACTCTTGACGAAATCCTCGACCAGAACAAGCGAATGGCAATGAAGATG
GAAAAAATATTTTCGAAAAAAGGTATTCCAGTAGTACCAAGTCTCGGCAATAACGATATATGGCCTCATAATATC
CTGGCTCCGGGCCCTAACAAGATCACAAACGAGTTTGCATCCTTATGGAGCCCGTTTATCCCCTTTCCTCAACGT
CAGGTGTTTCAACGGGGAGCGTATTATTCGACCGAAGTTATTCCCGGGCATCTGGCGGTGATCTCGTTGAATACG
CTCTATTTCTACGATTCGAACAAGGCTGTCGGTGGTTGTCAGTATGGAGATGATGACGACCCTGGAAATCTTGAG
TTTGATTGGCTGGAGGTGCAGTTGAAGCAGTTCCGCGACAAAAATATACAGGTGTATCTTACGGGACATATTCCT
CCTTCACTGGGAAATTATTACCCTGAATGTTACGTCCGATACACAGAGATGTCTTTACGATTCCAGGACACTATT
TTAGGACACCTTTATGGGCATATGAATCTAGATTATTTTTCATTCATGGAGGAGATTGATCTAGAAATCATTCCA
GGTGAGGAGGAAGAAGGGCCGAGGGCGAAAGGTGGTCGAAATGGGCTGTACGAAACGTTGCTACGGGAGTTTGAA
CAGCTGCCCGAGGAATCAGAAGAAGAGAGGCTGGATGGACTGGCCGTTATCAATGTGGCGCCCTCGGTGGTGCCG
AATCCGTTTGTGCCGGCGTTCAGGATATTCTCGTACAATGTTTCGGGGGATGGGCTGATGGGAGCGAGGAAGCAG
CGGGAACACGGGCATCGGCGAGGCCGGAAAGGGAACAAGGACGATGTTTGTAAGGACAAGCGGTATGACAAGTCG
TGGAAGTGCCACCTGCAAAAATCTTGGCACACGGATCGTGATGCGCCATCACGGAGGAATCAAGCATTGACGCCG
CTTGGGTATGCGCAGTACTATATGCCTGACATTGCGACGGCCAACAAGACACAGGCGCCGCGGTATGAGTTGGAG
TATGTCACATATCCGGTATCAGCGCTTGGGTCAGGTGACTGGGAACCTGTGCCGGTGCGACACCTGCCTCGGGCG
CTGCGGGAGGGGCGGAAGGGGAAGCGGTATGCGCCGTACGGGCTGCGGGATCTGACGGTCGGGTCGTGGGTGGGG
CTCGGGCGGCGGCTGGGGCAGGGGGCGGAGAAAAGGGATGTCGTTGTTGTCTTGACGATGGAGAACGCATATACT
TACCGAGTTGGATTTGACTGCGCCGTCGTCGAGGCCAGCGCAGAGCGGCAGACATCCAGAGCCCCCCCGCCAGCC
GCCGTGCTGCCTGTTTCGCCCATCCTCGGCTGGTCCGACCCCCCCACGATCCTTTCCCAGCACGACATGACCGCC
GTCAACATGCACATGCCCCTTGACTTTCTCCCCCACCACTCCCGCTCAAACTCGCTCTCCTCCGCCTCCACGCAC
TCCCGTCCTCATTCTTCCCAGGGCTCTATTCCTCGCATGCAGGCAGCAGGAACAGACGATCTCTATCGCCCCCCC
TACCACCTCCACCCTCCTCCCCTCCATCCCGATCCCTCCTCCTCGATCCACAACACAGCCCTAAAAGGCCCACTC
CGTCCGACCCACAACCGTGTCCGCGCTTCCCCCTACCCCCGTGACACCGACAGCGTCCATTCTTCCTCCTCCGAA
GCAGAAGACATCTCCATGTATCTAGGCCATCATCACACTCCCGAATACCAACCCTTGTATGGCGCTCCCCACACC
ATGGCCCCTAGCCCCGAGACCATGCATGCCGCAAACGCCTTTGGTCGTATGGCAATCAGCCAGGATCATGCCCTC
GAGAAACTCGCTGCCAATGTCCGTGCCGCCACCACCACCAGCGCTTCCGACCGGGCCAAACAAATTTTTGTCCAA
GCATGGCTAACTGCCAACTATGCCCCCTACCCCGATGGAAATGTCCCCCGTCAAGGATTGTATTTTTCATACCGT
CGTGTCTGTGACCAGTACGGGATCCCGCACATCAACACAGCCACGTTAGGCAAGGCCATCCGTCTCTGCTTCCCA
ACAATCAAAACACGGCGCTTAGGTGTCAGAGGCAACAGCAAATATCATTATTGCGGCATCAGACCCGCTACCACC
GCTGAAGCCGAATTTCTCCAGGACTATATCCAAAAGTCAAACAATAATGCCGGACAATCGTCCATTAATGCTGCT
CGCCTCGCAAATGAACAAGCTGATAACACTCATAGAACTAATGAAGACGGATCCGGGGATGATGATGACGACGAT
TCCGAAGGTAATCACTCCACCGCGGGTTCCAAACGCAGCTCGCTCGTCCTTTCAAACGAACTCAAAACTGTCGTC
TACGCTGATGACTTGAGCGACAAGACACCAACCGCCGCAACTCTGCTATCTCATGCTCAGGCTCAACGGCCTGGC
ATCTTTCCATCCCAGGCCTCCATACGAAGACACCCAGGTCAAGAACCTCTCCTAGGCCCGCACTCCGCTCATCCC
TCGCAGACTATTGGATCAGCGTCCGCCTTCATCTCTGGACAGACTGCTTTGTCAGTTCGACAGTTCCCCCACTTC
CCCTCGATCGATGAGGCCGTTGGAGCTGGTTCGACGTCTACCCATGGCATCGCTGGTCGCGAAGTTTGGAACTGG
TTTCAAGATCATTTGGATGCTCTTCTGGATAGTATGAGGACATTCCGCTTTGACCAATTTGAGATGCACCTGCGC
TCGTTCTGGTCCAATCTGGCTGGTAATCACCGTGAGGTTGTACATGCACCAGCAATCGCTGGATTAATGGCAAAG
GCTGATGCTATTGTATACGATGAAATTTTGGAGATTCTTCGCTCGCAGATGTTGTCCCCTATCCCTGCTGCGTCT
TTAACTAGTCTACGCCAGCTTGCTCTCAAGATGGAAAAAATTCTTTTGGCGTCCCTAGATGGCTATGGAAATACC
TTTGTTGAACCAAAGGTGGAGTTGGGTGCTCGTTTTGGTCATCTTATCTTGCGCTTCCTTGATATTTATCAAGTC
ACACAAGCCTTGAATACGGTCCTCACTAATCCTAAACAACTCGCTGATATGAGAAGGTCCTGGGAAAAAGTCGAT
TTTGAGTCTGTCCGCAACCAGTCGGCTTTGTCTAACAAAAACCAGCTCATGGGAAGCAGTCGTGTTCACAGCACT
CCGGAAGAGAGGGGTGGCATGAGTTCGCGCAGTGTTCTCATTCGTTGGGGCTATGTCACAAGTCAAGTCATGAGA
GATCTTACCATTCGCAGTGATCCCGCTTTCGGTGCTTTTCAGATACTAAAATTATTCCTTGATGATTGGATTGCC
GTCAACGTCCTTCGAAGCGTCGCTCTGTCCACCAACTCTGTTGCTGCCTCTGTTGAACCCGTGATGCAACAGCAG
TATTTCACACTTTCTCCGATGGCAGGCCAAGAAAGCTTTGGATCGATCGACGTACGGCCGACGCTGATAGCTCAA
ACCCCCACTACCTCGAGTATGCTTGCAGCACTTCAGTCTGACGCCTTCCCTTCTACTTCGTTGGATCCCACTTCA
TCGGCGTTTGGCTCCGATTCTTATGGGACGATGCAGTACATGGATCCTTCGAGCGGTCAGGATGACGCTTTATCA
TCGAGTCACCAAGCTACCCTGAGCTTTAGTGATTTTTCTGGTCCCGGAAATGCGTTTGATGTGGGTAATTATTCT
CAAGATTTGGGTATCAGCGCCTCTGGCACTCCGACGAGCGAGTCTGATCACGAACCAGAATCAGTCAAGTCTGAG
CAAACCTAA
Transcript >Agabi119p4|072750
ATGATTAATGTTCCACTCTGCGCTCTGGTGGTCTTTTTGACCACACAAGTTCTGGCTTCTCCCGCTCAGACACCT
CTGCGGGACGTCGTGTCGGAAAATGAAACAGCCACGTCTGCGGCCCCGAGGAAGCTGCACGGGCGCTTTTTGCAT
ATCACAGATATGCATCCAGACCCCCATTATAGTTTCCACGCATCAACTTCCAAGTCCTGTCACGGAAAGAAAGCG
AAGAAGAAGAGAAAGCGTGCGGGCTATTGGGGGACACCTGACGTTGAATGCGATTCGCCTTTGCGATTAATTGAT
TTGACGTTGGATTATCTGGACAAAAATTGGGCTGATGAGATAGATTTCGTTGTTTGGACGGGCGATAATGCTAGG
CATGACGAGGACCACCATATTCCTCGAACTCTTGACGAAATCCTCGACCAGAACAAGCGAATGGCAATGAAGATG
GAAAAAATATTTTCGAAAAAAGGTATTCCAGTAGTACCAAGTCTCGGCAATAACGATATATGGCCTCATAATATC
CTGGCTCCGGGCCCTAACAAGATCACAAACGAGTTTGCATCCTTATGGAGCCCGTTTATCCCCTTTCCTCAACGT
CAGGTGTTTCAACGGGGAGCGTATTATTCGACCGAAGTTATTCCCGGGCATCTGGCGGTGATCTCGTTGAATACG
CTCTATTTCTACGATTCGAACAAGGCTGTCGGTGGTTGTCAGTATGGAGATGATGACGACCCTGGAAATCTTGAG
TTTGATTGGCTGGAGGTGCAGTTGAAGCAGTTCCGCGACAAAAATATACAGGTGTATCTTACGGGACATATTCCT
CCTTCACTGGGAAATTATTACCCTGAATGTTACGTCCGATACACAGAGATGTCTTTACGATTCCAGGACACTATT
TTAGGACACCTTTATGGGCATATGAATCTAGATTATTTTTCATTCATGGAGGAGATTGATCTAGAAATCATTCCA
GGTGAGGAGGAAGAAGGGCCGAGGGCGAAAGGTGGTCGAAATGGGCTGTACGAAACGTTGCTACGGGAGTTTGAA
CAGCTGCCCGAGGAATCAGAAGAAGAGAGGCTGGATGGACTGGCCGTTATCAATGTGGCGCCCTCGGTGGTGCCG
AATCCGTTTGTGCCGGCGTTCAGGATATTCTCGTACAATGTTTCGGGGGATGGGCTGATGGGAGCGAGGAAGCAG
CGGGAACACGGGCATCGGCGAGGCCGGAAAGGGAACAAGGACGATGTTTGTAAGGACAAGCGGTATGACAAGTCG
TGGAAGTGCCACCTGCAAAAATCTTGGCACACGGATCGTGATGCGCCATCACGGAGGAATCAAGCATTGACGCCG
CTTGGGTATGCGCAGTACTATATGCCTGACATTGCGACGGCCAACAAGACACAGGCGCCGCGGTATGAGTTGGAG
TATGTCACATATCCGGTATCAGCGCTTGGGTCAGGTGACTGGGAACCTGTGCCGGTGCGACACCTGCCTCGGGCG
CTGCGGGAGGGGCGGAAGGGGAAGCGGTATGCGCCGTACGGGCTGCGGGATCTGACGGTCGGGTCGTGGGTGGGG
CTCGGGCGGCGGCTGGGGCAGGGGGCGGAGAAAAGGGATGTCGTTGTTGTCTTGACGATGGAGAACGCATATACT
TACCGAGTTGGATTTGACTGCGCCGTCGTCGAGGCCAGCGCAGAGCGGCAGACATCCAGAGCCCCCCCGCCAGCC
GCCGTGCTGCCTGTTTCGCCCATCCTCGGCTGGTCCGACCCCCCCACGATCCTTTCCCAGCACGACATGACCGCC
GTCAACATGCACATGCCCCTTGACTTTCTCCCCCACCACTCCCGCTCAAACTCGCTCTCCTCCGCCTCCACGCAC
TCCCGTCCTCATTCTTCCCAGGGCTCTATTCCTCGCATGCAGGCAGCAGGAACAGACGATCTCTATCGCCCCCCC
TACCACCTCCACCCTCCTCCCCTCCATCCCGATCCCTCCTCCTCGATCCACAACACAGCCCTAAAAGGCCCACTC
CGTCCGACCCACAACCGTGTCCGCGCTTCCCCCTACCCCCGTGACACCGACAGCGTCCATTCTTCCTCCTCCGAA
GCAGAAGACATCTCCATGTATCTAGGCCATCATCACACTCCCGAATACCAACCCTTGTATGGCGCTCCCCACACC
ATGGCCCCTAGCCCCGAGACCATGCATGCCGCAAACGCCTTTGGTCGTATGGCAATCAGCCAGGATCATGCCCTC
GAGAAACTCGCTGCCAATGTCCGTGCCGCCACCACCACCAGCGCTTCCGACCGGGCCAAACAAATTTTTGTCCAA
GCATGGCTAACTGCCAACTATGCCCCCTACCCCGATGGAAATGTCCCCCGTCAAGGATTGTATTTTTCATACCGT
CGTGTCTGTGACCAGTACGGGATCCCGCACATCAACACAGCCACGTTAGGCAAGGCCATCCGTCTCTGCTTCCCA
ACAATCAAAACACGGCGCTTAGGTGTCAGAGGCAACAGCAAATATCATTATTGCGGCATCAGACCCGCTACCACC
GCTGAAGCCGAATTTCTCCAGGACTATATCCAAAAGTCAAACAATAATGCCGGACAATCGTCCATTAATGCTGCT
CGCCTCGCAAATGAACAAGCTGATAACACTCATAGAACTAATGAAGACGGATCCGGGGATGATGATGACGACGAT
TCCGAAGGTAATCACTCCACCGCGGGTTCCAAACGCAGCTCGCTCGTCCTTTCAAACGAACTCAAAACTGTCGTC
TACGCTGATGACTTGAGCGACAAGACACCAACCGCCGCAACTCTGCTATCTCATGCTCAGGCTCAACGGCCTGGC
ATCTTTCCATCCCAGGCCTCCATACGAAGACACCCAGGTCAAGAACCTCTCCTAGGCCCGCACTCCGCTCATCCC
TCGCAGACTATTGGATCAGCGTCCGCCTTCATCTCTGGACAGACTGCTTTGTCAGTTCGACAGTTCCCCCACTTC
CCCTCGATCGATGAGGCCGTTGGAGCTGGTTCGACGTCTACCCATGGCATCGCTGGTCGCGAAGTTTGGAACTGG
TTTCAAGATCATTTGGATGCTCTTCTGGATAGTATGAGGACATTCCGCTTTGACCAATTTGAGATGCACCTGCGC
TCGTTCTGGTCCAATCTGGCTGGTAATCACCGTGAGGTTGTACATGCACCAGCAATCGCTGGATTAATGGCAAAG
GCTGATGCTATTGTATACGATGAAATTTTGGAGATTCTTCGCTCGCAGATGTTGTCCCCTATCCCTGCTGCGTCT
TTAACTAGTCTACGCCAGCTTGCTCTCAAGATGGAAAAAATTCTTTTGGCGTCCCTAGATGGCTATGGAAATACC
TTTGTTGAACCAAAGGTGGAGTTGGGTGCTCGTTTTGGTCATCTTATCTTGCGCTTCCTTGATATTTATCAAGTC
ACACAAGCCTTGAATACGGTCCTCACTAATCCTAAACAACTCGCTGATATGAGAAGGTCCTGGGAAAAAGTCGAT
TTTGAGTCTGTCCGCAACCAGTCGGCTTTGTCTAACAAAAACCAGCTCATGGGAAGCAGTCGTGTTCACAGCACT
CCGGAAGAGAGGGGTGGCATGAGTTCGCGCAGTGTTCTCATTCGTTGGGGCTATGTCACAAGTCAAGTCATGAGA
GATCTTACCATTCGCAGTGATCCCGCTTTCGGTGCTTTTCAGATACTAAAATTATTCCTTGATGATTGGATTGCC
GTCAACGTCCTTCGAAGCGTCGCTCTGTCCACCAACTCTGTTGCTGCCTCTGTTGAACCCGTGATGCAACAGCAG
TATTTCACACTTTCTCCGATGGCAGGCCAAGAAAGCTTTGGATCGATCGACGTACGGCCGACGCTGATAGCTCAA
ACCCCCACTACCTCGAGTATGCTTGCAGCACTTCAGTCTGACGCCTTCCCTTCTACTTCGTTGGATCCCACTTCA
TCGGCGTTTGGCTCCGATTCTTATGGGACGATGCAGTACATGGATCCTTCGAGCGGTCAGGATGACGCTTTATCA
TCGAGTCACCAAGCTACCCTGAGCTTTAGTGATTTTTCTGGTCCCGGAAATGCGTTTGATGTGGGTAATTATTCT
CAAGATTTGGGTATCAGCGCCTCTGGCACTCCGACGAGCGAGTCTGATCACGAACCAGAATCAGTCAAGTCTGAG
CAAACCTAA
Gene >Agabi119p4|072750
ATGATTAATGTTCCACTCTGCGCTCTGGTGGTCTTTTTGACCACACAAGTTCTGGCTTCTCCCGCTCAGACACCT
CTGCGGGACGTCGTGTCGGAAAATGAAACAGCCACGTCTGCGGGTAAGCTTATGTTCGGCCACAACGTTGCGATA
TCCAGAATAACCTTTGTCTTATAAGCCCCGAGGAAGCTGCACGGGCGCTTTTTGCATATCACAGATATGCATCCA
GACCCCCATTATAGTTTCCACGCATCAACTTCCAAGTCCTGTCACGGAAAGAAAGCGAAGAAGAAGAGAAAGCGT
GCGGGCTATTGGGGGACACCTGACGTGTATGTTAAACATAGTTCAAGCCAGTCCCAGCTGCTTATTGATTGATGT
TATTCTAACACAAAGTGAATGCGATTCGCCTTTGCGATTAATTGATTTGACGTTGGATTATCTGGACAAAAATTG
GGCTGATGAGATAGATTTCGTTGTTTGTACGTCATCTTTTTCAAAAAAAATTTCTAATACACATAATTTGAGAAG
GGACGGGCGATAATGCTAGGTGCGTATCTTATCTGTATCTGATTAACCAACCAATGGCCTAACGCAATCTGTCGA
TGTTTTCACAAAACCAGGCATGACGAGGACCACCATATTCCTCGAACTCTTGACGAAATCCTCGACCAGAACAAG
CGAATGGCAATGAAGATGGAAAAAATATTTTCGAAAAAAGGTATTCCAGTAGTACCAAGTCTCGGTGAGAGAATC
TATATCTTATTTAAATTCTTGGTGTAACCTTTTTTTTTTGTTTTTTGACACTAGGCAATAACGATATATGGCGTG
AGTTGAATCATTCTCTCATGTACCATTCGGGTGTTGACTGTATGTGTTCCTGTGTCCATTTAGCTCATGTAAGTG
CTTTGCCGCGCGCTTCTGCAAAACGCAAAACTCATTTATACAAATCTAACAACTTGACAACAGAATATCCTGGCT
CCGGGTGAGTTTGACGTCTGATTGGATGGAGTACGAATTAATCTCTTCCTCTTAGGCCCTAACAAGATCACAAAC
GAGTTTGCATCGTAGGTGGCCATTCTCATCACTGACGTATTCCTCGGCTGAATCAGTCATAGCTTATGGAGCCCG
TTTATCCCCTTTCCTCAACGTCAGGTGTTTCAACGGGGAGCGTATTATTCGACCGAAGTTATTCCCGGGCATCTG
GCGGTGATCTCGTTGAATACGCTCTATTTCTACGATTCGAACAAGGGTGAGCCAACAAATGATTATCATGTTTTG
TTTGATGGTTCTTTAACGTGATCGATTCAATAGCTGTCGGTGGTTGTCAGTATGGAGATGATGACGACCCTGGAA
ATCTTGAGTTTGATTGGCTGGAGGTGCAGTTGAAGCAGTTCCGCGACAAAAATATACAGGTAAGCATGCGGTTGA
ATTTAAAAAGTGGGTCACGGATGACTGATGCAAATAAAAAATTGCATTTTTTCCGGCAGGTGTATCTTACGGGTG
GGTGACATTCGCTCGCGCTTTATCGTGAAAAGGTGTTTAATGAGTGATAACAGGACATATTCCTCCTTCACTGGG
AAATTATTACCCTGAATGTGTGAGTATCAAAGCATAATTGTTGACAGAGAACACAGCTTTTGATCGATGAAACGG
TACATGGATACGAACAGTACGTCCGATACACAGAGATGTCTTTACGATTCCAGGACACTATTTTAGGACACCTTT
ATGGGGTAAGAGACAACTCGATTGAGAACTATAGATGGCTGATCGGATGCGATATTTTCCCAGCATATGAATCTA
GATTATGTAGGTGCCTTTTTAGATGAATTGAAACGCGGGAGTTGAATTAAGATGCATGTAGTTTTCATTCATGGA
GGAGATTGATCTAGAAATCATTCCAGGTGAGGAGGAAGAAGGGCCGAGGGCGAAAGGTGGTCGAAATGGGCTGTA
CGAAACGTTGCTACGGGAGTTTGAACAGCTGCCCGAGGAATCAGAAGAAGAGAGGCTGGATGGACTGGCCGTTAT
CAATGTGGCGCCCTCGGTGGTGCCGAATCCGTTTGTGCCGGCGTTCAGGATATTCTCGTACAATGTTTCGGGGGA
TGGGCTGATGGGAGCGAGGAAGCAGCGGGAACACGGGCATCGGCGAGGCCGGAAAGGGAACAAGGACGATGTTTG
TAAGGACAAGCGGTATGACAAGTCGTGGAAGTGCCACCTGCAAAAATCTTGGCACACGGATCGTGATGCGCCATC
ACGGAGGAATCAAGCATTGACGCCGCTTGGGTATGCGCAGGTAGGGGCACAGTTTCATCGGGGTACATAGAGCTG
AGGGAAGGTATATGCAGTACTATATGCCTGACATTGCGACGGCCAACAAGACACAGGCGCCGCGGTATGAGTTGG
AGTATGTCACATATCCGGTATCAGCGCTTGGGTCAGGTGACTGGGAACCTGTGCCGGTGCGACACCTGCCTCGGG
CGCTGCGGGAGGGGCGGAAGGGGAAGCGGTATGCGCCGTACGGGCTGCGGGATCTGACGGTCGGGTCGTGGGTGG
GGCTCGGGCGGCGGCTGGGGCAGGGGGCGGAGAAAAGGGTACGGCGACGGTTCAGGGAATACATGGGGGTGTCCG
GCTGAGTAAACAGAAATAAACAGGATGTCGTTGTTGTCTTGACGATGGAGAACGCATATACTTACCGAGTTGGAT
TTGACTGCGCCGTCGTCGAGGCCAGCGCAGAGCGGCAGACATCCAGAGCCCCCCCGCCAGCCGCCGTGCTGCCTG
TTTCGCCCATCCTCGGCTGGTCCGACCCCCCCACGATCCTTTCCCAGCACGACATGACCGCCGTCAACATGCACA
TGCCCCTTGACTTTCTCCCCCACCACTCCCGCTCAAACTCGCTCTCCTCCGCCTCCACGCACTCCCGTCCTCATT
CTTCCCAGGGCTCTATTCCTCGCATGCAGGCAGCAGGAACAGACGATCTCTATCGCCCCCCCTACCACCTCCACC
CTCCTCCCCTCCATCCCGATCCCGTACGTCTCTCCTTTGACCCTTTCCACTCTCTTTCTCACACTCCTCTAGTCC
TCCTCGATCCACAACACAGCCCTAAAAGGCCCACTCCGTCCGACCCACAACCGTGTCCGCGCTTCCCCCTACCCC
CGTGACACCGACAGCGTCCATTCTTCCTCCTCCGAAGCAGAAGACATCTCCATGTATCTAGGCCATCATCACACT
CCCGAATACCAACCCTTGTATGGCGCTCCCCACACCATGGCCCCTAGCCCCGAGACCATGCATGCCGCAAACGCC
TTTGGTCGTATGGCAATCAGCCAGGATCATGCCCTCGAGAAACTCGCTGCCAATGTCCGTGCCGCCACCACCACC
AGCGCTTCCGACCGGGCCAAACAAATTTTTGTCCAAGCATGGCAAGTTTTGTTTCCCTTATTGTTCTTTCTTTCG
CTCTCTTTCCTTTTCCTCTCACTGATCCGCTCTACACCCACAGGCTAACTGCCAACTATGCCCCCTACCCCGATG
GAAATGTCCCCCGTCAAGGATTGTATTTTTCATACCGTCGTGTCTGTGACCAGTACGGGATCCCGCACATCAACA
CAGCCACGTTAGGCAAGGCCATCCGTCTCTGCTTCCCAACAATCAAAACACGGCGCTTAGGTGTCAGAGGCAACA
GCAAATATCATTGCAAGTGTTTGATCATCTTTGTCCAGCACTGGTTCGGCCACTGATTTCGCATCCGTTGACAGA
TTGCGGCATCAGACCCGCTACCACCGCTGAAGCCGAATTTCTCCAGGACTATATCCAAAAGTCAAACAATAATGC
CGGACAATCGTCCATTAATGCTGCTCGCCTCGCAAATGAACAAGCTGATAACACTCATAGAACTAATGAAGACGG
ATCCGGGGATGATGATGACGACGATTCCGAAGGTAATCACTCCACCGCGGGTTCCAAACGCAGCTCGCTCGTCCT
TTCAAACGAACTCAAAACTGTCGTCTACGCTGATGACTTGAGCGACAAGACACCAACCGCCGCAACTCTGCTATC
TCATGCTCAGGCTCAACGGCCTGGCATCTTTCCATCCCAGGCCTCCATACGAAGACACCCAGGTCAAGAACCTCT
CCTAGGCCCGCACTCCGCTCATCCCTCGCAGACTATTGGATCAGCGTCCGCCTTCATCTCTGGACAGACTGCTTT
GTCAGTTCGACAGTTCCCCCACTTCCCCTCGATCGATGAGGCCGTTGGAGCTGGTTCGACGTCTACCCATGGCAT
CGCTGGTCGCGAAGTTTGGAACTGGTTTCAAGATCATTTGGATGCTCTTCTGGATAGTATGAGGACATTCCGCTT
TGACCAATTTGAGATGCACCTGCGCTCGTTCTGGTCCAATCTGGCTGGTAATCACCGTGAGGTTGTACATGCACC
AGCAATCGCTGGATTAATGGCAAAGGCTGATGCTATTGTATACGATGTACGTATTTCTCTGGGCGTGGACTAAGC
TGTCTCTGATCCGAGTTTTCTCAAGGAAATTTTGGAGATTCTTCGCTCGCAGATGTTGTCCCCTATCCCTGCTGC
GTCTTTAACTAGTCTACGCCAGCTTGCTCTCAAGATGGAAAAAATTCTTTTGGCGTCCCTAGATGGCTATGGAAA
TACCTTTGTTGAACCAAAGGTGGAGTTGGGTGCTCGTTTTGGTCATCTTATCTGTGCGTTCATTTTGTTTTGCTT
CAACATTGCCCTTGACAAATCGGTCTATAGTGCGCTTCCTTGATATTTATCAAGTCACACAAGCCTTGAATACGG
TCCTCACTAATCCTAAACAACTCGCTGATATGAGAAGGTCCTGGGAAAAAGTCGATTTTGAGTCTGTCCGCAACC
AGTCGGCTTTGGTGTGCAATTGTCGTCACGAAGAACTGGTGCAGTTGCTGGAGGTTGAATTCGTTGCTCTCTTGG
ACAGTCTAACAAAAACCAGTGAGCCAGTTCGAGAAGTCATGGCTTGGGCGGACAAATGTTGCGACAGGCTCATGG
GAAGCAGTCGTGTTCACAGCACTCCGGAAGAGAGGGGTGGCATGAGTTCGCGCAGTGTTCTCATTCGTTGGGGCT
ATGTCACAAGTCAAGTCATGAGAGATCTTGTGCGTCTTGACAATTGTTCTGTTTCTATCTTCGTTTTGATTGATG
ATCATGTGTAGACCATTCGCAGTGATCCCGCTTTCGGTGCTTTTCAGATACTAAAATTATTCCTTGAGTAAGTGC
TTCGCCCGCCATAATACACGGCTGTTGGTCTCGAACTCATGTTTACTCGTAGTGATTGGATTGCCGTCAACGTCC
TTCGAAGCGTCGCTCTGTCCACCAACTCTGTTGCTGCCTCTGTTGAACCCGTGATGCAACAGCAGTATTTCACAC
TTTCTCCGATGGCAGGCCAAGAAAGCTTTGGATCGATCGACGTACGGCCGACGCTGATAGCTCAAACCCCCACTA
CCTCGAGTATGCTTGCAGCACTTCAGTCTGACGCCTTCCCTTCTACTTCGTTGGATCCCACTTCATCGGCGTTTG
GCTCCGATTCTTATGGGACGATGCAGTACATGGATCCTTCGAGCGGTCAGGATGACGCTTTATCATCGAGTCACC
AAGCTACCCTGAGCTTTAGTGATTTTTCTGGTCCCGGAAATGCGTTTGATGTGGGTAATTATTCTCAAGATTTGG
GTATCAGCGCCTCTGGCACTCCGACGAGCGAGTCTGATCACGAACCAGAATCAGTCAAGTCTGAGCAAACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail