Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|072710
Gene name
Locationscaffold_04:1672717..1677019
Strand-
Gene length (bp)4302
Transcript length (bp)3138
Coding sequence length (bp)3138
Protein length (aa) 1046

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14671 DSPn Dual specificity protein phosphatase, N-terminal half 5.1E-40 396 560
PF00782 DSPc Dual specificity phosphatase, catalytic domain 2.0E-14 652 756

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B323|CDC14_EMENI Tyrosine-protein phosphatase cdcA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdcA PE=3 SV=1 393 950 7.0E-100
sp|Q00684|CDC14_YEAST Tyrosine-protein phosphatase CDC14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC14 PE=1 SV=2 432 951 1.0E-97
sp|Q9P7H1|FLP1_SCHPO Tyrosine-protein phosphatase CDC14 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clp1 PE=1 SV=1 446 975 3.0E-97
sp|Q59NH8|CDC14_CANAL Tyrosine-protein phosphatase CDC14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC14 PE=1 SV=1 461 865 1.0E-81
sp|Q6GQT0|CC14A_MOUSE Dual specificity protein phosphatase CDC14A OS=Mus musculus GN=Cdc14a PE=2 SV=2 438 771 2.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B323|CDC14_EMENI Tyrosine-protein phosphatase cdcA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdcA PE=3 SV=1 393 950 7.0E-100
sp|Q00684|CDC14_YEAST Tyrosine-protein phosphatase CDC14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC14 PE=1 SV=2 432 951 1.0E-97
sp|Q9P7H1|FLP1_SCHPO Tyrosine-protein phosphatase CDC14 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clp1 PE=1 SV=1 446 975 3.0E-97
sp|Q59NH8|CDC14_CANAL Tyrosine-protein phosphatase CDC14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC14 PE=1 SV=1 461 865 1.0E-81
sp|Q6GQT0|CC14A_MOUSE Dual specificity protein phosphatase CDC14A OS=Mus musculus GN=Cdc14a PE=2 SV=2 438 771 2.0E-79
sp|Q9UNH5|CC14A_HUMAN Dual specificity protein phosphatase CDC14A OS=Homo sapiens GN=CDC14A PE=1 SV=1 438 771 3.0E-79
sp|O60729|CC14B_HUMAN Dual specificity protein phosphatase CDC14B OS=Homo sapiens GN=CDC14B PE=1 SV=1 436 781 5.0E-79
sp|A6N3Q4|CC14C_SYMSY Dual specificity protein phosphatase CDC14C OS=Symphalangus syndactylus GN=CDC14C PE=3 SV=1 436 789 4.0E-77
sp|Q6PFY9|CC14B_MOUSE Dual specificity protein phosphatase CDC14B OS=Mus musculus GN=Cdc14b PE=2 SV=1 436 781 8.0E-77
sp|A4D256|CC14C_HUMAN Dual specificity protein phosphatase CDC14C OS=Homo sapiens GN=CDC14C PE=2 SV=2 436 781 8.0E-74
sp|P81299|CDC14_CAEEL Probable tyrosine-protein phosphatase cdc-14 OS=Caenorhabditis elegans GN=cdc-14 PE=1 SV=2 396 1003 7.0E-65
sp|Q9BVJ7|DUS23_HUMAN Dual specificity protein phosphatase 23 OS=Homo sapiens GN=DUSP23 PE=1 SV=1 676 760 4.0E-09
sp|Q6NT99|DUS23_MOUSE Dual specificity protein phosphatase 23 OS=Mus musculus GN=Dusp23 PE=1 SV=1 676 760 7.0E-09
sp|Q86BN8|PTPM1_DROME Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Drosophila melanogaster GN=Plip PE=2 SV=1 649 759 2.0E-08
sp|Q9D658|TP4A3_MOUSE Protein tyrosine phosphatase type IVA 3 OS=Mus musculus GN=Ptp4a3 PE=1 SV=1 648 762 7.0E-08
sp|Q12974|TP4A2_HUMAN Protein tyrosine phosphatase type IVA 2 OS=Homo sapiens GN=PTP4A2 PE=1 SV=1 651 762 1.0E-07
sp|O75365|TP4A3_HUMAN Protein tyrosine phosphatase type IVA 3 OS=Homo sapiens GN=PTP4A3 PE=1 SV=2 648 762 1.0E-07
sp|O70274|TP4A2_MOUSE Protein tyrosine phosphatase type IVA 2 OS=Mus musculus GN=Ptp4a2 PE=1 SV=1 651 762 1.0E-07
sp|Q6P9X4|TP4A2_RAT Protein tyrosine phosphatase type IVA 2 OS=Rattus norvegicus GN=Ptp4a2 PE=2 SV=1 651 762 1.0E-07
sp|Q9PUT6|PTEN_XENLA Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Xenopus laevis GN=pten PE=2 SV=1 648 763 1.0E-07
sp|A2VDT1|TP4A3_BOVIN Protein tyrosine phosphatase type IVA 3 OS=Bos taurus GN=PTP4A3 PE=2 SV=1 648 762 2.0E-07
sp|Q78EG7|TP4A1_RAT Protein tyrosine phosphatase type IVA 1 OS=Rattus norvegicus GN=Ptp4a1 PE=1 SV=1 648 762 3.0E-07
sp|Q63739|TP4A1_MOUSE Protein tyrosine phosphatase type IVA 1 OS=Mus musculus GN=Ptp4a1 PE=1 SV=1 648 762 3.0E-07
sp|Q9TSM6|TP4A1_MACFA Protein tyrosine phosphatase type IVA 1 OS=Macaca fascicularis GN=PTP4A1 PE=1 SV=1 648 762 3.0E-07
sp|Q93096|TP4A1_HUMAN Protein tyrosine phosphatase type IVA 1 OS=Homo sapiens GN=PTP4A1 PE=1 SV=2 648 762 3.0E-07
sp|Q5R7J8|TP4A1_PONAB Protein tyrosine phosphatase type IVA 1 OS=Pongo abelii GN=PTP4A1 PE=2 SV=1 648 766 4.0E-07
sp|Q6NZK8|PTPC1_MOUSE Protein tyrosine phosphatase domain-containing protein 1 OS=Mus musculus GN=Ptpdc1 PE=1 SV=1 710 754 6.0E-07
sp|A7E379|PTPC1_BOVIN Protein tyrosine phosphatase domain-containing protein 1 OS=Bos taurus GN=PTPDC1 PE=2 SV=2 710 754 8.0E-07
sp|A2A3K4|PTPC1_HUMAN Protein tyrosine phosphatase domain-containing protein 1 OS=Homo sapiens GN=PTPDC1 PE=2 SV=1 710 754 8.0E-07
sp|O55236|MCE1_MOUSE mRNA-capping enzyme OS=Mus musculus GN=Rngtt PE=1 SV=1 615 767 1.0E-06
sp|Q86IL4|TP4AB_DICDI Probable protein tyrosine phosphatase type IVA B OS=Dictyostelium discoideum GN=DDB_G0272662 PE=3 SV=4 649 762 1.0E-06
sp|O60942|MCE1_HUMAN mRNA-capping enzyme OS=Homo sapiens GN=RNGTT PE=1 SV=1 615 767 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016311 dephosphorylation Yes
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016787 hydrolase activity No
GO:0044237 cellular metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0006793 phosphorus metabolic process No
GO:0004721 phosphoprotein phosphatase activity No
GO:0003824 catalytic activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016791 phosphatase activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 44 63 19
3 70 92 22
4 122 144 22
5 229 248 19
6 254 276 22
7 295 314 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|072710
MTVRFGNNRLVFYIGVFLFSGAVLGLCAHLASQFLPNIHRDFSIFSLIVPSLTIFVFLLLLQWAQPNIEAVALFI
LGVLWLALAAWATDVIGHIQCDSLGGSTVVTHSGEMLASQWCREMKVIQAFSWMLFISYTFALIILITLVSRAQA
FGRFEIWSEPIRELPWFGEAPGYYNTSVAGAPSMPQAPYMGQYPYTQQPGGALVIQPDKQKMAFCPTFVIQVDAA
CKNVPIRTGAIVVTMLFVGHYVTKLMSSVFAFHLTQTSVAVLSIATLLFLVTMHNRREAQFLSQSEQEMLLIGGM
ALFWIAALVAWRGLRGGETSSAPSDVGSAGRGNRYLEDWPCRKNDVYCRVEEYRYCAVRLLHASSFLPLSSSPTR
HSAVTAFRMAPKCEPLCHFSDRLYFTTFPHPPPKPEVLNRLAADPGNQPRIRSCPRGGPSASPDDNTTYFYFTID
DQLLYLSFFQDWGPLNIAMVYKACIYIHELLEDKDLNQHRLVLYASDDPRKKANAALLMALYVMIVQRRAPWEAF
HPIAELEFMPFRDAGRGPSDFNLNIQDCLWGVWKAMQNGLCDMNEFSVEDYEYYEKVENGDWNWITPSFIAFASP
VDTNWIKREKEFKEGRIAAAGSTLGPPSAHPKNLALQRKLPTPFLNCLDYFEKRNIKLVVRLNTELYDRNTFLDR
GIDHMELYFDDGTNPTDEIVRTFIDVADRVIENGGVVAVHCKAGLGRTGTLIGAYLIWKYGFTANEVIAFMRIVR
PGSVVGPQQQYMYLKQLEWVKWAAADEMKKQQAAAMKPAAALVTPATPPADTDEEMDTRPATPPMNTVSLPPVTP
SRHVATAAAKAKSIAPPGQPRKTPKAKRLVEETEEEEENDALPALNVPATRNRSKTVSKPPVTRGVAASEQRPTR
VTRSTAGAANIRRAGTTAATTTSDSPSKATSTKQGPNKIPRLATTRTTGAARAVATTTTRQPSTRVPPSPILSRL
PTLVPSKRPHHTSSLSEVTGTVNPLKPSGAVPVGWVNNTTVVNPTHTTERPNLRSVRRRRSSFSNADVVA*
Coding >Agabi119p4|072710
ATGACTGTACGATTCGGAAACAACAGACTTGTATTCTACATTGGTGTGTTCCTCTTCTCGGGGGCGGTTTTGGGC
CTCTGCGCTCATCTAGCAAGCCAATTCTTGCCAAACATCCACAGGGACTTTTCAATTTTCTCGCTTATTGTACCT
TCTTTGACCATATTCGTGTTCCTCTTGCTGCTGCAATGGGCTCAACCCAATATCGAGGCTGTGGCTCTGTTCATT
TTGGGGGTACTTTGGCTCGCATTGGCGGCATGGGCGACCGACGTTATTGGACACATTCAATGCGATAGTTTGGGT
GGAAGCACCGTTGTAACTCACAGTGGTGAAATGTTGGCGTCACAATGGTGCCGCGAGATGAAGGTCATTCAGGCT
TTCTCCTGGATGCTCTTTATATCCTATACTTTTGCACTTATTATCCTGATCACTCTCGTTTCGCGTGCTCAAGCA
TTTGGACGGTTCGAAATCTGGTCGGAGCCCATTCGGGAGTTACCTTGGTTTGGCGAAGCGCCTGGATACTACAAT
ACTAGCGTGGCGGGAGCTCCATCCATGCCTCAAGCTCCTTACATGGGCCAATATCCTTATACTCAACAGCCGGGT
GGTGCTCTTGTTATCCAACCGGACAAACAAAAAATGGCCTTCTGTCCTACTTTTGTTATCCAAGTTGATGCCGCA
TGTAAAAACGTTCCAATCCGCACTGGAGCAATCGTTGTCACGATGCTATTCGTTGGGCACTATGTTACCAAGCTC
ATGTCTTCAGTTTTTGCCTTCCACCTGACGCAAACATCGGTTGCCGTGCTGTCAATTGCTACTTTACTCTTCTTG
GTGACGATGCATAACCGGAGAGAGGCGCAATTCCTATCACAGTCTGAACAAGAAATGCTTCTCATTGGTGGGATG
GCGCTGTTCTGGATTGCGGCTCTGGTAGCCTGGCGAGGGCTCCGAGGAGGGGAGACCAGCAGCGCGCCGTCGGAC
GTGGGTTCAGCTGGGAGAGGAAACAGGTACCTGGAGGACTGGCCATGCCGCAAGAACGATGTGTACTGCAGGGTC
GAGGAGTACAGATATTGTGCAGTTCGCCTGCTGCACGCTTCCTCCTTCCTTCCTCTTTCCTCTTCCCCCACGCGT
CACTCCGCCGTCACCGCCTTCCGGATGGCGCCCAAGTGCGAACCGTTATGTCATTTCAGCGACAGGCTCTATTTC
ACCACCTTTCCCCATCCACCCCCCAAACCGGAAGTCCTCAACAGACTCGCCGCCGATCCAGGAAATCAACCTCGC
ATTCGCTCATGTCCGAGGGGTGGCCCCTCCGCCTCTCCCGATGATAACACAACCTATTTCTACTTCACCATCGAC
GACCAGCTCCTTTATCTCTCTTTCTTCCAGGACTGGGGTCCGTTAAATATCGCCATGGTCTACAAGGCATGTATC
TATATCCACGAACTGCTTGAGGATAAGGATCTAAACCAGCATCGGCTCGTTCTGTACGCGTCTGATGATCCCCGT
AAGAAGGCTAATGCTGCACTACTCATGGCCTTATATGTCATGATCGTGCAGCGGCGTGCCCCATGGGAGGCTTTT
CATCCTATCGCTGAATTGGAATTCATGCCATTCAGGGATGCGGGACGGGGCCCCTCTGATTTCAATCTCAACATC
CAGGACTGCTTGTGGGGTGTGTGGAAGGCGATGCAAAACGGGCTTTGCGACATGAATGAATTTAGCGTTGAAGAT
TATGAATATTACGAAAAGGTTGAGAATGGAGATTGGAATTGGATAACGCCGAGTTTCATTGCGTTTGCGTCTCCA
GTTGATACCAACTGGATTAAACGTGAAAAGGAGTTTAAAGAAGGCAGAATCGCCGCGGCGGGATCTACCCTAGGT
CCACCCTCTGCCCATCCCAAAAACCTTGCTCTGCAACGCAAATTGCCGACACCTTTCCTCAACTGTCTGGATTAC
TTTGAAAAACGCAACATCAAGCTGGTCGTACGCCTCAATACCGAACTTTACGATCGAAATACCTTCTTGGATCGC
GGGATCGATCATATGGAACTATACTTTGATGACGGAACAAATCCAACTGATGAGATCGTGCGAACATTTATAGAC
GTAGCGGACCGTGTCATCGAGAATGGAGGAGTTGTTGCCGTTCATTGTAAGGCTGGCCTAGGAAGAACAGGGACT
CTCATCGGTGCATATCTCATCTGGAAATATGGATTCACAGCCAATGAAGTCATCGCATTTATGCGTATTGTGCGG
CCGGGGAGCGTGGTTGGACCTCAGCAGCAATACATGTACCTCAAACAACTGGAATGGGTGAAGTGGGCCGCAGCA
GATGAAATGAAGAAACAACAAGCTGCTGCTATGAAGCCGGCGGCGGCACTTGTTACTCCGGCGACACCACCAGCC
GATACGGATGAGGAGATGGACACCCGACCGGCGACACCACCAATGAATACCGTATCATTACCTCCCGTTACCCCC
AGTCGACATGTCGCCACAGCAGCTGCGAAAGCCAAGTCAATTGCACCTCCTGGACAGCCACGGAAAACTCCTAAA
GCAAAGAGGTTAGTGGAAGAGACAGAGGAGGAGGAAGAGAATGATGCCCTGCCTGCGCTGAATGTACCAGCTACT
CGCAACAGATCGAAGACGGTGTCAAAACCGCCGGTTACTCGTGGCGTTGCAGCATCAGAGCAGCGACCCACGCGA
GTTACGCGGTCCACAGCTGGTGCCGCAAACATTCGTCGAGCCGGGACAACAGCTGCCACGACAACGTCAGACTCA
CCGTCCAAAGCAACCAGCACGAAGCAGGGGCCGAACAAAATTCCTCGACTAGCTACTACAAGAACAACTGGTGCA
GCGCGAGCAGTTGCTACAACGACCACTAGACAACCCTCTACCCGTGTTCCCCCTTCCCCAATACTTTCTCGTTTA
CCCACCCTCGTACCTTCCAAACGGCCGCATCACACTTCATCATTAAGTGAGGTTACCGGGACCGTAAACCCACTC
AAACCATCAGGCGCTGTACCTGTTGGTTGGGTAAATAACACTACCGTCGTCAACCCAACACATACGACCGAACGA
CCGAATTTGAGAAGCGTCAGACGTCGCCGAAGTAGTTTTAGTAACGCCGACGTCGTGGCTTGA
Transcript >Agabi119p4|072710
ATGACTGTACGATTCGGAAACAACAGACTTGTATTCTACATTGGTGTGTTCCTCTTCTCGGGGGCGGTTTTGGGC
CTCTGCGCTCATCTAGCAAGCCAATTCTTGCCAAACATCCACAGGGACTTTTCAATTTTCTCGCTTATTGTACCT
TCTTTGACCATATTCGTGTTCCTCTTGCTGCTGCAATGGGCTCAACCCAATATCGAGGCTGTGGCTCTGTTCATT
TTGGGGGTACTTTGGCTCGCATTGGCGGCATGGGCGACCGACGTTATTGGACACATTCAATGCGATAGTTTGGGT
GGAAGCACCGTTGTAACTCACAGTGGTGAAATGTTGGCGTCACAATGGTGCCGCGAGATGAAGGTCATTCAGGCT
TTCTCCTGGATGCTCTTTATATCCTATACTTTTGCACTTATTATCCTGATCACTCTCGTTTCGCGTGCTCAAGCA
TTTGGACGGTTCGAAATCTGGTCGGAGCCCATTCGGGAGTTACCTTGGTTTGGCGAAGCGCCTGGATACTACAAT
ACTAGCGTGGCGGGAGCTCCATCCATGCCTCAAGCTCCTTACATGGGCCAATATCCTTATACTCAACAGCCGGGT
GGTGCTCTTGTTATCCAACCGGACAAACAAAAAATGGCCTTCTGTCCTACTTTTGTTATCCAAGTTGATGCCGCA
TGTAAAAACGTTCCAATCCGCACTGGAGCAATCGTTGTCACGATGCTATTCGTTGGGCACTATGTTACCAAGCTC
ATGTCTTCAGTTTTTGCCTTCCACCTGACGCAAACATCGGTTGCCGTGCTGTCAATTGCTACTTTACTCTTCTTG
GTGACGATGCATAACCGGAGAGAGGCGCAATTCCTATCACAGTCTGAACAAGAAATGCTTCTCATTGGTGGGATG
GCGCTGTTCTGGATTGCGGCTCTGGTAGCCTGGCGAGGGCTCCGAGGAGGGGAGACCAGCAGCGCGCCGTCGGAC
GTGGGTTCAGCTGGGAGAGGAAACAGGTACCTGGAGGACTGGCCATGCCGCAAGAACGATGTGTACTGCAGGGTC
GAGGAGTACAGATATTGTGCAGTTCGCCTGCTGCACGCTTCCTCCTTCCTTCCTCTTTCCTCTTCCCCCACGCGT
CACTCCGCCGTCACCGCCTTCCGGATGGCGCCCAAGTGCGAACCGTTATGTCATTTCAGCGACAGGCTCTATTTC
ACCACCTTTCCCCATCCACCCCCCAAACCGGAAGTCCTCAACAGACTCGCCGCCGATCCAGGAAATCAACCTCGC
ATTCGCTCATGTCCGAGGGGTGGCCCCTCCGCCTCTCCCGATGATAACACAACCTATTTCTACTTCACCATCGAC
GACCAGCTCCTTTATCTCTCTTTCTTCCAGGACTGGGGTCCGTTAAATATCGCCATGGTCTACAAGGCATGTATC
TATATCCACGAACTGCTTGAGGATAAGGATCTAAACCAGCATCGGCTCGTTCTGTACGCGTCTGATGATCCCCGT
AAGAAGGCTAATGCTGCACTACTCATGGCCTTATATGTCATGATCGTGCAGCGGCGTGCCCCATGGGAGGCTTTT
CATCCTATCGCTGAATTGGAATTCATGCCATTCAGGGATGCGGGACGGGGCCCCTCTGATTTCAATCTCAACATC
CAGGACTGCTTGTGGGGTGTGTGGAAGGCGATGCAAAACGGGCTTTGCGACATGAATGAATTTAGCGTTGAAGAT
TATGAATATTACGAAAAGGTTGAGAATGGAGATTGGAATTGGATAACGCCGAGTTTCATTGCGTTTGCGTCTCCA
GTTGATACCAACTGGATTAAACGTGAAAAGGAGTTTAAAGAAGGCAGAATCGCCGCGGCGGGATCTACCCTAGGT
CCACCCTCTGCCCATCCCAAAAACCTTGCTCTGCAACGCAAATTGCCGACACCTTTCCTCAACTGTCTGGATTAC
TTTGAAAAACGCAACATCAAGCTGGTCGTACGCCTCAATACCGAACTTTACGATCGAAATACCTTCTTGGATCGC
GGGATCGATCATATGGAACTATACTTTGATGACGGAACAAATCCAACTGATGAGATCGTGCGAACATTTATAGAC
GTAGCGGACCGTGTCATCGAGAATGGAGGAGTTGTTGCCGTTCATTGTAAGGCTGGCCTAGGAAGAACAGGGACT
CTCATCGGTGCATATCTCATCTGGAAATATGGATTCACAGCCAATGAAGTCATCGCATTTATGCGTATTGTGCGG
CCGGGGAGCGTGGTTGGACCTCAGCAGCAATACATGTACCTCAAACAACTGGAATGGGTGAAGTGGGCCGCAGCA
GATGAAATGAAGAAACAACAAGCTGCTGCTATGAAGCCGGCGGCGGCACTTGTTACTCCGGCGACACCACCAGCC
GATACGGATGAGGAGATGGACACCCGACCGGCGACACCACCAATGAATACCGTATCATTACCTCCCGTTACCCCC
AGTCGACATGTCGCCACAGCAGCTGCGAAAGCCAAGTCAATTGCACCTCCTGGACAGCCACGGAAAACTCCTAAA
GCAAAGAGGTTAGTGGAAGAGACAGAGGAGGAGGAAGAGAATGATGCCCTGCCTGCGCTGAATGTACCAGCTACT
CGCAACAGATCGAAGACGGTGTCAAAACCGCCGGTTACTCGTGGCGTTGCAGCATCAGAGCAGCGACCCACGCGA
GTTACGCGGTCCACAGCTGGTGCCGCAAACATTCGTCGAGCCGGGACAACAGCTGCCACGACAACGTCAGACTCA
CCGTCCAAAGCAACCAGCACGAAGCAGGGGCCGAACAAAATTCCTCGACTAGCTACTACAAGAACAACTGGTGCA
GCGCGAGCAGTTGCTACAACGACCACTAGACAACCCTCTACCCGTGTTCCCCCTTCCCCAATACTTTCTCGTTTA
CCCACCCTCGTACCTTCCAAACGGCCGCATCACACTTCATCATTAAGTGAGGTTACCGGGACCGTAAACCCACTC
AAACCATCAGGCGCTGTACCTGTTGGTTGGGTAAATAACACTACCGTCGTCAACCCAACACATACGACCGAACGA
CCGAATTTGAGAAGCGTCAGACGTCGCCGAAGTAGTTTTAGTAACGCCGACGTCGTGGCTTGA
Gene >Agabi119p4|072710
ATGACTGTACGATTCGGAAACAACAGACTTGTATTCTACAGTAAGTTGCCACCTCCATTGCAGCGAACATGAATG
ACCTCGATCGATCACTAGTTGGTGTGTTCCTCTTCTCGGGTATGTATAGCACCGCTTGTTCGTTCGAGACATTTT
CATCAACATATTTCAGGGGCGGTTTTGGGCCTCTGCGCTCATCTAGCAAGCCAATTCTTGCCAAACATCCACAGT
ATGTCCTAATTTCTTGTGGCACATGAACACACTGACGTTCGACGGCAGGGGACTTTTCAATTTTCTCGCTTATTG
TACCTTCTTTGACCATATTCGTGTTCCTCTTGCTGTGCGTCTCGACTACCATGAGTGGCTGTGAGAAAACTAAAT
CCTACCGACTATCTATTCGCGTAGGCTGCAATGGGCTCAACCCAATATCGAGGCTGTGGCTCTGTTCATTTTGGG
GGTACTTTGGCTCGGTGCGTAGTGGTAGCCTGGTGATATCAGTGGGGCCTAATCAAGTTTTTTTTCCCGCTCCAG
CATTGGCGGCATGGGCGACGTAAGTGACAGTTGGGGATTTCAACTCAGTATTTTGACTTGCCATTACAGCGACGT
TATTGGACACATTCAATGCGATAGTTTGGGTGGAAGCACCGTTGTAACTCACAGTGGTGAAAGTAAGGCTTCCCC
CATACTCTTCAGCCCGTCATCAAATTCACCATTAACACCTACAGTGTTGGCGTCACAATGGTGCCGCGAGATGAA
GGTCATTCAGGCTTTCTCCTGGATGCTCTTTATATCCTATACTTTTGCACTTATTATCCTGATCACTCTCGTTTC
GCGTGCTCAAGCATTTGGACGGTTCGAAATCTGGTCGGAGCCCATTCGGGGTAAGTATTTCACTGCTCCATTTAT
TTACTTCCGAAATTGATTTGTGCATGACCCGAACAGAGTTACCTTGGTTTGGCGAAGCGCCTGGATACTACAATA
CTAGCGTGGCGGGAGCTCCATCCATGCCTCAAGCTCCTTACATGGGCCAATATCCTTATACTCAACAGCCGGGTG
GTGCTCTTGTTATCCAACCGGGTGTCAATGGACAGATGCCCTCGATTACCCAGATACCTATTTCACAGCATGCTT
GAAGACAAACAAAAAATGGCCTTCTGTCCTACTTTTGTTATCCAAGTTGGTTAGGCTTGATCTCTTCATTTTCTG
ACCTGGGGGTTCATGTCCGCACAGATGCCGCATGTAAAAACGTGTATGCCTCGTGTGTCAATTGTATCGTAATAA
TATACGCATGAAATTTAGGGCTACTAGTTTGGGTTTCGCTCACTTCACAACTACATTCTACCCACCATCTATAAC
ATGCCTCTCTTTCGTGACAGTCCAATCCGCACTGGAGCAATCGGTAAGGCCAATTCGGCGGCACTCGAAATAGAG
TACTGAATGCTAGAATGCAGTTGTCACGATGCTATTCGTTGGGCACTATGTTACCAAGCTCATGTCTTCAGTTTG
TGAGTTGCAAAAATCACCATTGGAAGGGCACGAAAGATCAATAAACAATACAGTTGCCTTCCACCTGACGCAAAC
ATCGGTTGCCGTGCTGTCAATTGCTACTTTACTCTTCTTGTAAGTGACCGTAATATGCTGGGTGTGGGTGGACAG
TGATGTGATCGAACAGGGTGACGATGCATAACCGGAGAGAGGCGCAATTCCTATCACAGTCTGAACAAGAAATGC
TTCTCATTGGTGGGATGGCGCTGTTCTGGATTGGTGGGTATTTCTCTAAATGCTAGCCAACCACGTGGGTGCTGA
TAGTATGAAAAAGCGGCTCTGGTAGCCTGGCGAGGGCTCCGAGGAGGGGAGACCAGCAGCGCGCCGTCGGACGTG
GGTTCAGCTGGGAGAGGAAACAGGTACCTGGAGGACTGGCCATGCCGCAAGAACGATGTGTACTGCAGGGTCGAG
GAGTACAGATATTGGTAGACAACTTTGTAGATGTGACACAGGAATAAACAAAAGGCTCACGTGCGCGGGCGAGTG
CAGTTCGCCTGCTGCACGCTTCCTCCTTCCTTCCTCTTTCCTCTTCCCCCACGCGTCACTCCGCCGTCACCGCCT
TCCGGATGGCGCCCAAGTGCGAACCGTTATGTCATTTCAGCGACAGGTATCCACTCGCCCTACAAATCCGACCCT
TACTGACTCCATTCCAGGCTCTATTTCACCACCTTTCCCCATCCACCCCCCAAACCGGAAGTCCTCAACAGACTC
GCCGCCGATCCAGGAAATCAACCTCGCATTCGCTCATGTCCGAGGGGTGGCCCCTCCGCCTCTCCCGATGATAAC
ACAACCTATTTCTACTTCACCATCGACGACCAGCTCCTTTATCTCTCTTTCTTCCAGGACTGGGGTCCGTTAAAT
ATCGCCATGGTCTACAAGGCATGTATCTATATCCACGAACTGCTTGAGGTATGACCGCTATCACACCCTGCCACC
TCGTGTTCCTCACGTGTGCGACTCAAGGATAAGGATCTAAACCAGCATCGGCTCGTTCTGTACGCGTCTGATGAT
CCCCGTAAGAAGGCTAATGCTGCACTACTCATGGCCTTATATGTCGTGAGTATCCCCTTTTCCTTCTACTCCGTG
ATTTTCTTCTAAACAGCGTTCCTCAGATGATCGTGCAGCGGCGTGCCCCATGGGAGGCTTTTCATCCTATCGCTG
AATTGGAATTCATGCCATTCAGGGATGCGGGACGGGGCCCCTCTGATTTCAATCTCAACATCCAGGACTGCTTGT
GGGGTGTGTGGAAGGCGATGCAAAACGGGCTTTGCGACATGAATGAATTTAGCGTTGAAGATTATGAATATTACG
AAAAGGTTGAGAATGGAGATTGGAATTGGATAACGCCGAGTTTCATTGCGTTTGCGTCTCCAGTTGATACCAACT
GGATTAAACGTGAAAAGGAGTTTAAAGAAGGCAGAATCGCCGCGGCGGGATCTACCCTAGGTCCACCCTCTGCCC
ATCCCAAAAACCTTGCTCTGCAACGCAAATTGCCGACACCTTTCCTCAACTGTCTGGATTACTTTGAAAAACGCA
ACATCAAGCTGGTCGTACGCCTCAATACCGAACTTTACGATCGAAATACCTTCTTGGATCGCGGGATCGATCATA
TGGAACTATACTTTGATGACGGAACAAATCCAACTGATGAGATCGTGCGAACATTTATAGACGTAGCGGACCGTG
TCATCGAGAATGGAGGAGTTGTTGCCGTTCATGTGAGTAGCATTCGTGTCTTGAAGGCTATAATTATCCTCAGAA
CTTTGATAGTGTAAGGCTGGCCTAGGAAGAACAGGGACTCTCATCGGTGCATATCTCATCTGGAAATATGGATTC
ACAGCCAATGAAGTCATCGCATTTATGCGTATTGTGCGGCCGGGGAGCGTGGTTGGACCTCAGCAGCAATACATG
TACCTCAAACAACTGGAATGGGTGAAGTGGGCCGCAGCAGATGAAATGAAGAAACAACAAGCTGCTGCTATGAAG
CCGGCGGCGGCACTTGTTACTCCGGCGACACCACCAGCCGATACGGATGAGGAGATGGACACCCGACCGGCGACA
CCACCAATGAATACCGTATCATTACCTCCCGTTACCCCCAGTCGACATGTCGCCACAGCAGCTGCGAAAGCCAAG
TCAATTGCACCTCCTGGACAGCCACGGAAAACTCCTAAAGCAAAGAGGTTAGTGGAAGAGACAGAGGAGGAGGAA
GAGAATGATGCCCTGCCTGCGCTGAATGTACCAGCTACTCGCAACAGATCGAAGACGGTGTCAAAACCGCCGGTT
ACTCGTGGCGTTGCAGCATCAGAGCAGCGACCCACGCGAGTTACGCGGTCCACAGCTGGTGCCGCAAACATTCGT
CGAGCCGGGACAACAGCTGCCACGACAACGTCAGACTCACCGTCCAAAGCAACCAGCACGAAGCAGGGGCCGAAC
AAAATTCCTCGACTAGCTACTACAAGAACAACTGGTGCAGCGCGAGCAGTTGCTACAACGACCACTAGACAACCC
TCTACCCGTGTTCCCCCTTCCCCAATACTTTCTCGTTTACCCACCCTCGTACCTTCCAAACGGCCGCATCACACT
TCATCATTAAGTGAGGTTACCGGGACCGTAAACCCACTCAAACCATCAGGCGCTGTACCTGTTGGTTGGGTAAAT
AACACTACCGTCGTCAACCCAACACATACGACCGAACGACCGAATTTGAGAAGCGTCAGACGTCGCCGAAGTAGT
TTTAGTAACGCCGACGTCGTGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail